F442813

General Info

Members Datasets Scaffolds Average Seq Length
433 298 430 215

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10041635|Ga0099795_100416353
Length 235
Sequence MARLRIGVLISGRGSNLQALIDAAADPAYPAEIVLVISNRAEAEGLRRAADAGIAHQVVAERDRTAFAAAANGALRQNGVELIALAGFMRLLDTGFVEAWRDRMVNIHPSLLPAFPGLHPQRQALMAGARFSGCTVHFVRTEVDTGPIIAQAVVPVHDDXXXESLSARILTAEHRLYPLALRLHAEGRLRIDGNRVSVAGGTAPDIAALNPLEALASRGGSAIPRAEISQRARRR

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2773857925 Microvirga vignae BR3299 Isolate Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
77 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
78 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
79 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
80 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
81 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
188 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0.46
Rhizoplane 8.31
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10082464 3300005327 Bacteria 2642
2 Ga0070676_10058291 3300005328 Bacteria 2288
3 Ga0070683_100549889 3300005329 Bacteria 1104
4 Ga0070683_100896485 3300005329 Bacteria 851
5 Ga0068869_100513862 3300005334 Bacteria 1002
6 Ga0070666_10014445 3300005335 Bacteria 5028
7 Ga0070680_100135259 3300005336 Bacteria 2064
8 Ga0070680_100880957 3300005336 Bacteria 772
9 Ga0068868_100987400 3300005338 Unclassified 770
10 Ga0070660_100105585 3300005339 Bacteria 2236
11 Ga0070660_100517268 3300005339 Bacteria 994
12 Ga0070668_100163428 3300005347 Bacteria 1808
13 Ga0070668_100294609 3300005347 Bacteria 1359
14 Ga0070671_100325795 3300005355 Bacteria 1309
15 Ga0070659_100468478 3300005366 Bacteria 1071
16 Ga0070709_10003530 3300005434 Bacteria 8405
17 Ga0070714_100202879 3300005435 Bacteria 1814
18 Ga0070714_100284107 3300005435 Bacteria 1538
19 Ga0070713_100001980 3300005436 Bacteria 13222
20 Ga0070713_100004676 3300005436 Bacteria 9242
21 Ga0070713_100766905 3300005436 Unclassified 923
22 Ga0070710_10001979 3300005437 Bacteria 9711
23 Ga0070711_100128933 3300005439 Bacteria 1881
24 Ga0070711_100615256 3300005439 Bacteria 907
25 Ga0070708_100022231 3300005445 Bacteria 5376
26 Ga0070663_100058214 3300005455 Bacteria 2774
27 Ga0070662_100854666 3300005457 Unclassified 775
28 Ga0070681_10081987 3300005458 Bacteria 3181
29 Ga0070681_10195012 3300005458 Bacteria 1944
30 Ga0070681_10276625 3300005458 Bacteria 1590
31 Ga0070685_10007924 3300005466 Bacteria 5442
32 Ga0070706_100000049 3300005467 Bacteria 141287
33 Ga0070706_100014523 3300005467 Bacteria 7275
34 Ga0070707_100005499 3300005468 Bacteria 11845
35 Ga0070707_100013646 3300005468 Bacteria 7609
36 Ga0070698_100055749 3300005471 Bacteria 4005
37 Ga0070698_100311976 3300005471 Bacteria 1504
38 Ga0070699_100022639 3300005518 Bacteria 5416
39 Ga0070699_100835653 3300005518 Bacteria 843
40 Ga0070679_100383809 3300005530 Bacteria 1351
41 Ga0070679_100613673 3300005530 Bacteria 1031
42 Ga0070684_100133845 3300005535 Bacteria 2238
43 Ga0070684_100442595 3300005535 Bacteria 1200
44 Ga0070697_100045410 3300005536 Bacteria 3560
45 Ga0070696_100150462 3300005546 Unclassified 1708
46 Ga0070665_100531780 3300005548 Bacteria 1187
47 Ga0070665_100883827 3300005548 Unclassified 906
48 Ga0070704_100375127 3300005549 Bacteria 1207
49 Ga0068855_100397658 3300005563 Bacteria 1510
50 Ga0070664_100194793 3300005564 Bacteria 1806
51 Ga0070664_100375698 3300005564 Bacteria 1296
52 Ga0068857_100083595 3300005577 Bacteria 2852
53 Ga0068854_100073261 3300005578 Bacteria 2510
54 Ga0068856_100000082 3300005614 Bacteria 88302
55 Ga0068856_100025096 3300005614 Bacteria 5808
56 Ga0068856_100140564 3300005614 Bacteria 2421
57 Ga0068856_100185208 3300005614 Bacteria 2096
58 Ga0068856_100233714 3300005614 Bacteria 1854
59 Ga0070702_100013875 3300005615 Bacteria 4078
60 Ga0068852_100300174 3300005616 Bacteria 1554
61 Ga0068852_100398499 3300005616 Bacteria 1353
62 Ga0068859_100334467 3300005617 Bacteria 1609
63 Ga0068864_100027332 3300005618 Bacteria 4818
64 Ga0068861_100149395 3300005719 Bacteria 1916
65 Ga0068863_100033568 3300005841 Bacteria 4889
66 Ga0068858_100399478 3300005842 Unclassified 1320
67 Ga0068858_100401290 3300005842 Bacteria 1317
68 Ga0068860_100420010 3300005843 Bacteria 1325
69 Ga0070717_10000822 3300006028 Bacteria 20471
70 Ga0070717_10249235 3300006028 Bacteria 1568
71 Ga0075365_10188534 3300006038 Bacteria 1443
72 Ga0075365_10249487 3300006038 Bacteria 1247
73 Ga0070715_10001175 3300006163 Bacteria 7513
74 Ga0070716_100005712 3300006173 Bacteria 6042
75 Ga0097621_100024616 3300006237 Bacteria 4703
76 Ga0068871_100001532 3300006358 Bacteria 15499
77 Ga0075430_100057195 3300006846 Bacteria 3280
78 Ga0075431_100025010 3300006847 Bacteria 6121
79 Ga0075434_100029208 3300006871 Bacteria 5422
80 Ga0075434_100949254 3300006871 Bacteria 874
81 Ga0075429_100036912 3300006880 Bacteria 4253
82 Ga0068865_100087701 3300006881 Bacteria 2249
83 Ga0075436_100056593 3300006914 Bacteria 2708
84 Ga0075436_100063284 3300006914 Bacteria 2557
85 Ga0097620_100334490 3300006931 Bacteria 1609
86 Ga0075435_100033922 3300007076 Bacteria 4040
87 Ga0075435_100613804 3300007076 Unclassified 943
88 Ga0099795_10041635 3300007788 Bacteria 1636
89 Ga0105251_10008054 3300009011 Bacteria 6390
90 Ga0105240_10136975 3300009093 Bacteria 2931
91 Ga0105240_10191584 3300009093 Bacteria 2404
92 Ga0105240_10379673 3300009093 Bacteria 1596
93 Ga0111539_10351389 3300009094 Bacteria 1716
94 Ga0111539_10367269 3300009094 Bacteria 1675
95 Ga0105247_10259743 3300009101 Bacteria 1190
96 Ga0105247_10484985 3300009101 Unclassified 898
97 Ga0114129_10109702 3300009147 Bacteria 3809
98 Ga0114129_10899833 3300009147 Bacteria 1121
99 Ga0105243_10029809 3300009148 Bacteria 4198
100 Ga0105243_10720439 3300009148 Bacteria 975
101 Ga0105241_10022839 3300009174 Bacteria 4637
102 Ga0105242_10056179 3300009176 Bacteria 3221
103 Ga0105238_10062579 3300009551 Bacteria 3722
104 Ga0105238_11415368 3300009551 Bacteria 723
105 Ga0105249_10313259 3300009553 Bacteria 1578
106 Ga0105249_10683174 3300009553 Bacteria 1086
107 Ga0099796_10000728 3300010159 Bacteria 5856
108 Ga0105239_11301131 3300010375 Bacteria 838
109 Ga0105246_10291287 3300011119 Bacteria 1314
