F442818

General Info

Members Datasets Scaffolds Average Seq Length
433 299 420 337

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10036784|Ga0105240_100367845
Length 324
Sequence MTVVVTGVAGFVGYHVARALLGRGQHVIGIDSVNDYYDVRLKEARLAQLGQIAGFSFHRLDIADSDSLISVLERARPVSGVVHLAAQAGVRYSLQNPFAYVHSNVLGQVAVFNAVRQLDPAPALVYASSSSVYGGNRKLPFAVADRVDHPVSLYAATKRSGELLAESYAAMYGLASTGLRFFTLYGPWGRPDMAYYSFTAAILGGQPIPVFNEGRLERDFTYIDDAVIGILAALDQPTNPERLHRLYNLGNNKPEPVLRFIEVLERAVGRKAIFRFEPMQPGDVVATAAEIEDSRRDLAFEPATSIDEGLPRFVSWYKAYHGVT

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
5 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
6 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
7 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
8 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
9 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
10 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
298 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
299 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0
Isolates 3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 1.85
Rhizoplane 6
Rhizosphere 82.22
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10012611 3300003203 Bacteria 3658
2 JGI25153J46596_10003408 3300003215 Bacteria 8907
3 rootL2_10012969 3300003322 Bacteria 25272
4 rootL2_10063627 3300003322 Bacteria 1977
5 Ga0065715_10013501 3300005293 Bacteria 1876
6 Ga0070658_10062172 3300005327 Bacteria 3043
7 Ga0070676_10176591 3300005328 Bacteria 1386
8 Ga0070680_100015827 3300005336 Bacteria 5921
9 Ga0070680_100144466 3300005336 Bacteria 1995
10 Ga0070682_100048792 3300005337 Bacteria 2637
11 Ga0068868_100112486 3300005338 Bacteria 2213
12 Ga0070660_100034705 3300005339 Bacteria 3813
13 Ga0070660_100156777 3300005339 Bacteria 1833
14 Ga0070689_100038243 3300005340 Bacteria 3670
15 Ga0070689_100134241 3300005340 Bacteria 1986
16 Ga0070689_100315161 3300005340 Bacteria 1305
17 Ga0070691_10088076 3300005341 Bacteria 1528
18 Ga0070661_100139130 3300005344 Bacteria 1828
19 Ga0070668_100054542 3300005347 Bacteria 3083
20 Ga0070675_100175790 3300005354 Bacteria 1849
21 Ga0070675_100206932 3300005354 Bacteria 1705
22 Ga0070671_100039169 3300005355 Bacteria 3934
23 Ga0070673_100191555 3300005364 Bacteria 1757
24 Ga0070688_100035417 3300005365 Bacteria 3032
25 Ga0070667_100097444 3300005367 Bacteria 2537
26 Ga0070709_10007255 3300005434 Bacteria 6075
27 Ga0070709_10145095 3300005434 Bacteria 1634
28 Ga0070714_100006438 3300005435 Bacteria 9068
29 Ga0070714_100145063 3300005435 Bacteria 2134
30 Ga0070713_100002174 3300005436 Bacteria 12691
31 Ga0070710_10001572 3300005437 Bacteria 10784
32 Ga0070710_10070553 3300005437 Bacteria 2013
33 Ga0070701_10079880 3300005438 Bacteria 1768
34 Ga0070711_100014780 3300005439 Bacteria 4927
35 Ga0070711_100120268 3300005439 Bacteria 1941
36 Ga0070705_100065311 3300005440 Bacteria 2178
37 Ga0070694_100115155 3300005444 Bacteria 1921
38 Ga0070662_100200916 3300005457 Bacteria 1581
39 Ga0070685_10003228 3300005466 Bacteria 8293
40 Ga0070685_10047451 3300005466 Bacteria 2470
41 Ga0070699_100228220 3300005518 Bacteria 1660
42 Ga0070679_100007468 3300005530 Bacteria 10218
43 Ga0070679_100113217 3300005530 Bacteria 2699
44 Ga0070684_100137566 3300005535 Bacteria 2207
45 Ga0070684_100191759 3300005535 Bacteria 1860
46 Ga0070672_100131021 3300005543 Bacteria 2061
47 Ga0070686_100008642 3300005544 Bacteria 5706
48 Ga0070695_100050294 3300005545 Bacteria 2670
49 Ga0070696_100019736 3300005546 Bacteria 4568
50 Ga0070696_100096334 3300005546 Bacteria 2114
51 Ga0070696_100328052 3300005546 Bacteria 1180
52 Ga0070693_100029667 3300005547 Bacteria 2985
53 Ga0070665_100003089 3300005548 Bacteria 17925
54 Ga0070665_100100308 3300005548 Bacteria 2899
55 Ga0070665_100325215 3300005548 Bacteria 1542
56 Ga0070704_100099381 3300005549 Bacteria 2188
57 Ga0070664_100205097 3300005564 Bacteria 1760
58 Ga0070664_100393522 3300005564 Bacteria 1266
59 Ga0068854_100161078 3300005578 Bacteria 1738
60 Ga0068856_100214312 3300005614 Bacteria 1941
61 Ga0068856_100268869 3300005614 Bacteria 1720
62 Ga0070702_100071192 3300005615 Bacteria 2055
63 Ga0068852_100502165 3300005616 Bacteria 1208
64 Ga0068859_100108247 3300005617 Bacteria 2840
65 Ga0068859_100324384 3300005617 Bacteria 1634
66 Ga0068859_100634567 3300005617 Bacteria 1161
67 Ga0068864_100022858 3300005618 Bacteria 5245
68 Ga0068861_100046937 3300005719 Bacteria 3258
69 Ga0068861_100071532 3300005719 Bacteria 2689
70 Ga0068863_100325413 3300005841 Bacteria 1494
71 Ga0068858_100264114 3300005842 Bacteria 1637
72 Ga0068860_100161156 3300005843 Bacteria 2163
73 Ga0081455_10002164 3300005937 Bacteria 23439
74 Ga0081455_10005135 3300005937 Bacteria 14429
75 Ga0081455_10017524 3300005937 Bacteria 6862
76 Ga0081455_10075118 3300005937 Bacteria 2789
77 Ga0081540_1000003 3300005983 Bacteria 233942
78 Ga0081540_1003510 3300005983 Bacteria 12375
79 Ga0081540_1069932 3300005983 Bacteria 1628
80 Ga0081539_10006579 3300005985 Bacteria 11056
81 Ga0070717_10000145 3300006028 Bacteria 52677
82 Ga0075365_10021005 3300006038 Bacteria 4063
83 Ga0075365_10074743 3300006038 Bacteria 2286
84 Ga0075368_10013893 3300006042 Bacteria 2963
85 Ga0075363_100032653 3300006048 Bacteria 2705
86 Ga0075364_10036380 3300006051 Bacteria 3182
87 Ga0070715_10010667 3300006163 Bacteria 3282
88 Ga0070715_10031164 3300006163 Bacteria 2162
89 Ga0070716_100001181 3300006173 Bacteria 11493
90 Ga0070712_100049746 3300006175 Bacteria 2912
91 Ga0070712_100181561 3300006175 Bacteria 1640
92 Ga0070712_100365565 3300006175 Bacteria 1184
93 Ga0075362_10048926 3300006177 Bacteria 1887
94 Ga0075362_10050768 3300006177 Bacteria 1855
95 Ga0075367_10121105 3300006178 Bacteria 1612
96 Ga0075369_10023433 3300006186 Bacteria 2552
97 Ga0075366_10000683 3300006195 Bacteria 16043
98 Ga0097621_100397979 3300006237 Bacteria 1232
99 Ga0075433_10145190 3300006852 Bacteria 2109
100 Ga0075433_10178314 3300006852 Bacteria 1890
101 Ga0075434_100060274 3300006871 Bacteria 3774
102 Ga0075434_100089864 3300006871 Bacteria 3072
103 Ga0068865_100003336 3300006881 Bacteria 9612
104 Ga0068865_100146513 3300006881 Bacteria 1786
105 Ga0097620_100036260 3300006931 Bacteria 4950
106 Ga0097620_100108258 3300006931 Bacteria 2840
107 Ga0097620_100324375 3300006931 Bacteria 1634
108 Ga0097620_100634561 3300006931 Bacteria 1161
109 Ga0075435_100068074 3300007076 Bacteria 2899
110 Ga0075435_100136733 3300007076 Bacteria 2053
111 Ga0105251_10018941 3300009011 Bacteria 3647
112 Ga0105240_10036784 3300009093 Bacteria 6294
113 Ga0105240_10141825 3300009093 Bacteria 2872
114 Ga0111539_10611391 3300009094 Bacteria 1269
115 Ga0105245_10022060 3300009098 Bacteria 5589
116 Ga0105245_10487115 3300009098 Bacteria 1247
117 Ga0105247_10028620 3300009101 Bacteria 3372
118 Ga0105247_10098234 3300009101 Bacteria 1869
119 Ga0114129_10032431 3300009147 Bacteria 7383
120 Ga0105243_10003342 3300009148 Bacteria 13016
121 Ga0105241_10011582 3300009174 Bacteria 6466
122 Ga0105242_10243960 3300009176 Bacteria 1616
123 Ga0105248_10042172 3300009177 Bacteria 5117
124 Ga0105248_10305821 3300009177 Bacteria 1790
125 Ga0105237_10214090 3300009545 Bacteria 1926
126 Ga0105238_10024303 3300009551 Bacteria 6177
127 Ga0105249_10068005 3300009553 Bacteria 3284
128 Ga0105239_10391869 3300010375 Bacteria 1571
129 Ga0105246_10017007 3300011119 Bacteria 4618
130 Ga0105246_10065552 3300011119 Bacteria 2539
131 Ga0157373_10028445 3300013100 Bacteria 4032
132 Ga0157373_10088792 3300013100 Bacteria 2178
133 Ga0157370_10267753 3300013104 Bacteria 1579
134 Ga0157374_10185808 3300013296 Bacteria 2032
135 Ga0157378_10065059 3300013297 Bacteria 3263
136 Ga0157378_10453096 3300013297 Bacteria 1274
137 Ga0163162_10078863 3300013306 Bacteria 3359
138 Ga0163162_10098682 3300013306 Bacteria 3011
139 Ga0163162_10115117 3300013306 Bacteria 2789
140 Ga0163162_10254230 3300013306 Bacteria 1889
141 Ga0157372_10521485 3300013307 Bacteria 1385
142 Ga0157375_10221404 3300013308 Bacteria 2051
143 Ga0163163_10008161 3300014325 Bacteria 9285
144 Ga0163163_10106583 3300014325 Bacteria 2829
145 Ga0157380_10066178 3300014326 Bacteria 2906
146 Ga0157379_10009770 3300014968 Bacteria 8359
147 Ga0157379_10160933 3300014968 Bacteria 2026
148 Ga0163161_10040937 3300017792 Bacteria 3329
149 Ga0213873_10010885 3300021358 Bacteria 1931
150 Ga0213875_10064615 3300021388 Bacteria 1710
151 Ga0209233_1009777 3300025261 Bacteria 2904
152 Ga0209758_1003134 3300025297 Bacteria 15604
153 Ga0207697_10008012 3300025315 Bacteria 4665
154 Ga0207653_10043937 3300025885 Bacteria 1472
155 Ga0207692_10001804 3300025898 Bacteria 8121
156 Ga0207692_10054227 3300025898 Bacteria 2046
157 Ga0207642_10054229 3300025899 Bacteria 1828
158 Ga0207710_10008485 3300025900 Bacteria 4332
159 Ga0207688_10008512 3300025901 Bacteria 5584
160 Ga0207688_10095171 3300025901 Bacteria 1714
161 Ga0207680_10113217 3300025903 Bacteria 1763
162 Ga0207699_10002006 3300025906 Bacteria 9614
163 Ga0207699_10035160 3300025906 Bacteria 2849
164 Ga0207699_10130381 3300025906 Bacteria 1639
165 Ga0207645_10022233 3300025907 Bacteria 4128
166 Ga0207643_10065545 3300025908 Bacteria 2081
167 Ga0207654_10004600 3300025911 Bacteria 6967
168 Ga0207693_10003437 3300025915 Bacteria 13514
169 Ga0207660_10019768 3300025917 Bacteria 4508
170 Ga0207660_10130750 3300025917 Bacteria 1911
171 Ga0207660_10188228 3300025917 Bacteria 1606
172 Ga0207662_10024440 3300025918 Bacteria 3477
173 Ga0207662_10107520 3300025918 Bacteria 1736
174 Ga0207657_10007133 3300025919 Bacteria 11476
175 Ga0207657_10103233 3300025919 Bacteria 2363
176 Ga0207657_10145585 3300025919 Bacteria 1933
177 Ga0207657_10371787 3300025919 Bacteria 1126
178 Ga0207652_10246798 3300025921 Bacteria 1610
179 Ga0207681_10244203 3300025923 Bacteria 1399
180 Ga0207694_10040801 3300025924 Bacteria 3575
181 Ga0207659_10256393 3300025926 Bacteria 1421
182 Ga0207687_10016883 3300025927 Bacteria 4799