110 Ga0157336_1005434 3300012477 Unclassified 840
111 Ga0157324_1001374 3300012506 Bacteria 1332
112 Ga0157342_1005995 3300012507 Bacteria 1135
113 Ga0157315_1013295 3300012508 Unclassified 772
114 Ga0157316_1003834 3300012510 Bacteria 1108
115 Ga0157338_1000859 3300012515 Bacteria 1989
116 Ga0157370_10266939 3300013104 Bacteria 1581
117 Ga0157369_10261006 3300013105 Bacteria 1806
118 Ga0157374_10736238 3300013296 Bacteria 1000
119 Ga0157378_10519291 3300013297 Bacteria 1192
120 Ga0163162_10154327 3300013306 Bacteria 2415
121 Ga0157375_10229961 3300013308 Bacteria 2013
122 Ga0163163_10241365 3300014325 Bacteria 1856
123 Ga0157380_10031592 3300014326 Bacteria 4066
124 Ga0157380_10208700 3300014326 Bacteria 1739
125 Ga0157380_10287073 3300014326 Bacteria 1509
126 Ga0182008_10034859 3300014497 Bacteria 2523
127 Ga0182008_10044487 3300014497 Bacteria 2208
128 Ga0157379_10679778 3300014968 Bacteria 965
129 Ga0157376_10499390 3300014969 Bacteria 1195
130 Ga0213873_10050225 3300021358 Bacteria 1102
131 Ga0213875_10049912 3300021388 Bacteria 1961
132 Ga0209676_1000159 3300025292 Bacteria 161731
133 Ga0209050_1015498 3300025298 Bacteria 3194
134 Ga0207710_10002649 3300025900 Bacteria 8253
135 Ga0207680_10021180 3300025903 Bacteria 3514
136 Ga0207699_10012841 3300025906 Bacteria 4267
137 Ga0207699_10103324 3300025906 Bacteria 1812
138 Ga0207645_10057842 3300025907 Bacteria 2476
139 Ga0207705_10256510 3300025909 Bacteria 1334
140 Ga0207684_10000011 3300025910 Bacteria 502991
141 Ga0207654_10142304 3300025911 Bacteria 1531
142 Ga0207707_10140953 3300025912 Bacteria 2108
143 Ga0207707_10185944 3300025912 Bacteria 1813
144 Ga0207695_10166456 3300025913 Bacteria 2132
145 Ga0207695_10504311 3300025913 Bacteria 1092
146 Ga0207671_10060791 3300025914 Bacteria 2803
147 Ga0207693_10009353 3300025915 Bacteria 7990
148 Ga0207693_10028814 3300025915 Bacteria 4389
149 Ga0207663_10291682 3300025916 Bacteria 1215
150 Ga0207657_10114608 3300025919 Bacteria 2222
151 Ga0207657_10525390 3300025919 Bacteria 926
152 Ga0207649_10107666 3300025920 Bacteria 1856
153 Ga0207652_10213676 3300025921 Bacteria 1737
154 Ga0207646_10008409 3300025922 Bacteria 10348
155 Ga0207646_10575859 3300025922 Bacteria 1011
156 Ga0207694_10270678 3300025924 Bacteria 1393
157 Ga0207659_10035596 3300025926 Bacteria 3443
158 Ga0207700_10008262 3300025928 Bacteria 6433
159 Ga0207700_10012467 3300025928 Bacteria 5484
160 Ga0207664_10027142 3300025929 Bacteria 4337
161 Ga0207644_10035998 3300025931 Bacteria 3472
162 Ga0207706_10353631 3300025933 Bacteria 1277
163 Ga0207686_10046149 3300025934 Bacteria 2686
164 Ga0207709_10224470 3300025935 Bacteria 1357
165 Ga0207669_10174528 3300025937 Bacteria 1534
166 Ga0207704_10105432 3300025938 Bacteria 1891
167 Ga0207665_10060309 3300025939 Bacteria 2569
168 Ga0207711_10017313 3300025941 Bacteria 5988
169 Ga0207689_10488844 3300025942 Bacteria 1031
170 Ga0207661_10039367 3300025944 Bacteria 3710
171 Ga0207661_10545863 3300025944 Bacteria 1062
172 Ga0207679_10063181 3300025945 Bacteria 2763
173 Ga0207679_10773537 3300025945 Bacteria 874
174 Ga0207667_10063548 3300025949 Bacteria 3857
175 Ga0207667_10713791 3300025949 Bacteria 1004
176 Ga0207651_10420713 3300025960 Bacteria 1141
177 Ga0207712_10574889 3300025961 Bacteria 972
178 Ga0207658_10049041 3300025986 Bacteria 3100
179 Ga0207677_10031724 3300026023 Bacteria 3387
180 Ga0207639_10639958 3300026041 Bacteria 983
181 Ga0207678_10029152 3300026067 Bacteria 4817
182 Ga0207678_10406922 3300026067 Bacteria 1178
183 Ga0207702_10000048 3300026078 Bacteria 143125
184 Ga0207702_10187257 3300026078 Bacteria 1910
185 Ga0207641_10096191 3300026088 Bacteria 2600
186 Ga0207676_10132064 3300026095 Bacteria 2124
187 Ga0207675_100068700 3300026118 Bacteria 3311
188 Ga0207683_10002032 3300026121 Bacteria 17891
189 Ga0209179_1005421 3300027512 Bacteria 1994
190 Ga0209974_10023829 3300027876 Bacteria 2025
191 Ga0268266_10025477 3300028379 Bacteria 5032
192 Ga0268266_10646640 3300028379 Bacteria 1017
193 Ga0265330_10062629 3300031235 Bacteria 1617
194 Ga0265330_10062985 3300031235 Bacteria 1612
195 Ga0265332_10000227 3300031238 Bacteria 45207
196 Ga0265332_10006558 3300031238 Bacteria 5278
197 Ga0265328_10084878 3300031239 Bacteria 1168
198 Ga0265320_10028991 3300031240 Bacteria 2869
199 Ga0265325_10005176 3300031241 Bacteria 8103
200 Ga0265325_10055397 3300031241 Bacteria 2027
201 Ga0265325_10336702 3300031241 Bacteria 668
202 Ga0265340_10001172 3300031247 Bacteria 15004
203 Ga0265340_10009212 3300031247 Bacteria 5305
204 Ga0265340_10082122 3300031247 Bacteria 1516
205 Ga0265340_10084863 3300031247 Bacteria 1486
206 Ga0265339_10009213 3300031249 Bacteria 6224
207 Ga0265339_10215320 3300031249 Bacteria 942
208 Ga0265331_10029749 3300031250 Bacteria 2724
209 Ga0265331_10097472 3300031250 Bacteria 1356
210 Ga0265331_10128203 3300031250 Bacteria 1158
211 Ga0265316_10094085 3300031344 Bacteria 2283
212 Ga0265316_10109203 3300031344 Bacteria 2096
213 Ga0265313_10011747 3300031595 Bacteria 5419
214 Ga0265313_10039343 3300031595 Bacteria 2346
215 Ga0265314_10041082 3300031711 Bacteria 3314
216 Ga0265314_10294290 3300031711 Bacteria 913
217 Ga0265342_10000137 3300031712 Bacteria 81963
218 Ga0307413_10313624 3300031824 Bacteria 1195
219 Ga0307409_100118738 3300031995 Bacteria 2234
220 Ga0307416_100009899 3300032002 Bacteria 6270
221 Ga0307416_100364353 3300032002 Bacteria 1469
222 Ga0307415_100905722 3300032126 Bacteria 813
223 Ga0316583_10001495 3300032133 Bacteria 7836
224 Ga0373926_0023735 3300035083 Bacteria 2131
225 Ga0373928_0006359 3300035084 Bacteria 2273
226 Ga0373929_0018390 3300035085 Bacteria 1388
227 Ga0373934_0183477 3300035086 Bacteria 860
228 Ga0373949_0007194 3300035090 Bacteria 2440
229 Ga0373923_0064322 3300035111 Bacteria 1564
230 Ga0373932_0008573 3300035112 Bacteria 2445
231 Ga0373936_0004917 3300035113 Bacteria 5037
232 Ga0373939_0010588 3300035114 Bacteria 2310
233 Ga0373941_0038530 3300035115 Bacteria 1464
234 Ga0373941_0070779 3300035115 Bacteria 1157
235 Ga0373945_0005304 3300035116 Bacteria 4125
236 Ga0373945_0013651 3300035116 Bacteria 2714
237 Ga0373954_0082316 3300035118 Bacteria 1539
238 Ga0373956_0022004 3300035119 Bacteria 2724
239 Ga0373943_0022616 3300035170 Unclassified 2916
240 Ga0373946_0008284 3300035171 Bacteria 3815
241 Ga0373955_0009249 3300035172 Bacteria 4613
242 Ga0373961_0010488 3300035241 Bacteria 2284
243 Ga0316574_0205844 3300035398 Bacteria 1263
244 Ga0373924_0082072 3300035410 Bacteria 1372
245 Ga0373931_0004866 3300035691 Bacteria 6170
246 Ga0373931_0091428 3300035691 Bacteria 1696
247 Ga0373935_0005794 3300035692 Bacteria 7311
248 Ga0373927_0029540 3300035695 Bacteria 3573
249 Ga0373927_0043235 3300035695 Bacteria 2918
250 Ga0373927_0063218 3300035695 Bacteria 2394
251 Ga0373933_0000041 3300035724 Bacteria 79805
252 Ga0373933_0012503 3300035724 Bacteria 4688
253 Ga0373947_0001639 3300035725 Bacteria 13730
254 Ga0373947_0004271 3300035725 Bacteria 8386
255 Ga0373937_0360385 3300036401 Bacteria 1378
256 Ga0373937_0901082 3300036401 Bacteria 833
257 Ga0373925_0023367 3300037068 Bacteria 4511
258 Ga0373925_0080248 3300037068 Bacteria 2479
259 Ga0373925_0258327 3300037068 Bacteria 1399
260 Ga0373925_0405341 3300037068 Bacteria 1112
261 Ga0436364_0633668 3300037853 Bacteria 9751
262 Ga0400486_18375 3300038742 Bacteria 2765
263 Ga0400487_58895 3300039110 Bacteria 4452
264 Ga0436365_0606451 3300039437 Bacteria 1210
265 Ga0436365_1652338 3300039437 Bacteria 19999
266 Ga0436360_0216104 3300039438 Bacteria 1419
267 Ga0436361_0156887 3300039447 Bacteria 2717
268 Ga0436361_0281489 3300039447 Bacteria 791
269 Ga0436363_0187609 3300039450 Bacteria 1069
270 Ga0436362_0149843 3300039453 Bacteria 1827
271 Ga0436362_1037706 3300039453 Bacteria 1099
272 Ga0451807_1259783 3300041486 Bacteria 860
273 Ga0450890_036348 3300042127 Unclassified 717
274 Ga0451577_0068018 3300042876 Bacteria 3177
275 Ga0451577_0102500 3300042876 Bacteria 2557
276 Ga0451577_0182799 3300042876 Bacteria 1890
277 Ga0451577_0472807 3300042876 Bacteria 1138
278 Ga0451577_0688097 3300042876 Bacteria 926
279 Ga0466963_0202405 3300044694 Bacteria 1389
280 Ga0453684_0006774 3300044712 Bacteria 21561
281 Ga0453684_0043386 3300044712 Bacteria 6045
282 Ga0453684_0166876 3300044712 Bacteria 2598
283 Ga0453684_0447258 3300044712 Bacteria 1439
284 Ga0466959_0015780 3300045049 Bacteria 5510
285 Ga0451576_0001069 3300045051 Bacteria 50249
286 Ga0451576_0006250 3300045051 Bacteria 14662
287 Ga0451576_0241404 3300045051 Bacteria 1887
288 Ga0451576_0343975 3300045051 Bacteria 1562
289 Ga0495592_0068767 3300046454 Bacteria 2584
290 Ga0495603_0105123 3300046455 Bacteria 1647
291 Ga0495629_0000688 3300046459 Bacteria 27364
292 Ga0495641_0020267 3300046461 Bacteria 3376
293 Ga0495641_0051428 3300046461 Bacteria 1881
294 Ga0495580_0027556 3300046472 Bacteria 4133
295 Ga0495580_0049994 3300046472 Bacteria 2957
296 Ga0495582_0002698 3300046473 Bacteria 9908
297 Ga0495582_0011725 3300046473 Bacteria 4830
298 Ga0495639_0045983 3300046475 Bacteria 1975
299 Ga0495662_0037447 3300046476 Bacteria 2342
300 Ga0495584_0054179 3300046491 Bacteria 2019
301 Ga0495585_0013732 3300046492 Bacteria 4732
302 Ga0495594_0019571 3300046499 Bacteria 3598
303 Ga0495628_0026351 3300046516 Bacteria 4742
304 Ga0495630_0036667 3300046517 Bacteria 3665
305 Ga0495630_0096341 3300046517 Bacteria 2237
306 Ga0495643_0121547 3300046522 Bacteria 1319
307 Ga0495663_0042432 3300046525 Unclassified 1386
308 Ga0495666_0010363 3300046526 Bacteria 4645
309 Ga0495665_0002653 3300046531 Bacteria 9656
310 Ga0495586_0150969 3300046535 Unclassified 1307
311 Ga0495587_0075784 3300046536 Bacteria 1953
312 Ga0495622_0061458 3300046557 Bacteria 1739
313 Ga0495633_0004645 3300046558 Bacteria 8651
314 Ga0495667_0040453 3300046559 Bacteria 3095
315 Ga0495656_0000194 3300046615 Bacteria 21724
316 Ga0495634_0155945 3300046642 Unclassified 1441
317 Ga0495611_0004273 3300046648 Bacteria 6209
318 Ga0495635_0023837 3300046663 Bacteria 4264
319 Ga0495659_0004606 3300046664 Bacteria 4341
320 Ga0495588_0013111 3300046674 Bacteria 3940
321 Ga0495599_0007081 3300046678 Bacteria 6789
322 Ga0495646_0022708 3300046680 Bacteria 3954
323 Ga0495647_0007046 3300046681 Bacteria 3748
324 Ga0495658_0000246 3300046683 Bacteria 31009
325 Ga0495658_0005203 3300046683 Bacteria 6397
326 Ga0495669_0111904 3300046684 Unclassified 1275
327 Ga0495613_0034537 3300046689 Bacteria 3755
328 Ga0495670_0000200 3300046691 Bacteria 26865
329 Ga0495600_0002311 3300046809 Bacteria 10878
330 Ga0495674_0105056 3300047319 Bacteria 2400
331 Ga0495676_0235276 3300047321 Bacteria 1256
332 Ga0495680_0010106 3300047322 Bacteria 8439
333 Ga0495684_0007729 3300047471 Bacteria 8323
334 Ga0495615_0155183 3300048090 Unclassified 684
335 Ga0496100_0008551 3300048903 Bacteria 5712
336 Ga0496101_0332575 3300048904 Bacteria 1192
337 Ga0496102_0073107 3300048905 Bacteria 3151
338 Ga0496102_0227043 3300048905 Bacteria 1760
339 Ga0496102_0465205 3300048905 Bacteria 1185
340 Ga0496103_0033955 3300048906 Bacteria 3118
341 Ga0496104_0073744 3300048907 Bacteria 3247
342 Ga0496104_0257887 3300048907 Bacteria 1656
343 Ga0496104_0383266 3300048907 Bacteria 1318
344 Ga0496105_0135060 3300048908 Bacteria 2032
345 Ga0496105_0208731 3300048908 Bacteria 1592
346 Ga0496105_0254597 3300048908 Bacteria 1421
347 Ga0496106_0004190 3300048909 Bacteria 10751
348 Ga0496106_0054273 3300048909 Bacteria 3027
349 Ga0496106_0467017 3300048909 Unclassified 1014
350 Ga0496107_0002077 3300048910 Bacteria 12815
351 Ga0496108_0044492 3300048911 Bacteria 3705
352 Ga0496108_0763924 3300048911 Unclassified 835
353 Ga0496109_0035768 3300048912 Bacteria 4482
354 Ga0496109_0545784 3300048912 Bacteria 1093
355 Ga0496110_0068069 3300048913 Bacteria 3151
356 Ga0496110_0407906 3300048913 Unclassified 1239
357 Ga0496111_0008831 3300048914 Bacteria 6696
358 Ga0496112_0037123 3300048915 Bacteria 4757
359 Ga0496112_0226985 3300048915 Bacteria 1822
360 Ga0496112_0257099 3300048915 Bacteria 1696
361 Ga0496112_0370632 3300048915 Unclassified 1373
362 Ga0496112_0615203 3300048915 Bacteria 1017
363 Ga0496113_0114978 3300048916 Bacteria 2098
364 Ga0496113_0326429 3300048916 Bacteria 1230
365 Ga0496113_0372824 3300048916 Bacteria 1145
366 Ga0496114_0072409 3300048917 Bacteria 2898
367 Ga0496115_0096756 3300048918 Bacteria 2417
368 Ga0496115_0201835 3300048918 Bacteria 1642
369 Ga0496115_0415287 3300048918 Bacteria 1090
370 Ga0496126_0073025 3300048929 Bacteria 3051
371 Ga0501032_0365024 3300049569 Bacteria 929