183 Ga0207700_10069876 3300025928 Bacteria 2697
184 Ga0207700_10109656 3300025928 Bacteria 2218
185 Ga0207664_10015721 3300025929 Bacteria 5502
186 Ga0207664_10062629 3300025929 Bacteria 2971
187 Ga0207644_10019223 3300025931 Bacteria 4630
188 Ga0207706_10025928 3300025933 Bacteria 5249
189 Ga0207686_10019347 3300025934 Bacteria 3870
190 Ga0207709_10129708 3300025935 Bacteria 1716
191 Ga0207709_10190006 3300025935 Bacteria 1458
192 Ga0207670_10247355 3300025936 Bacteria 1376
193 Ga0207670_10274744 3300025936 Bacteria 1311
194 Ga0207669_10284567 3300025937 Bacteria 1249
195 Ga0207704_10076035 3300025938 Bacteria 2150
196 Ga0207704_10127221 3300025938 Bacteria 1756
197 Ga0207665_10000265 3300025939 Bacteria 36482
198 Ga0207665_10181487 3300025939 Bacteria 1524
199 Ga0207691_10059624 3300025940 Bacteria 3469
200 Ga0207711_10161106 3300025941 Bacteria 2031
201 Ga0207711_10445534 3300025941 Bacteria 1205
202 Ga0207689_10011270 3300025942 Bacteria 7672
203 Ga0207689_10026799 3300025942 Bacteria 4826
204 Ga0207689_10036991 3300025942 Bacteria 4051
205 Ga0207679_10192388 3300025945 Bacteria 1697
206 Ga0207679_10213117 3300025945 Bacteria 1621
207 Ga0207667_10022704 3300025949 Bacteria 6922
208 Ga0207712_10044316 3300025961 Bacteria 3074
209 Ga0207712_10148345 3300025961 Bacteria 1809
210 Ga0207712_10292538 3300025961 Bacteria 1333
211 Ga0207668_10044495 3300025972 Bacteria 3020
212 Ga0207640_10379988 3300025981 Bacteria 1144
213 Ga0207677_10152986 3300026023 Bacteria 1782
214 Ga0207677_10247977 3300026023 Bacteria 1444
215 Ga0207703_10020020 3300026035 Bacteria 5228
216 Ga0207703_10203559 3300026035 Bacteria 1760
217 Ga0207639_10377092 3300026041 Bacteria 1273
218 Ga0207678_10020266 3300026067 Bacteria 5836
219 Ga0207678_10042834 3300026067 Bacteria 3919
220 Ga0207678_10204133 3300026067 Bacteria 1690
221 Ga0207641_10070957 3300026088 Bacteria 2994
222 Ga0207648_10098908 3300026089 Bacteria 2555
223 Ga0207676_10124025 3300026095 Bacteria 2183
224 Ga0207674_10060720 3300026116 Bacteria 3822
225 Ga0207674_10081040 3300026116 Bacteria 3248
226 Ga0207675_100030151 3300026118 Bacteria 5051
227 Ga0207675_100071292 3300026118 Bacteria 3248
228 Ga0207683_10006706 3300026121 Bacteria 9851
229 Ga0207683_10027799 3300026121 Bacteria 4888
230 Ga0207683_10077828 3300026121 Bacteria 2938
231 Ga0207428_10161743 3300027907 Bacteria 1700
232 Ga0268266_10003520 3300028379 Bacteria 15543
233 Ga0268266_10010718 3300028379 Bacteria 7987
234 Ga0268266_10012789 3300028379 Bacteria 7250
235 Ga0268265_10016767 3300028380 Bacteria 5041
236 Ga0268265_10221763 3300028380 Bacteria 1655
237 Ga0268264_10220235 3300028381 Bacteria 1747
238 Ga0265337_1000250 3300028556 Bacteria 29184
239 Ga0265325_10000053 3300031241 Bacteria 77918
240 Ga0265325_10038429 3300031241 Bacteria 2526
241 Ga0265340_10014213 3300031247 Bacteria 4165
242 Ga0265339_10001034 3300031249 Bacteria 21208
243 Ga0265331_10041003 3300031250 Bacteria 2250
244 Ga0265313_10032472 3300031595 Bacteria 2665
245 Ga0265314_10002155 3300031711 Bacteria 20584
246 Ga0265314_10008989 3300031711 Bacteria 8499
247 Ga0265342_10000954 3300031712 Bacteria 28791
248 Ga0307413_10342515 3300031824 Bacteria 1150
249 Ga0307410_10146451 3300031852 Bacteria 1753
250 Ga0307409_100108860 3300031995 Bacteria 2318
251 Ga0307414_10062579 3300032004 Bacteria 2642
252 Ga0307415_100098171 3300032126 Bacteria 2140
253 Ga0373926_0028032 3300035083 Bacteria 1976
254 Ga0373944_0005309 3300035089 Bacteria 3388
255 Ga0373951_0002572 3300035091 Bacteria 4559
256 Ga0373936_0022463 3300035113 Bacteria 2456
257 Ga0373954_0005693 3300035118 Bacteria 5406
258 Ga0373954_0013257 3300035118 Bacteria 3672
259 Ga0373943_0001738 3300035170 Bacteria 9877
260 Ga0373946_0054624 3300035171 Bacteria 1681
261 Ga0373955_0002538 3300035172 Bacteria 7986
262 Ga0373961_0001489 3300035241 Bacteria 6855
263 Ga0373962_0006224 3300035242 Bacteria 2887
264 Ga0373962_0040725 3300035242 Bacteria 1307
265 Ga0373924_0005203 3300035410 Bacteria 4592
266 Ga0373924_0084262 3300035410 Bacteria 1355
267 Ga0373931_0009518 3300035691 Bacteria 4645
268 Ga0373935_0025423 3300035692 Bacteria 3649
269 Ga0373935_0058894 3300035692 Bacteria 2454
270 Ga0373927_0009273 3300035695 Bacteria 6600
271 Ga0373933_0167291 3300035724 Bacteria 1398
272 Ga0373947_0007515 3300035725 Bacteria 6305
273 Ga0373947_0015555 3300035725 Bacteria 4370
274 Ga0373937_0079525 3300036401 Bacteria 3030
275 Ga0373925_0014297 3300037068 Bacteria 5742
276 Ga0373925_0026861 3300037068 Bacteria 4214
277 Ga0373925_0153002 3300037068 Bacteria 1812
278 Ga0436364_0650169 3300037853 Bacteria 2410
279 Ga0436360_0654994 3300039438 Bacteria 8074
280 Ga0466972_0144708 3300044658 Bacteria 1118
281 Ga0466966_0106983 3300044684 Bacteria 1726
282 Ga0453684_0073767 3300044712 Bacteria 4300
283 Ga0466957_0020434 3300044842 Bacteria 3897
284 Ga0466960_0106618 3300044901 Bacteria 1450
285 Ga0495592_0013943 3300046454 Bacteria 6105
286 Ga0495603_0013671 3300046455 Bacteria 4912
287 Ga0495603_0016198 3300046455 Bacteria 4510
288 Ga0495629_0000875 3300046459 Bacteria 24261
289 Ga0495638_0000001 3300046460 Bacteria 1114121
290 Ga0495641_0013172 3300046461 Bacteria 4566
291 Ga0495651_0011085 3300046462 Bacteria 6933
292 Ga0495580_0139365 3300046472 Bacteria 1681
293 Ga0495582_0002081 3300046473 Bacteria 11192
294 Ga0495662_0010543 3300046476 Bacteria 4521
295 Ga0495608_0187345 3300046511 Bacteria 1307
296 Ga0495628_0041236 3300046516 Bacteria 3685
297 Ga0495628_0180945 3300046516 Bacteria 1595
298 Ga0495652_0054907 3300046529 Bacteria 3390
299 Ga0495665_0009115 3300046531 Bacteria 5377
300 Ga0495640_0010134 3300046533 Bacteria 7304
301 Ga0495587_0019919 3300046536 Bacteria 4146
302 Ga0495622_0029702 3300046557 Bacteria 2554
303 Ga0495667_0003730 3300046559 Bacteria 10251
304 Ga0495657_0050996 3300046675 Bacteria 2780
305 Ga0495647_0026764 3300046681 Bacteria 2115
306 Ga0495647_0039151 3300046681 Bacteria 1796
307 Ga0495613_0025427 3300046689 Bacteria 4411
308 Ga0495624_0077277 3300046690 Bacteria 2065
309 Ga0495624_0089814 3300046690 Bacteria 1895
310 Ga0495649_0017234 3300046694 Bacteria 4079
311 Ga0495600_0121576 3300046809 Bacteria 1698
312 Ga0495581_0034674 3300047315 Bacteria 2919
313 Ga0495581_0142860 3300047315 Bacteria 1397
314 Ga0495604_0026274 3300047317 Bacteria 4636
315 Ga0495604_0123031 3300047317 Bacteria 1875
316 Ga0495676_0106802 3300047321 Bacteria 2062
317 Ga0495676_0207563 3300047321 Bacteria 1357
318 Ga0495676_0225735 3300047321 Bacteria 1289
319 Ga0495680_0003824 3300047322 Bacteria 14615
320 Ga0495680_0062166 3300047322 Bacteria 2872
321 Ga0495675_0083554 3300047444 Bacteria 2010
322 Ga0495593_0018424 3300047673 Bacteria 3922
323 Ga0495614_0062847 3300048089 Bacteria 1596
324 Ga0496101_0041308 3300048904 Bacteria 3288
325 Ga0496101_0168376 3300048904 Bacteria 1683
326 Ga0496102_0110985 3300048905 Bacteria 2556
327 Ga0496103_0123017 3300048906 Bacteria 1653
328 Ga0496105_0162266 3300048908 Bacteria 1835
329 Ga0496106_0449219 3300048909 Bacteria 1035
330 Ga0496108_0111538 3300048911 Bacteria 2339
331 Ga0496108_0221945 3300048911 Bacteria 1642
332 Ga0496109_0035838 3300048912 Bacteria 4478
333 Ga0496109_0044564 3300048912 Bacteria 4024
334 Ga0496109_0326184 3300048912 Bacteria 1449
335 Ga0496110_0107336 3300048913 Bacteria 2506
336 Ga0496110_0140359 3300048913 Bacteria 2184
337 Ga0496110_0148898 3300048913 Bacteria 2118
338 Ga0496111_0032388 3300048914 Bacteria 3727
339 Ga0496112_0049919 3300048915 Bacteria 4101
340 Ga0496112_0051378 3300048915 Bacteria 4043
341 Ga0496112_0555820 3300048915 Bacteria 1081
342 Ga0496113_0016647 3300048916 Bacteria 5083
343 Ga0496113_0017879 3300048916 Bacteria 4928
344 Ga0496113_0053175 3300048916 Bacteria 3027
345 Ga0496113_0158842 3300048916 Bacteria 1786
346 Ga0496114_0010689 3300048917 Bacteria 7305
347 Ga0496115_0119726 3300048918 Bacteria 2165
348 Ga0496115_0126245 3300048918 Bacteria 2107
349 Ga0496115_0359122 3300048918 Bacteria 1187
350 Ga0496121_0077879 3300048924 Bacteria 2638
351 Ga0496121_0109884 3300048924 Bacteria 2105
352 Ga0496124_0209480 3300048927 Bacteria 1476
353 Ga0501031_0020555 3300049568 Bacteria 4304
354 Ga0501032_0010657 3300049569 Bacteria 6617
355 Ga0501033_0218137 3300049570 Bacteria 1358
356 Ga0501034_0050543 3300049571 Bacteria 4193
357 Ga0501034_0052315 3300049571 Bacteria 4114
358 Ga0501034_0062682 3300049571 Bacteria 3734
359 Ga0501034_0166923 3300049571 Bacteria 2170
360 Ga0501036_0058223 3300049572 Bacteria 3273
361 Ga0501037_0006555 3300049573 Bacteria 8520
362 Ga0501037_0225449 3300049573 Bacteria 1317
363 Ga0501038_0012755 3300049574 Bacteria 7676
364 Ga0501038_0335843 3300049574 Bacteria 1179
365 Ga0501039_0013895 3300049575 Bacteria 6160
366 Ga0501042_0116899 3300049578 Bacteria 1920
367 Ga0501043_0147370 3300049579 Bacteria 1842
368 Ga0501043_0187665 3300049579 Bacteria 1609
369 Ga0501047_0310083 3300049581 Bacteria 1419
370 Ga0501048_0008156 3300049582 Bacteria 7922
371 Ga0501067_0024052 3300049583 Bacteria 3378
372 Ga0501067_0107955 3300049583 Bacteria 1547
373 Ga0501069_0088783 3300049585 Bacteria 1747
374 Ga0501070_0338977 3300049586 Bacteria 1221
375 Ga0501071_0197316 3300049587 Bacteria 1511
376 Ga0501073_0017482 3300049589 Bacteria 5194
377 Ga0501073_0112399 3300049589 Bacteria 1889
378 Ga0501074_0206742 3300049590 Bacteria 1399
379 Ga0501076_0360254 3300049592 Bacteria 1195
380 Ga0501236_002505 3300049670 Bacteria 2111
381 Ga0501079_0052021 3300049741 Bacteria 3163
382 Ga0501080_0004302 3300049742 Bacteria 12645
383 Ga0501083_0024209 3300049744 Bacteria 4208
384 Ga0501035_0058046 3300049822 Bacteria 3449
385 Ga0501044_0001046 3300049823 Bacteria 33251
386 Ga0501044_0325863 3300049823 Bacteria 1459
387 Ga0501044_0346885 3300049823 Bacteria 1405
388 Ga0501045_0006385 3300049824 Bacteria 8162
389 nmdc:mga03683_25880_c1 3300050489 Bacteria 2309
390 nmdc:mga03683_39931_c1 3300050489 Bacteria 1922