372 Ga0501033_0696586 3300049570 Bacteria 691
373 Ga0501034_0234959 3300049571 Bacteria 1781
374 Ga0501036_0042851 3300049572 Bacteria 3832
375 Ga0501036_1021184 3300049572 Bacteria 677
376 Ga0501038_0055518 3300049574 Bacteria 3402
377 Ga0501038_0062043 3300049574 Bacteria 3195
378 Ga0501038_0526967 3300049574 Bacteria 901
379 Ga0501041_0407429 3300049577 Bacteria 862
380 Ga0501043_0067086 3300049579 Bacteria 2818
381 Ga0501047_0001978 3300049581 Bacteria 19663
382 Ga0501047_0009534 3300049581 Bacteria 9176
383 Ga0501048_0877924 3300049582 Bacteria 645
384 Ga0501067_0089304 3300049583 Bacteria 1710
385 Ga0501068_0214262 3300049584 Bacteria 1223
386 Ga0501069_0001433 3300049585 Bacteria 11699
387 Ga0501070_0002086 3300049586 Bacteria 17544
388 Ga0501071_0729953 3300049587 Bacteria 763
389 Ga0501072_0065161 3300049588 Bacteria 2873
390 Ga0501073_0000593 3300049589 Bacteria 25499
391 Ga0501073_0214834 3300049589 Bacteria 1329
392 Ga0501074_0001408 3300049590 Bacteria 16023
393 Ga0501075_0526795 3300049591 Bacteria 902
394 Ga0501076_0222884 3300049592 Bacteria 1541
395 Ga0501079_0007049 3300049741 Bacteria 8479
396 Ga0501079_0326204 3300049741 Bacteria 1202
397 Ga0501080_0092806 3300049742 Bacteria 2803
398 Ga0501083_0011585 3300049744 Bacteria 6184
399 Ga0501083_0017058 3300049744 Bacteria 5070
400 Ga0501083_0046687 3300049744 Bacteria 2927
401 Ga0501035_0132923 3300049822 Bacteria 2168
402 Ga0501045_0114227 3300049824 Bacteria 2002
403 nmdc:mga0yw44_152744_c1 3300050492 Bacteria 1507
404 nmdc:mga05p37_91860_c1 3300050507 Bacteria 3740
405 nmdc:mga0qj67_97617_c1 3300050509 Bacteria 2366
406 nmdc:mga08y16_454710_c1 3300050511 Bacteria 1305
407 nmdc:mga0n895_171463_c1 3300050512 Bacteria 2202
408 nmdc:mga0n895_32642_c1 3300050512 Bacteria 4998
409 nmdc:mga0n895_38169_c1 3300050512 Bacteria 4652
410 nmdc:mga0n895_68061_c1 3300050512 Bacteria 3527
411 nmdc:mga0rr50_10090_c1 3300050513 Bacteria 5976
412 nmdc:mga0rr50_188303_c1 3300050513 Bacteria 1690
413 nmdc:mga0rr50_287629_c1 3300050513 Bacteria 1373
414 nmdc:mga0rr50_52036_c1 3300050513 Bacteria 3041
415 nmdc:mga08x19_235634_c1 3300050514 Bacteria 1261
416 nmdc:mga08x19_73533_c1 3300050514 Bacteria 2232
417 Ga0495601_0304068 3300053077 Bacteria 1039
418 Ga0495595_0028099 3300053084 Bacteria 2510
419 Ga0495619_0001867 3300053085 Bacteria 14031
420 Ga0500562_000071 3300053108 Bacteria 49821
421 Ga0500616_0022616 3300053153 Bacteria 3508
422 Ga0500645_029575 3300053730 Bacteria 1653
423 Ga0501084_0042100 3300054114 Bacteria 3820
424 Ga0501084_0084814 3300054114 Bacteria 2659
425 Ga0501084_0794522 3300054114 Bacteria 797
426 Ga0501082_0029814 3300060353 Bacteria 4700
427 Ga0501082_0056457 3300060353 Bacteria 3382
428 Ga0501082_0081946 3300060353 Bacteria 2784
429 Ga0501082_0107740 3300060353 Bacteria 2411
430 Ga0466962_0099665 3300061719 Bacteria 1395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10081987 Ga0070681_100819873 183
2 3300025912 Ga0207707_10140953 Ga0207707_101409533 183
3 3300050513 nmdc:mga0rr50_287629_c1 nmdc:mga0rr50_287629_c1_798_1349 183
4 3300039447 Ga0436361_0281489 Ga0436361_0281489_199_753 184
5 3300031235 Ga0265330_10062629 Ga0265330_100626292 186
6 3300031247 Ga0265340_10084863 Ga0265340_100848632 186
7 3300031344 Ga0265316_10109203 Ga0265316_101092032 186
8 3300031595 Ga0265313_10011747 Ga0265313_100117472 186
9 3300031711 Ga0265314_10041082 Ga0265314_100410822 186
10 3300039453 Ga0436362_0149843 Ga0436362_0149843_742_1311 189
11 3300042876 Ga0451577_0068018 Ga0451577_0068018_668_1321 189
12 3300044712 Ga0453684_0043386 Ga0453684_0043386_1058_1771 189
13 3300049744 Ga0501083_0046687 Ga0501083_0046687_1245_1814 189
14 3300054114 Ga0501084_0084814 Ga0501084_0084814_1298_1915 189
15 3300060353 Ga0501082_0056457 Ga0501082_0056457_2125_2742 189
16 3300031241 Ga0265325_10336702 Ga0265325_103367022 191
17 3300031247 Ga0265340_10001172 Ga0265340_1000117213 191
18 3300031247 Ga0265340_10082122 Ga0265340_100821222 191
19 3300031595 Ga0265313_10039343 Ga0265313_100393433 191
20 3300005614 Ga0068856_100185208 Ga0068856_1001852082 192
21 3300044694 Ga0466963_0202405 Ga0466963_0202405_670_1248 192
22 3300041486 Ga0451807_1259783 Ga0451807_1259783_216_797 193
23 3300046522 Ga0495643_0121547 Ga0495643_0121547_717_1298 193
24 3300053730 Ga0500645_029575 Ga0500645_029575_601_1182 193
25 3300005471 Ga0070698_100311976 Ga0070698_1003119761 195
26 3300049572 Ga0501036_1021184 Ga0501036_1021184_11_601 195
27 3300049579 Ga0501043_0067086 Ga0501043_0067086_625_1212 195
28 3300042876 Ga0451577_0472807 Ga0451577_0472807_138_791 196
29 3300021358 Ga0213873_10050225 Ga0213873_100502252 198
30 3300039437 Ga0436365_1652338 Ga0436365_1652338_17573_18271 198
31 3300039453 Ga0436362_1037706 Ga0436362_1037706_192_890 198
32 3300049581 Ga0501047_0001978 Ga0501047_0001978_6197_6796 198
33 3300049583 Ga0501067_0089304 Ga0501067_0089304_592_1191 198
34 3300049584 Ga0501068_0214262 Ga0501068_0214262_574_1173 198
35 3300049585 Ga0501069_0001433 Ga0501069_0001433_1192_1791 198
36 3300049586 Ga0501070_0002086 Ga0501070_0002086_15640_16239 198
37 3300049588 Ga0501072_0065161 Ga0501072_0065161_1079_1678 198
38 3300049589 Ga0501073_0000593 Ga0501073_0000593_12508_13107 198
39 3300049590 Ga0501074_0001408 Ga0501074_0001408_3974_4573 198
40 3300049741 Ga0501079_0007049 Ga0501079_0007049_2189_2788 198
41 3300049742 Ga0501080_0092806 Ga0501080_0092806_92_691 198
42 3300049744 Ga0501083_0011585 Ga0501083_0011585_1210_1809 198
43 3300049822 Ga0501035_0132923 Ga0501035_0132923_912_1511 198
44 3300054114 Ga0501084_0042100 Ga0501084_0042100_2413_3012 198
45 3300060353 Ga0501082_0107740 Ga0501082_0107740_1256_1855 198
46 3300032126 Ga0307415_100905722 Ga0307415_1009057221 199
47 3300035691 Ga0373931_0091428 Ga0373931_0091428_478_1155 199
48 3300039447 Ga0436361_0156887 Ga0436361_0156887_1148_1789 199
49 3300045051 Ga0451576_0006250 Ga0451576_0006250_1685_2338 199
50 3300005467 Ga0070706_100000049 Ga0070706_10000004972 200
51 3300005468 Ga0070707_100005499 Ga0070707_1000054999 200
52 3300005536 Ga0070697_100045410 Ga0070697_1000454103 200
53 3300025910 Ga0207684_10000011 Ga0207684_10000011152 200
54 3300031238 Ga0265332_10000227 Ga0265332_1000022732 200
55 3300031247 Ga0265340_10009212 Ga0265340_100092123 200
56 3300031249 Ga0265339_10009213 Ga0265339_100092135 200
57 3300031250 Ga0265331_10128203 Ga0265331_101282031 200
58 3300031712 Ga0265342_10000137 Ga0265342_1000013773 200
59 3300006871 Ga0075434_100029208 Ga0075434_1000292084 201
60 3300007076 Ga0075435_100033922 Ga0075435_1000339223 201
61 3300009147 Ga0114129_10109702 Ga0114129_101097025 201
62 3300039438 Ga0436360_0216104 Ga0436360_0216104_59_664 201
63 3300039450 Ga0436363_0187609 Ga0436363_0187609_130_738 201
64 3300044712 Ga0453684_0447258 Ga0453684_0447258_774_1412 201
65 3300045049 Ga0466959_0015780 Ga0466959_0015780_4041_4649 201
66 3300049582 Ga0501048_0877924 Ga0501048_0877924_19_624 201
67 3300050507 nmdc:mga05p37_91860_c1 nmdc:mga05p37_91860_c1_838_1458 201
68 3300050513 nmdc:mga0rr50_188303_c1 nmdc:mga0rr50_188303_c1_422_1042 201
69 3300061719 Ga0466962_0099665 Ga0466962_0099665_325_933 201
70 3300005435 Ga0070714_100284107 Ga0070714_1002841072 202
71 3300005439 Ga0070711_100615256 Ga0070711_1006152561 202
72 3300005614 Ga0068856_100025096 Ga0068856_1000250967 202
73 3300006028 Ga0070717_10249235 Ga0070717_102492353 202
74 3300006914 Ga0075436_100056593 Ga0075436_1000565933 202
75 3300025906 Ga0207699_10103324 Ga0207699_101033241 202
76 3300025915 Ga0207693_10028814 Ga0207693_100288144 202
77 3300025928 Ga0207700_10012467 Ga0207700_100124678 202
78 3300025929 Ga0207664_10027142 Ga0207664_100271425 202
79 3300025939 Ga0207665_10060309 Ga0207665_100603091 202
80 3300031235 Ga0265330_10062985 Ga0265330_100629853 202
81 3300031238 Ga0265332_10006558 Ga0265332_100065582 202
82 3300031239 Ga0265328_10084878 Ga0265328_100848782 202
83 3300031241 Ga0265325_10005176 Ga0265325_100051768 202
84 3300031249 Ga0265339_10215320 Ga0265339_102153202 202
85 3300031250 Ga0265331_10029749 Ga0265331_100297493 202
86 3300031250 Ga0265331_10097472 Ga0265331_100974722 202
87 3300031344 Ga0265316_10094085 Ga0265316_100940852 202
88 3300031711 Ga0265314_10294290 Ga0265314_102942902 202
89 3300035115 Ga0373941_0070779 Ga0373941_0070779_462_1139 202
90 3300037853 Ga0436364_0633668 Ga0436364_0633668_7724_8344 202
91 3300049570 Ga0501033_0696586 Ga0501033_0696586_27_635 202
92 3300049574 Ga0501038_0526967 Ga0501038_0526967_224_886 202
93 3300050513 nmdc:mga0rr50_52036_c1 nmdc:mga0rr50_52036_c1_1099_1776 202
94 3300050514 nmdc:mga08x19_73533_c1 nmdc:mga08x19_73533_c1_912_1589 202
95 3300046642 Ga0495634_0155945 Ga0495634_0155945_93_704 203
96 3300048090 Ga0495615_0155183 Ga0495615_0155183_32_643 203
97 3300048911 Ga0496108_0763924 Ga0496108_0763924_41_652 203
98 3300036401 Ga0373937_0360385 Ga0373937_0360385_15_638 204
99 3300005445 Ga0070708_100022231 Ga0070708_1000222316 206
100 3300005467 Ga0070706_100014523 Ga0070706_1000145233 206
101 3300005468 Ga0070707_100013646 Ga0070707_1000136464 206
102 3300005471 Ga0070698_100055749 Ga0070698_1000557494 206
103 3300005518 Ga0070699_100022639 Ga0070699_1000226396 206
104 3300025922 Ga0207646_10008409 Ga0207646_100084095 206
105 3300042127 Ga0450890_036348 Ga0450890_036348_11_637 206
106 3300049591 Ga0501075_0526795 Ga0501075_0526795_109_735 206
107 3300005436 Ga0070713_100766905 Ga0070713_1007669051 207
108 3300010159 Ga0099796_10000728 Ga0099796_100007284 207
109 3300014497 Ga0182008_10044487 Ga0182008_100444872 207
110 3300025922 Ga0207646_10575859 Ga0207646_105758592 207
111 3300025945 Ga0207679_10063181 Ga0207679_100631813 207
112 3300027512 Ga0209179_1005421 Ga0209179_10054212 207
113 3300035116 Ga0373945_0013651 Ga0373945_0013651_394_1035 207
114 3300035695 Ga0373927_0063218 Ga0373927_0063218_526_1167 207
115 3300035725 Ga0373947_0004271 Ga0373947_0004271_7244_7885 207
116 3300037068 Ga0373925_0258327 Ga0373925_0258327_532_1167 207
117 3300037068 Ga0373925_0405341 Ga0373925_0405341_100_741 207
118 3300046472 Ga0495580_0027556 Ga0495580_0027556_1320_1961 207
119 3300048909 Ga0496106_0467017 Ga0496106_0467017_199_876 207
120 3300048913 Ga0496110_0407906 Ga0496110_0407906_117_794 207
121 3300048915 Ga0496112_0370632 Ga0496112_0370632_58_735 207
122 3300048929 Ga0496126_0073025 Ga0496126_0073025_649_1275 207
123 3300050492 nmdc:mga0yw44_152744_c1 nmdc:mga0yw44_152744_c1_586_1242 207
124 3300053108 Ga0500562_000071 Ga0500562_000071_47959_48582 207
125 3300005435 Ga0070714_100202879 Ga0070714_1002028791 208
126 3300005616 Ga0068852_100300174 Ga0068852_1003001742 208
127 3300014497 Ga0182008_10034859 Ga0182008_100348592 208
128 3300042876 Ga0451577_0182799 Ga0451577_0182799_993_1646 208
129 3300044712 Ga0453684_0166876 Ga0453684_0166876_499_1152 208
130 3300021388 Ga0213875_10049912 Ga0213875_100499122 209
131 3300053077 Ga0495601_0304068 Ga0495601_0304068_223_927 210
132 iso_pu_bacteria 2773857925 2774872614 210
133 3300005518 Ga0070699_100835653 Ga0070699_1008356532 211
134 iso_pu_bacteria 2508501050 2508728442 211
135 iso_pu_bacteria 2508501114 2509078420 211
136 3300035410 Ga0373924_0082072 Ga0373924_0082072_306_962 212
137 3300048915 Ga0496112_0615203 Ga0496112_0615203_359_997 212
138 3300050512 nmdc:mga0n895_32642_c1 nmdc:mga0n895_32642_c1_21_659 212
139 3300009147 Ga0114129_10899833 Ga0114129_108998331 214
140 3300027876 Ga0209974_10023829 Ga0209974_100238292 214
141 3300005329 Ga0070683_100549889 Ga0070683_1005498891 215
142 3300005347 Ga0070668_100294609 Ga0070668_1002946092 215
143 3300005535 Ga0070684_100133845 Ga0070684_1001338452 215
144 3300005549 Ga0070704_100375127 Ga0070704_1003751271 215
145 3300006038 Ga0075365_10188534 Ga0075365_101885342 215
146 3300007788 Ga0099795_10041635 Ga0099795_100416353 215
147 3300009094 Ga0111539_10351389 Ga0111539_103513893 215
148 3300009148 Ga0105243_10720439 Ga0105243_107204392 215
149 3300009551 Ga0105238_11415368 Ga0105238_114153681 215
150 3300014325 Ga0163163_10241365 Ga0163163_102413653 215
151 3300014326 Ga0157380_10031592 Ga0157380_100315922 215
152 3300025292 Ga0209676_1000159 Ga0209676_100015976 215
153 3300025298 Ga0209050_1015498 Ga0209050_10154982 215
154 3300025944 Ga0207661_10545863 Ga0207661_105458632 215
155 3300025960 Ga0207651_10420713 Ga0207651_104207132 215
156 3300031824 Ga0307413_10313624 Ga0307413_103136241 215
157 3300031995 Ga0307409_100118738 Ga0307409_1001187382 215
158 3300032002 Ga0307416_100009899 Ga0307416_1000098993 215