391 nmdc:mga0k408_14171_c1 3300050493 Bacteria 4387
392 nmdc:mga0k408_17808_c1 3300050493 Bacteria 3960
393 nmdc:mga06z11_39561_c1 3300050494 Bacteria 2347
394 nmdc:mga04h51_5977_c1 3300050495 Bacteria 2049
395 nmdc:mga07m45_31280_c1 3300050496 Bacteria 2949
396 nmdc:mga07m45_31947_c1 3300050496 Bacteria 2919
397 nmdc:mga05p37_169120_c1 3300050507 Bacteria 2666
398 nmdc:mga05p37_21969_c1 3300050507 Bacteria 7730
399 nmdc:mga08y16_26137_c1 3300050511 Bacteria 6157
400 nmdc:mga0n895_7805_c1 3300050512 Bacteria 9222
401 nmdc:mga0rr50_63076_c1 3300050513 Bacteria 2798
402 nmdc:mga0rr50_73140_c1 3300050513 Bacteria 2620
403 nmdc:mga0a205_24887_c1 3300050515 Bacteria 5697
404 nmdc:mga0a205_64992_c1 3300050515 Bacteria 3524
405 Ga0495612_0008457 3300053078 Bacteria 4174
406 Ga0495595_0026424 3300053084 Bacteria 2580
407 Ga0495595_0036015 3300053084 Bacteria 2244
408 Ga0495619_0043925 3300053085 Bacteria 2931
409 Ga0495619_0208993 3300053085 Bacteria 1352
410 Ga0500643_004385 3300053087 Bacteria 6403
411 Ga0500644_0000369 3300053088 Bacteria 22061
412 Ga0500566_0012802 3300053094 Bacteria 4938
413 Ga0500641_0033274 3300053096 Bacteria 2045
414 Ga0500595_000029 3300053119 Bacteria 122318
415 Ga0500588_0048742 3300053146 Bacteria 1311
416 Ga0500616_0000009 3300053153 Bacteria 779095
417 Ga0500620_028566 3300053155 Bacteria 1745
418 Ga0500627_0026978 3300053158 Bacteria 2375
419 Ga0500639_040115 3300053163 Bacteria 2464
420 Ga0500645_000143 3300053730 Bacteria 56081

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1003510 Ga0081540_10035103 299
2 3300046454 Ga0495592_0013943 Ga0495592_0013943_5177_6085 302
3 3300046516 Ga0495628_0041236 Ga0495628_0041236_24_932 302
4 3300046690 Ga0495624_0089814 Ga0495624_0089814_974_1882 302
5 3300048915 Ga0496112_0555820 Ga0496112_0555820_38_1000 308
6 3300049571 Ga0501034_0052315 Ga0501034_0052315_23_970 314
7 3300049585 Ga0501069_0088783 Ga0501069_0088783_780_1727 314
8 3300049579 Ga0501043_0187665 Ga0501043_0187665_12_974 319
9 3300009093 Ga0105240_10036784 Ga0105240_100367845 320
10 3300053146 Ga0500588_0048742 Ga0500588_0048742_299_1276 320
11 3300005355 Ga0070671_100039169 Ga0070671_1000391691 324
12 3300005367 Ga0070667_100097444 Ga0070667_1000974442 324
13 3300006038 Ga0075365_10074743 Ga0075365_100747433 324
14 3300013306 Ga0163162_10078863 Ga0163162_100788634 324
15 3300025911 Ga0207654_10004600 Ga0207654_100046008 324
16 3300025942 Ga0207689_10011270 Ga0207689_100112708 324
17 3300025972 Ga0207668_10044495 Ga0207668_100444952 324
18 3300026035 Ga0207703_10020020 Ga0207703_100200207 324
19 3300026116 Ga0207674_10060720 Ga0207674_100607204 324
20 3300026121 Ga0207683_10077828 Ga0207683_100778284 324
21 3300005347 Ga0070668_100054542 Ga0070668_1000545422 325
22 3300005364 Ga0070673_100191555 Ga0070673_1001915551 325
23 3300005546 Ga0070696_100328052 Ga0070696_1003280522 325
24 3300005547 Ga0070693_100029667 Ga0070693_1000296673 325
25 3300005614 Ga0068856_100268869 Ga0068856_1002688691 325
26 3300005618 Ga0068864_100022858 Ga0068864_1000228586 325
27 3300005719 Ga0068861_100046937 Ga0068861_1000469373 325
28 3300006048 Ga0075363_100032653 Ga0075363_1000326534 325
29 3300006178 Ga0075367_10121105 Ga0075367_101211052 325
30 3300006186 Ga0075369_10023433 Ga0075369_100234332 325
31 3300006237 Ga0097621_100397979 Ga0097621_1003979791 325
32 3300006871 Ga0075434_100089864 Ga0075434_1000898643 325
33 3300007076 Ga0075435_100136733 Ga0075435_1001367333 325
34 3300009098 Ga0105245_10022060 Ga0105245_100220604 325
35 3300009101 Ga0105247_10098234 Ga0105247_100982342 325
36 3300009174 Ga0105241_10011582 Ga0105241_100115823 325
37 3300009176 Ga0105242_10243960 Ga0105242_102439603 325
38 3300009177 Ga0105248_10305821 Ga0105248_103058212 325
39 3300011119 Ga0105246_10065552 Ga0105246_100655523 325
40 3300013297 Ga0157378_10065059 Ga0157378_100650592 325
41 3300014968 Ga0157379_10009770 Ga0157379_100097703 325
42 3300025901 Ga0207688_10008512 Ga0207688_100085124 325
43 3300025945 Ga0207679_10213117 Ga0207679_102131172 325
44 3300025949 Ga0207667_10022704 Ga0207667_100227044 325
45 3300025961 Ga0207712_10292538 Ga0207712_102925382 325
46 3300026067 Ga0207678_10020266 Ga0207678_100202664 325
47 3300028379 Ga0268266_10003520 Ga0268266_1000352013 325
48 3300031824 Ga0307413_10342515 Ga0307413_103425151 325
49 3300031852 Ga0307410_10146451 Ga0307410_101464512 325
50 3300031995 Ga0307409_100108860 Ga0307409_1001088602 325
51 3300032126 Ga0307415_100098171 Ga0307415_1000981712 325
52 3300048912 Ga0496109_0326184 Ga0496109_0326184_58_1077 325
53 3300048924 Ga0496121_0077879 Ga0496121_0077879_1071_2090 325
54 3300048924 Ga0496121_0109884 Ga0496121_0109884_410_1411 325
55 3300046690 Ga0495624_0077277 Ga0495624_0077277_10_1002 329
56 3300048909 Ga0496106_0449219 Ga0496106_0449219_17_1012 330
57 3300049571 Ga0501034_0062682 Ga0501034_0062682_438_1472 330
58 3300049573 Ga0501037_0225449 Ga0501037_0225449_144_1175 330