159 3300035170 Ga0373943_0022616 Ga0373943_0022616_2076_2738 215
160 3300035695 Ga0373927_0043235 Ga0373927_0043235_1854_2528 215
161 3300039437 Ga0436365_0606451 Ga0436365_0606451_22_696 215
162 3300050511 nmdc:mga08y16_454710_c1 nmdc:mga08y16_454710_c1_31_693 215
163 3300005458 Ga0070681_10276625 Ga0070681_102766253 216
164 3300005530 Ga0070679_100613673 Ga0070679_1006136732 216
165 3300006846 Ga0075430_100057195 Ga0075430_1000571955 216
166 3300006847 Ga0075431_100025010 Ga0075431_1000250105 216
167 3300006880 Ga0075429_100036912 Ga0075429_1000369122 216
168 3300009093 Ga0105240_10136975 Ga0105240_101369752 216
169 3300010375 Ga0105239_11301131 Ga0105239_113011312 216
170 3300025913 Ga0207695_10166456 Ga0207695_101664564 216
171 3300032002 Ga0307416_100364353 Ga0307416_1003643532 216
172 3300036401 Ga0373937_0901082 Ga0373937_0901082_64_717 216
173 3300042876 Ga0451577_0102500 Ga0451577_0102500_457_1137 216
174 3300042876 Ga0451577_0688097 Ga0451577_0688097_51_731 216
175 3300044712 Ga0453684_0006774 Ga0453684_0006774_8945_9625 216
176 3300045051 Ga0451576_0241404 Ga0451576_0241404_161_841 216
177 3300046517 Ga0495630_0096341 Ga0495630_0096341_190_846 216
178 3300049572 Ga0501036_0042851 Ga0501036_0042851_2207_2887 216
179 3300049592 Ga0501076_0222884 Ga0501076_0222884_237_917 216
180 3300049824 Ga0501045_0114227 Ga0501045_0114227_1087_1767 216
181 3300050509 nmdc:mga0qj67_97617_c1 nmdc:mga0qj67_97617_c1_1637_2287 216
182 3300050512 nmdc:mga0n895_68061_c1 nmdc:mga0n895_68061_c1_49_705 216
183 3300060353 Ga0501082_0081946 Ga0501082_0081946_386_1066 216
184 3300005436 Ga0070713_100004676 Ga0070713_1000046768 217
185 3300012510 Ga0157316_1003834 Ga0157316_10038342 217
186 3300014326 Ga0157380_10208700 Ga0157380_102087003 217
187 3300031241 Ga0265325_10055397 Ga0265325_100553973 217
188 3300035086 Ga0373934_0183477 Ga0373934_0183477_49_702 217
189 3300035724 Ga0373933_0000041 Ga0373933_0000041_44272_44925 217
190 3300038742 Ga0400486_18375 Ga0400486_18375_409_1071 217
191 3300039110 Ga0400487_58895 Ga0400487_58895_1032_1694 217
192 3300049741 Ga0501079_0326204 Ga0501079_0326204_58_711 217
193 3300053153 Ga0500616_0022616 Ga0500616_0022616_2740_3393 217
194 3300005577 Ga0068857_100083595 Ga0068857_1000835954 218
195 3300005614 Ga0068856_100000082 Ga0068856_10000008292 218
196 3300006038 Ga0075365_10249487 Ga0075365_102494872 218
197 3300026078 Ga0207702_10000048 Ga0207702_1000004885 218
198 3300031240 Ga0265320_10028991 Ga0265320_100289912 218
199 3300035398 Ga0316574_0205844 Ga0316574_0205844_125_787 218
200 3300045051 Ga0451576_0001069 Ga0451576_0001069_48354_49016 218
201 3300049569 Ga0501032_0365024 Ga0501032_0365024_161_817 218
202 3300049571 Ga0501034_0234959 Ga0501034_0234959_503_1159 218
203 3300049574 Ga0501038_0055518 Ga0501038_0055518_1665_2321 218
204 3300049577 Ga0501041_0407429 Ga0501041_0407429_31_696 218
205 3300049581 Ga0501047_0009534 Ga0501047_0009534_2604_3260 218
206 3300049587 Ga0501071_0729953 Ga0501071_0729953_18_674 218
207 3300049589 Ga0501073_0214834 Ga0501073_0214834_346_1002 218
208 3300049744 Ga0501083_0017058 Ga0501083_0017058_3035_3691 218
209 3300054114 Ga0501084_0794522 Ga0501084_0794522_19_675 218
210 3300060353 Ga0501082_0029814 Ga0501082_0029814_2375_3031 218
211 3300005327 Ga0070658_10082464 Ga0070658_100824642 219
212 3300005328 Ga0070676_10058291 Ga0070676_100582912 219
213 3300005329 Ga0070683_100896485 Ga0070683_1008964851 219
214 3300005334 Ga0068869_100513862 Ga0068869_1005138622 219
215 3300005335 Ga0070666_10014445 Ga0070666_100144453 219
216 3300005336 Ga0070680_100135259 Ga0070680_1001352593 219
217 3300005336 Ga0070680_100880957 Ga0070680_1008809571 219
218 3300005338 Ga0068868_100987400 Ga0068868_1009874001 219
219 3300005339 Ga0070660_100105585 Ga0070660_1001055853 219
220 3300005339 Ga0070660_100517268 Ga0070660_1005172682 219
221 3300005347 Ga0070668_100163428 Ga0070668_1001634282 219
222 3300005355 Ga0070671_100325795 Ga0070671_1003257951 219
223 3300005366 Ga0070659_100468478 Ga0070659_1004684782 219
224 3300005434 Ga0070709_10003530 Ga0070709_100035303 219
225 3300005436 Ga0070713_100001980 Ga0070713_1000019802 219
226 3300005437 Ga0070710_10001979 Ga0070710_100019791 219
227 3300005439 Ga0070711_100128933 Ga0070711_1001289332 219
228 3300005455 Ga0070663_100058214 Ga0070663_1000582142 219
229 3300005457 Ga0070662_100854666 Ga0070662_1008546661 219
230 3300005458 Ga0070681_10195012 Ga0070681_101950123 219
231 3300005466 Ga0070685_10007924 Ga0070685_100079243 219
232 3300005530 Ga0070679_100383809 Ga0070679_1003838092 219
233 3300005535 Ga0070684_100442595 Ga0070684_1004425952 219
234 3300005546 Ga0070696_100150462 Ga0070696_1001504622 219
235 3300005548 Ga0070665_100531780 Ga0070665_1005317802 219
236 3300005548 Ga0070665_100883827 Ga0070665_1008838272 219
237 3300005563 Ga0068855_100397658 Ga0068855_1003976582 219
238 3300005564 Ga0070664_100194793 Ga0070664_1001947932 219
239 3300005564 Ga0070664_100375698 Ga0070664_1003756982 219
240 3300005578 Ga0068854_100073261 Ga0068854_1000732613 219
241 3300005614 Ga0068856_100140564 Ga0068856_1001405643 219
242 3300005614 Ga0068856_100233714 Ga0068856_1002337142 219
243 3300005615 Ga0070702_100013875 Ga0070702_1000138754 219
244 3300005616 Ga0068852_100398499 Ga0068852_1003984992 219
245 3300005617 Ga0068859_100334467 Ga0068859_1003344672 219
246 3300005618 Ga0068864_100027332 Ga0068864_1000273323 219
247 3300005719 Ga0068861_100149395 Ga0068861_1001493951 219
248 3300005841 Ga0068863_100033568 Ga0068863_1000335682 219
249 3300005842 Ga0068858_100399478 Ga0068858_1003994782 219
250 3300005842 Ga0068858_100401290 Ga0068858_1004012902 219
251 3300005843 Ga0068860_100420010 Ga0068860_1004200102 219
252 3300006028 Ga0070717_10000822 Ga0070717_1000082211 219
253 3300006163 Ga0070715_10001175 Ga0070715_100011757 219
254 3300006173 Ga0070716_100005712 Ga0070716_1000057127 219
255 3300006237 Ga0097621_100024616 Ga0097621_1000246162 219
256 3300006358 Ga0068871_100001532 Ga0068871_1000015328 219
257 3300006871 Ga0075434_100949254 Ga0075434_1009492541 219
258 3300006881 Ga0068865_100087701 Ga0068865_1000877012 219
259 3300006914 Ga0075436_100063284 Ga0075436_1000632842 219
260 3300006931 Ga0097620_100334490 Ga0097620_1003344902 219