59 3300049574 Ga0501038_0335843 Ga0501038_0335843_66_1100 330
60 3300049589 Ga0501073_0112399 Ga0501073_0112399_166_1197 330
61 3300049744 Ga0501083_0024209 Ga0501083_0024209_2638_3672 330
62 3300049823 Ga0501044_0346885 Ga0501044_0346885_124_1155 330
63 iso_pu_bacteria 2523533628 2524002035 330
64 3300049587 Ga0501071_0197316 Ga0501071_0197316_73_1071 331
65 iso_pu_bacteria 2508501128 2509152946 333
66 iso_pu_bacteria 2513237098 2513676203 333
67 iso_pu_bacteria 2513237141 2513891790 333
68 iso_pu_bacteria 2879110137 2879113469 333
69 iso_pu_bacteria 2885383462 2885387758 333
70 iso_pu_bacteria 2903768456 2903776058 333
71 iso_pu_bacteria 2922361189 2922367593 333
72 iso_pu_bacteria 8006984368 8006986130 333
73 iso_pu_bacteria 8056681323 8056684949 333
74 3300025937 Ga0207669_10284567 Ga0207669_102845672 334
75 3300049592 Ga0501076_0360254 Ga0501076_0360254_54_1061 334
76 3300050507 nmdc:mga05p37_169120_c1 nmdc:mga05p37_169120_c1_1536_2543 334
77 iso_pu_bacteria 2876808645 2876817297 334
78 iso_pu_bacteria 2922386360 2922391570 334
79 3300003215 JGI25153J46596_10003408 JGI25153J46596_100034082 335
80 3300005937 Ga0081455_10017524 Ga0081455_100175243 335
81 3300013104 Ga0157370_10267753 Ga0157370_102677532 335
82 3300013297 Ga0157378_10453096 Ga0157378_104530961 335
83 3300025928 Ga0207700_10109656 Ga0207700_101096562 335
84 3300025938 Ga0207704_10076035 Ga0207704_100760351 335
85 3300035083 Ga0373926_0028032 Ga0373926_0028032_103_1116 335
86 3300035724 Ga0373933_0167291 Ga0373933_0167291_217_1230 335
87 3300035725 Ga0373947_0015555 Ga0373947_0015555_1390_2403 335
88 3300036401 Ga0373937_0079525 Ga0373937_0079525_1723_2736 335
89 3300037068 Ga0373925_0014297 Ga0373925_0014297_3053_4066 335
90 3300044842 Ga0466957_0020434 Ga0466957_0020434_1520_2530 335
91 3300046455 Ga0495603_0013671 Ga0495603_0013671_1505_2518 335
92 3300046533 Ga0495640_0010134 Ga0495640_0010134_17_1030 335
93 3300047315 Ga0495581_0142860 Ga0495581_0142860_21_1034 335
94 3300047321 Ga0495676_0106802 Ga0495676_0106802_998_2011 335
95 3300047321 Ga0495676_0225735 Ga0495676_0225735_77_1090 335
96 3300048927 Ga0496124_0209480 Ga0496124_0209480_436_1452 335
97 3300049568 Ga0501031_0020555 Ga0501031_0020555_820_1830 335
98 3300049569 Ga0501032_0010657 Ga0501032_0010657_4443_5453 335
99 3300049570 Ga0501033_0218137 Ga0501033_0218137_231_1241 335
100 3300049572 Ga0501036_0058223 Ga0501036_0058223_1905_2915 335
101 3300049573 Ga0501037_0006555 Ga0501037_0006555_4363_5373 335
102 3300049574 Ga0501038_0012755 Ga0501038_0012755_6485_7495 335
103 3300049575 Ga0501039_0013895 Ga0501039_0013895_2388_3398 335
104 3300049578 Ga0501042_0116899 Ga0501042_0116899_712_1722 335
105 3300049579 Ga0501043_0147370 Ga0501043_0147370_182_1192 335
106 3300049582 Ga0501048_0008156 Ga0501048_0008156_3469_4479 335
107 3300049583 Ga0501067_0107955 Ga0501067_0107955_398_1408 335
108 3300049589 Ga0501073_0017482 Ga0501073_0017482_1796_2806 335
109 3300049741 Ga0501079_0052021 Ga0501079_0052021_1974_2984 335
110 3300049742 Ga0501080_0004302 Ga0501080_0004302_2637_3647 335
111 3300049822 Ga0501035_0058046 Ga0501035_0058046_208_1218 335
112 3300049823 Ga0501044_0325863 Ga0501044_0325863_268_1278 335
113 3300049824 Ga0501045_0006385 Ga0501045_0006385_4546_5556 335
114 3300053084 Ga0495595_0026424 Ga0495595_0026424_896_1909 335
115 iso_pu_bacteria 8019648815 8019659198 335
116 3300003203 JGI25406J46586_10012611 JGI25406J46586_100126113 336
117 3300003322 rootL2_10012969 rootL2_100129692 336
118 3300003322 rootL2_10063627 rootL2_100636272 336
119 3300005293 Ga0065715_10013501 Ga0065715_100135012 336
120 3300005327 Ga0070658_10062172 Ga0070658_100621723 336
121 3300005328 Ga0070676_10176591 Ga0070676_101765911 336
122 3300005336 Ga0070680_100015827 Ga0070680_1000158276 336
123 3300005336 Ga0070680_100144466 Ga0070680_1001444662 336
124 3300005337 Ga0070682_100048792 Ga0070682_1000487922 336
125 3300005338 Ga0068868_100112486 Ga0068868_1001124862 336
126 3300005339 Ga0070660_100034705 Ga0070660_1000347053 336
127 3300005339 Ga0070660_100156777 Ga0070660_1001567772 336
128 3300005340 Ga0070689_100038243 Ga0070689_1000382432 336
129 3300005340 Ga0070689_100134241 Ga0070689_1001342412 336
130 3300005340 Ga0070689_100315161 Ga0070689_1003151612 336
131 3300005341 Ga0070691_10088076 Ga0070691_100880762 336
132 3300005344 Ga0070661_100139130 Ga0070661_1001391302 336
133 3300005354 Ga0070675_100175790 Ga0070675_1001757902 336
134 3300005354 Ga0070675_100206932 Ga0070675_1002069322 336
135 3300005365 Ga0070688_100035417 Ga0070688_1000354172 336
136 3300005434 Ga0070709_10007255 Ga0070709_100072552 336
137 3300005434 Ga0070709_10145095 Ga0070709_101450952 336
138 3300005435 Ga0070714_100006438 Ga0070714_1000064381 336
139 3300005435 Ga0070714_100145063 Ga0070714_1001450631 336
140 3300005436 Ga0070713_100002174 Ga0070713_10000217411 336
141 3300005437 Ga0070710_10001572 Ga0070710_100015722 336
142 3300005437 Ga0070710_10070553 Ga0070710_100705531 336
143 3300005438 Ga0070701_10079880 Ga0070701_100798802 336
144 3300005439 Ga0070711_100014780 Ga0070711_1000147801 336
145 3300005439 Ga0070711_100120268 Ga0070711_1001202682 336
146 3300005440 Ga0070705_100065311 Ga0070705_1000653112 336
147 3300005444 Ga0070694_100115155 Ga0070694_1001151552 336
148 3300005457 Ga0070662_100200916 Ga0070662_1002009162 336
149 3300005466 Ga0070685_10003228 Ga0070685_100032282 336
150 3300005466 Ga0070685_10047451 Ga0070685_100474512 336
151 3300005518 Ga0070699_100228220 Ga0070699_1002282202 336
152 3300005530 Ga0070679_100007468 Ga0070679_1000074689 336
153 3300005530 Ga0070679_100113217 Ga0070679_1001132172 336
154 3300005535 Ga0070684_100137566 Ga0070684_1001375662 336
155 3300005535 Ga0070684_100191759 Ga0070684_1001917592 336
156 3300005543 Ga0070672_100131021 Ga0070672_1001310212 336
157 3300005544 Ga0070686_100008642 Ga0070686_1000086423 336
158 3300005545 Ga0070695_100050294 Ga0070695_1000502942 336
159 3300005546 Ga0070696_100019736 Ga0070696_1000197363 336
160 3300005546 Ga0070696_100096334 Ga0070696_1000963342 336
161 3300005548 Ga0070665_100003089 Ga0070665_1000030894 336
162 3300005548 Ga0070665_100100308 Ga0070665_1001003083 336
163 3300005548 Ga0070665_100325215 Ga0070665_1003252152 336
164 3300005549 Ga0070704_100099381 Ga0070704_1000993812 336
165 3300005564 Ga0070664_100205097 Ga0070664_1002050971 336
166 3300005564 Ga0070664_100393522 Ga0070664_1003935222 336
167 3300005578 Ga0068854_100161078 Ga0068854_1001610781 336
168 3300005614 Ga0068856_100214312 Ga0068856_1002143122 336
169 3300005615 Ga0070702_100071192 Ga0070702_1000711922 336
170 3300005616 Ga0068852_100502165 Ga0068852_1005021652 336
171 3300005617 Ga0068859_100108247 Ga0068859_1001082472 336
172 3300005617 Ga0068859_100324384 Ga0068859_1003243841 336
173 3300005617 Ga0068859_100634567 Ga0068859_1006345671 336
174 3300005719 Ga0068861_100071532 Ga0068861_1000715322 336
175 3300005841 Ga0068863_100325413 Ga0068863_1003254131 336
176 3300005842 Ga0068858_100264114 Ga0068858_1002641142 336
177 3300005843 Ga0068860_100161156 Ga0068860_1001611562 336
178 3300005937 Ga0081455_10002164 Ga0081455_1000216410 336
179 3300005937 Ga0081455_10005135 Ga0081455_100051357 336
180 3300005937 Ga0081455_10075118 Ga0081455_100751182 336
181 3300005983 Ga0081540_1000003 Ga0081540_100000372 336
182 3300005983 Ga0081540_1069932 Ga0081540_10699321 336
183 3300005985 Ga0081539_10006579 Ga0081539_100065793 336
184 3300006028 Ga0070717_10000145 Ga0070717_1000014517 336
185 3300006038 Ga0075365_10021005 Ga0075365_100210053 336
186 3300006042 Ga0075368_10013893 Ga0075368_100138932 336
187 3300006051 Ga0075364_10036380 Ga0075364_100363803 336
188 3300006163 Ga0070715_10010667 Ga0070715_100106674 336
189 3300006163 Ga0070715_10031164 Ga0070715_100311642 336
190 3300006173 Ga0070716_100001181 Ga0070716_1000011817 336
191 3300006175 Ga0070712_100049746 Ga0070712_1000497462 336
192 3300006175 Ga0070712_100181561 Ga0070712_1001815612 336
193 3300006175 Ga0070712_100365565 Ga0070712_1003655651 336
194 3300006177 Ga0075362_10048926 Ga0075362_100489262 336
195 3300006177 Ga0075362_10050768 Ga0075362_100507682 336
196 3300006195 Ga0075366_10000683 Ga0075366_1000068324 336
197 3300006852 Ga0075433_10145190 Ga0075433_101451902 336
198 3300006852 Ga0075433_10178314 Ga0075433_101783142 336
199 3300006871 Ga0075434_100060274 Ga0075434_1000602743 336
200 3300006881 Ga0068865_100003336 Ga0068865_1000033362 336
201 3300006881 Ga0068865_100146513 Ga0068865_1001465132 336
202 3300006931 Ga0097620_100036260 Ga0097620_1000362603 336
203 3300006931 Ga0097620_100108258 Ga0097620_1001082582 336
204 3300006931 Ga0097620_100324375 Ga0097620_1003243751 336
205 3300006931 Ga0097620_100634561 Ga0097620_1006345611 336
206 3300007076 Ga0075435_100068074 Ga0075435_1000680742 336
207 3300009011 Ga0105251_10018941 Ga0105251_100189414 336
208 3300009093 Ga0105240_10141825 Ga0105240_101418252 336
209 3300009094 Ga0111539_10611391 Ga0111539_106113911 336
210 3300009098 Ga0105245_10487115 Ga0105245_104871152 336
211 3300009101 Ga0105247_10028620 Ga0105247_100286203 336
212 3300009147 Ga0114129_10032431 Ga0114129_100324313 336
213 3300009148 Ga0105243_10003342 Ga0105243_1000334213 336
214 3300009177 Ga0105248_10042172 Ga0105248_100421723 336
215 3300009545 Ga0105237_10214090 Ga0105237_102140902 336
216 3300009551 Ga0105238_10024303 Ga0105238_100243037 336
217 3300009553 Ga0105249_10068005 Ga0105249_100680052 336
218 3300010375 Ga0105239_10391869 Ga0105239_103918692 336
219 3300011119 Ga0105246_10017007 Ga0105246_100170075 336
220 3300013100 Ga0157373_10028445 Ga0157373_100284451 336
221 3300013100 Ga0157373_10088792 Ga0157373_100887922 336
222 3300013296 Ga0157374_10185808 Ga0157374_101858082 336
223 3300013306 Ga0163162_10098682 Ga0163162_100986825 336
224 3300013306 Ga0163162_10115117 Ga0163162_101151172 336
225 3300013306 Ga0163162_10254230 Ga0163162_102542301 336