261 3300007076 Ga0075435_100613804 Ga0075435_1006138042 219
262 3300009011 Ga0105251_10008054 Ga0105251_100080542 219
263 3300009093 Ga0105240_10191584 Ga0105240_101915842 219
264 3300009093 Ga0105240_10379673 Ga0105240_103796733 219
265 3300009094 Ga0111539_10367269 Ga0111539_103672692 219
266 3300009101 Ga0105247_10259743 Ga0105247_102597432 219
267 3300009101 Ga0105247_10484985 Ga0105247_104849852 219
268 3300009148 Ga0105243_10029809 Ga0105243_100298092 219
269 3300009174 Ga0105241_10022839 Ga0105241_100228392 219
270 3300009176 Ga0105242_10056179 Ga0105242_100561793 219
271 3300009551 Ga0105238_10062579 Ga0105238_100625793 219
272 3300009553 Ga0105249_10313259 Ga0105249_103132591 219
273 3300009553 Ga0105249_10683174 Ga0105249_106831742 219
274 3300011119 Ga0105246_10291287 Ga0105246_102912872 219
275 3300012477 Ga0157336_1005434 Ga0157336_10054342 219
276 3300012506 Ga0157324_1001374 Ga0157324_10013742 219
277 3300012507 Ga0157342_1005995 Ga0157342_10059952 219
278 3300012508 Ga0157315_1013295 Ga0157315_10132951 219
279 3300012515 Ga0157338_1000859 Ga0157338_10008592 219
280 3300013104 Ga0157370_10266939 Ga0157370_102669392 219
281 3300013105 Ga0157369_10261006 Ga0157369_102610062 219
282 3300013296 Ga0157374_10736238 Ga0157374_107362382 219
283 3300013297 Ga0157378_10519291 Ga0157378_105192912 219
284 3300013306 Ga0163162_10154327 Ga0163162_101543273 219
285 3300013308 Ga0157375_10229961 Ga0157375_102299612 219
286 3300014326 Ga0157380_10287073 Ga0157380_102870732 219
287 3300014968 Ga0157379_10679778 Ga0157379_106797781 219
288 3300014969 Ga0157376_10499390 Ga0157376_104993902 219
289 3300025900 Ga0207710_10002649 Ga0207710_100026493 219
290 3300025903 Ga0207680_10021180 Ga0207680_100211803 219
291 3300025906 Ga0207699_10012841 Ga0207699_100128413 219
292 3300025907 Ga0207645_10057842 Ga0207645_100578422 219
293 3300025909 Ga0207705_10256510 Ga0207705_102565102 219
294 3300025911 Ga0207654_10142304 Ga0207654_101423042 219
295 3300025912 Ga0207707_10185944 Ga0207707_101859442 219
296 3300025913 Ga0207695_10504311 Ga0207695_105043112 219
297 3300025914 Ga0207671_10060791 Ga0207671_100607912 219
298 3300025915 Ga0207693_10009353 Ga0207693_100093537 219
299 3300025916 Ga0207663_10291682 Ga0207663_102916822 219
300 3300025919 Ga0207657_10114608 Ga0207657_101146083 219
301 3300025919 Ga0207657_10525390 Ga0207657_105253902 219
302 3300025920 Ga0207649_10107666 Ga0207649_101076662 219
303 3300025921 Ga0207652_10213676 Ga0207652_102136762 219
304 3300025924 Ga0207694_10270678 Ga0207694_102706782 219
305 3300025926 Ga0207659_10035596 Ga0207659_100355963 219
306 3300025928 Ga0207700_10008262 Ga0207700_100082627 219
307 3300025931 Ga0207644_10035998 Ga0207644_100359982 219
308 3300025933 Ga0207706_10353631 Ga0207706_103536312 219
309 3300025934 Ga0207686_10046149 Ga0207686_100461492 219
310 3300025935 Ga0207709_10224470 Ga0207709_102244702 219
311 3300025937 Ga0207669_10174528 Ga0207669_101745282 219
312 3300025938 Ga0207704_10105432 Ga0207704_101054323 219
313 3300025941 Ga0207711_10017313 Ga0207711_100173131 219
314 3300025942 Ga0207689_10488844 Ga0207689_104888442 219
315 3300025944 Ga0207661_10039367 Ga0207661_100393673 219
316 3300025945 Ga0207679_10773537 Ga0207679_107735372 219
317 3300025949 Ga0207667_10063548 Ga0207667_100635482 219
318 3300025949 Ga0207667_10713791 Ga0207667_107137911 219
319 3300025961 Ga0207712_10574889 Ga0207712_105748891 219
320 3300025986 Ga0207658_10049041 Ga0207658_100490412 219
321 3300026023 Ga0207677_10031724 Ga0207677_100317243 219
322 3300026041 Ga0207639_10639958 Ga0207639_106399581 219
323 3300026067 Ga0207678_10029152 Ga0207678_100291522 219
324 3300026067 Ga0207678_10406922 Ga0207678_104069222 219
325 3300026078 Ga0207702_10187257 Ga0207702_101872572 219
326 3300026088 Ga0207641_10096191 Ga0207641_100961912 219
327 3300026095 Ga0207676_10132064 Ga0207676_101320642 219
328 3300026118 Ga0207675_100068700 Ga0207675_1000687003 219
329 3300026121 Ga0207683_10002032 Ga0207683_100020324 219
330 3300028379 Ga0268266_10025477 Ga0268266_100254775 219
331 3300028379 Ga0268266_10646640 Ga0268266_106466402 219
332 3300032133 Ga0316583_10001495 Ga0316583_100014953 219
333 3300035083 Ga0373926_0023735 Ga0373926_0023735_847_1506 219
334 3300035084 Ga0373928_0006359 Ga0373928_0006359_755_1414 219
335 3300035085 Ga0373929_0018390 Ga0373929_0018390_607_1266 219
336 3300035090 Ga0373949_0007194 Ga0373949_0007194_84_743 219
337 3300035111 Ga0373923_0064322 Ga0373923_0064322_557_1216 219
338 3300035112 Ga0373932_0008573 Ga0373932_0008573_1205_1864 219
339 3300035113 Ga0373936_0004917 Ga0373936_0004917_2408_3067 219
340 3300035114 Ga0373939_0010588 Ga0373939_0010588_1145_1804 219
341 3300035115 Ga0373941_0038530 Ga0373941_0038530_451_1110 219
342 3300035116 Ga0373945_0005304 Ga0373945_0005304_771_1430 219
343 3300035118 Ga0373954_0082316 Ga0373954_0082316_749_1450 219
344 3300035119 Ga0373956_0022004 Ga0373956_0022004_1689_2348 219
345 3300035171 Ga0373946_0008284 Ga0373946_0008284_1925_2584 219
346 3300035172 Ga0373955_0009249 Ga0373955_0009249_3399_4058 219
347 3300035241 Ga0373961_0010488 Ga0373961_0010488_1161_1820 219
348 3300035691 Ga0373931_0004866 Ga0373931_0004866_3194_3853 219
349 3300035692 Ga0373935_0005794 Ga0373935_0005794_1806_2465 219
350 3300035695 Ga0373927_0029540 Ga0373927_0029540_1553_2212 219
351 3300035724 Ga0373933_0012503 Ga0373933_0012503_1038_1697 219
352 3300035725 Ga0373947_0001639 Ga0373947_0001639_1227_1886 219
353 3300037068 Ga0373925_0023367 Ga0373925_0023367_1324_1983 219
354 3300037068 Ga0373925_0080248 Ga0373925_0080248_1372_2031 219
355 3300045051 Ga0451576_0343975 Ga0451576_0343975_627_1286 219
356 3300046454 Ga0495592_0068767 Ga0495592_0068767_738_1397 219
357 3300046455 Ga0495603_0105123 Ga0495603_0105123_654_1313 219
358 3300046459 Ga0495629_0000688 Ga0495629_0000688_12901_13560 219
359 3300046461 Ga0495641_0020267 Ga0495641_0020267_2011_2670 219
360 3300046461 Ga0495641_0051428 Ga0495641_0051428_863_1522 219
361 3300046472 Ga0495580_0049994 Ga0495580_0049994_2268_2927 219
362 3300046473 Ga0495582_0002698 Ga0495582_0002698_493_1152 219
363 3300046473 Ga0495582_0011725 Ga0495582_0011725_2379_3038 219
364 3300046475 Ga0495639_0045983 Ga0495639_0045983_149_808 219
365 3300046476 Ga0495662_0037447 Ga0495662_0037447_1570_2229 219
366 3300046491 Ga0495584_0054179 Ga0495584_0054179_1072_1731 219
367 3300046492 Ga0495585_0013732 Ga0495585_0013732_2969_3628 219
368 3300046499 Ga0495594_0019571 Ga0495594_0019571_2605_3264 219
369 3300046516 Ga0495628_0026351 Ga0495628_0026351_2401_3060 219
370 3300046517 Ga0495630_0036667 Ga0495630_0036667_2093_2752 219
371 3300046525 Ga0495663_0042432 Ga0495663_0042432_590_1249 219
372 3300046526 Ga0495666_0010363 Ga0495666_0010363_1018_1677 219
373 3300046531 Ga0495665_0002653 Ga0495665_0002653_7967_8626 219
374 3300046535 Ga0495586_0150969 Ga0495586_0150969_556_1215 219
375 3300046536 Ga0495587_0075784 Ga0495587_0075784_876_1535 219
376 3300046557 Ga0495622_0061458 Ga0495622_0061458_804_1463 219
377 3300046558 Ga0495633_0004645 Ga0495633_0004645_4604_5263 219
378 3300046559 Ga0495667_0040453 Ga0495667_0040453_1805_2464 219
379 3300046615 Ga0495656_0000194 Ga0495656_0000194_2858_3517 219
380 3300046648 Ga0495611_0004273 Ga0495611_0004273_1790_2449 219
381 3300046663 Ga0495635_0023837 Ga0495635_0023837_887_1546 219
382 3300046664 Ga0495659_0004606 Ga0495659_0004606_437_1096 219
383 3300046674 Ga0495588_0013111 Ga0495588_0013111_2096_2755 219
384 3300046678 Ga0495599_0007081 Ga0495599_0007081_1063_1722 219
385 3300046680 Ga0495646_0022708 Ga0495646_0022708_2211_2870 219
386 3300046681 Ga0495647_0007046 Ga0495647_0007046_1868_2527 219
387 3300046683 Ga0495658_0000246 Ga0495658_0000246_14147_14806 219
388 3300046683 Ga0495658_0005203 Ga0495658_0005203_2051_2710 219
389 3300046684 Ga0495669_0111904 Ga0495669_0111904_429_1088 219
390 3300046689 Ga0495613_0034537 Ga0495613_0034537_2044_2703 219
391 3300046691 Ga0495670_0000200 Ga0495670_0000200_15575_16234 219
392 3300046809 Ga0495600_0002311 Ga0495600_0002311_9626_10285 219
393 3300047319 Ga0495674_0105056 Ga0495674_0105056_868_1527 219
394 3300047321 Ga0495676_0235276 Ga0495676_0235276_449_1108 219
395 3300047322 Ga0495680_0010106 Ga0495680_0010106_4310_4969 219
396 3300047471 Ga0495684_0007729 Ga0495684_0007729_886_1545 219
397 3300048903 Ga0496100_0008551 Ga0496100_0008551_2705_3364 219
398 3300048904 Ga0496101_0332575 Ga0496101_0332575_303_962 219
399 3300048905 Ga0496102_0073107 Ga0496102_0073107_1807_2466 219
400 3300048905 Ga0496102_0227043 Ga0496102_0227043_231_890 219
401 3300048905 Ga0496102_0465205 Ga0496102_0465205_229_888 219
402 3300048906 Ga0496103_0033955 Ga0496103_0033955_1152_1811 219
403 3300048907 Ga0496104_0073744 Ga0496104_0073744_1821_2480 219
404 3300048907 Ga0496104_0257887 Ga0496104_0257887_780_1439 219
405 3300048907 Ga0496104_0383266 Ga0496104_0383266_357_1016 219
406 3300048908 Ga0496105_0135060 Ga0496105_0135060_1140_1799 219
407 3300048908 Ga0496105_0208731 Ga0496105_0208731_702_1361 219
408 3300048908 Ga0496105_0254597 Ga0496105_0254597_530_1189 219
409 3300048909 Ga0496106_0004190 Ga0496106_0004190_10031_10690 219
410 3300048909 Ga0496106_0054273 Ga0496106_0054273_37_696 219
411 3300048910 Ga0496107_0002077 Ga0496107_0002077_1923_2582 219
412 3300048911 Ga0496108_0044492 Ga0496108_0044492_1946_2605 219
413 3300048912 Ga0496109_0035768 Ga0496109_0035768_3521_4180 219
414 3300048912 Ga0496109_0545784 Ga0496109_0545784_132_791 219
415 3300048913 Ga0496110_0068069 Ga0496110_0068069_221_880 219
416 3300048914 Ga0496111_0008831 Ga0496111_0008831_5254_5913 219
417 3300048915 Ga0496112_0037123 Ga0496112_0037123_2953_3612 219
418 3300048915 Ga0496112_0226985 Ga0496112_0226985_807_1466 219
419 3300048915 Ga0496112_0257099 Ga0496112_0257099_807_1466 219
420 3300048916 Ga0496113_0114978 Ga0496113_0114978_1083_1742 219
421 3300048916 Ga0496113_0326429 Ga0496113_0326429_359_1018 219
422 3300048916 Ga0496113_0372824 Ga0496113_0372824_437_1096 219
423 3300048917 Ga0496114_0072409 Ga0496114_0072409_1308_1967 219
424 3300048918 Ga0496115_0096756 Ga0496115_0096756_1150_1809 219
425 3300048918 Ga0496115_0201835 Ga0496115_0201835_750_1409 219
426 3300048918 Ga0496115_0415287 Ga0496115_0415287_154_813 219
427 3300049574 Ga0501038_0062043 Ga0501038_0062043_51_746 219
428 3300050512 nmdc:mga0n895_171463_c1 nmdc:mga0n895_171463_c1_1145_1804 219
429 3300050512 nmdc:mga0n895_38169_c1 nmdc:mga0n895_38169_c1_2837_3496 219
430 3300050513 nmdc:mga0rr50_10090_c1 nmdc:mga0rr50_10090_c1_5291_5950 219
431 3300050514 nmdc:mga08x19_235634_c1 nmdc:mga08x19_235634_c1_241_900 219
432 3300053084 Ga0495595_0028099 Ga0495595_0028099_1199_1858 219
433 3300053085 Ga0495619_0001867 Ga0495619_0001867_4261_4920 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

4

181

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9715 3 202
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9694 4 205
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9662 5 204
5j9f-assembly2.cif.gz_A human gar transformylase in complex with gar and (4-{[2-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)ethyl]amino}benzoyl)-l-glutamic acid (agf183) 0.9621 5 202
4zyv-assembly1.cif.gz_A human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) 0.9618 5 203
ID Description Score Start End Superfamily
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9884 2 191 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9715 3 202 3.40.50.170
1njsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9635 5 202 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9564 5 205 3.40.50.170
4s1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9542 4 188 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A326KWL4-F1-model_v4 deleted 0.9951 3 190
AF-A0A4R4DV83-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9925 2 215 GO:0004644
GO:0005829
GO:0006189
AF-A0A381TCJ8-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9923 17 160 GO:0004644
GO:0005829
GO:0006189
AF-A0A061IBE4-F1-model_v4 Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (GARS) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART)] 0.9922 2 187 GO:0004637
GO:0004641
GO:0004644
GO:0005524
GO:0005829
GO:0006189
GO:0046084
GO:0046872
AF-A0A1G7VXV0-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9919 2 217 GO:0004644
GO:0005829
GO:0006189

Feature Viewer

pLDDT pTM Quality
95.66 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map