226 3300013307 Ga0157372_10521485 Ga0157372_105214852 336
227 3300013308 Ga0157375_10221404 Ga0157375_102214042 336
228 3300014325 Ga0163163_10008161 Ga0163163_100081617 336
229 3300014325 Ga0163163_10106583 Ga0163163_101065833 336
230 3300014326 Ga0157380_10066178 Ga0157380_100661782 336
231 3300014968 Ga0157379_10160933 Ga0157379_101609332 336
232 3300017792 Ga0163161_10040937 Ga0163161_100409371 336
233 3300021358 Ga0213873_10010885 Ga0213873_100108851 336
234 3300021388 Ga0213875_10064615 Ga0213875_100646152 336
235 3300025261 Ga0209233_1009777 Ga0209233_10097771 336
236 3300025297 Ga0209758_1003134 Ga0209758_100313410 336
237 3300025315 Ga0207697_10008012 Ga0207697_100080123 336
238 3300025885 Ga0207653_10043937 Ga0207653_100439372 336
239 3300025898 Ga0207692_10001804 Ga0207692_100018045 336
240 3300025898 Ga0207692_10054227 Ga0207692_100542271 336
241 3300025899 Ga0207642_10054229 Ga0207642_100542291 336
242 3300025900 Ga0207710_10008485 Ga0207710_100084854 336
243 3300025901 Ga0207688_10095171 Ga0207688_100951712 336
244 3300025903 Ga0207680_10113217 Ga0207680_101132172 336
245 3300025906 Ga0207699_10002006 Ga0207699_100020067 336
246 3300025906 Ga0207699_10035160 Ga0207699_100351602 336
247 3300025906 Ga0207699_10130381 Ga0207699_101303811 336
248 3300025907 Ga0207645_10022233 Ga0207645_100222332 336
249 3300025908 Ga0207643_10065545 Ga0207643_100655452 336
250 3300025915 Ga0207693_10003437 Ga0207693_100034378 336
251 3300025917 Ga0207660_10019768 Ga0207660_100197682 336
252 3300025917 Ga0207660_10130750 Ga0207660_101307502 336
253 3300025917 Ga0207660_10188228 Ga0207660_101882281 336
254 3300025918 Ga0207662_10024440 Ga0207662_100244405 336
255 3300025918 Ga0207662_10107520 Ga0207662_101075201 336
256 3300025919 Ga0207657_10007133 Ga0207657_100071334 336
257 3300025919 Ga0207657_10103233 Ga0207657_101032332 336
258 3300025919 Ga0207657_10145585 Ga0207657_101455852 336
259 3300025919 Ga0207657_10371787 Ga0207657_103717871 336
260 3300025921 Ga0207652_10246798 Ga0207652_102467982 336
261 3300025923 Ga0207681_10244203 Ga0207681_102442031 336
262 3300025924 Ga0207694_10040801 Ga0207694_100408014 336
263 3300025926 Ga0207659_10256393 Ga0207659_102563931 336
264 3300025927 Ga0207687_10016883 Ga0207687_100168832 336
265 3300025928 Ga0207700_10069876 Ga0207700_100698762 336
266 3300025929 Ga0207664_10015721 Ga0207664_100157213 336
267 3300025929 Ga0207664_10062629 Ga0207664_100626292 336
268 3300025931 Ga0207644_10019223 Ga0207644_100192234 336
269 3300025933 Ga0207706_10025928 Ga0207706_100259285 336
270 3300025934 Ga0207686_10019347 Ga0207686_100193472 336
271 3300025935 Ga0207709_10129708 Ga0207709_101297081 336
272 3300025935 Ga0207709_10190006 Ga0207709_101900062 336
273 3300025936 Ga0207670_10247355 Ga0207670_102473552 336
274 3300025936 Ga0207670_10274744 Ga0207670_102747441 336
275 3300025938 Ga0207704_10127221 Ga0207704_101272212 336
276 3300025939 Ga0207665_10000265 Ga0207665_1000026522 336
277 3300025939 Ga0207665_10181487 Ga0207665_101814871 336
278 3300025940 Ga0207691_10059624 Ga0207691_100596244 336
279 3300025941 Ga0207711_10161106 Ga0207711_101611062 336
280 3300025941 Ga0207711_10445534 Ga0207711_104455342 336
281 3300025942 Ga0207689_10026799 Ga0207689_100267994 336
282 3300025942 Ga0207689_10036991 Ga0207689_100369912 336
283 3300025945 Ga0207679_10192388 Ga0207679_101923882 336
284 3300025961 Ga0207712_10044316 Ga0207712_100443162 336
285 3300025961 Ga0207712_10148345 Ga0207712_101483452 336
286 3300025981 Ga0207640_10379988 Ga0207640_103799881 336
287 3300026023 Ga0207677_10152986 Ga0207677_101529862 336
288 3300026023 Ga0207677_10247977 Ga0207677_102479772 336
289 3300026035 Ga0207703_10203559 Ga0207703_102035591 336
290 3300026041 Ga0207639_10377092 Ga0207639_103770921 336
291 3300026067 Ga0207678_10042834 Ga0207678_100428344 336
292 3300026067 Ga0207678_10204133 Ga0207678_102041332 336
293 3300026088 Ga0207641_10070957 Ga0207641_100709572 336
294 3300026089 Ga0207648_10098908 Ga0207648_100989082 336
295 3300026095 Ga0207676_10124025 Ga0207676_101240252 336
296 3300026116 Ga0207674_10081040 Ga0207674_100810402 336
297 3300026118 Ga0207675_100030151 Ga0207675_1000301512 336
298 3300026118 Ga0207675_100071292 Ga0207675_1000712923 336
299 3300026121 Ga0207683_10006706 Ga0207683_100067067 336
300 3300026121 Ga0207683_10027799 Ga0207683_100277993 336
301 3300027907 Ga0207428_10161743 Ga0207428_101617433 336
302 3300028379 Ga0268266_10010718 Ga0268266_100107186 336
303 3300028379 Ga0268266_10012789 Ga0268266_100127895 336
304 3300028380 Ga0268265_10016767 Ga0268265_100167674 336
305 3300028380 Ga0268265_10221763 Ga0268265_102217632 336
306 3300028381 Ga0268264_10220235 Ga0268264_102202351 336
307 3300028556 Ga0265337_1000250 Ga0265337_100025019 336
308 3300031241 Ga0265325_10000053 Ga0265325_1000005376 336
309 3300031241 Ga0265325_10038429 Ga0265325_100384291 336
310 3300031247 Ga0265340_10014213 Ga0265340_100142132 336
311 3300031249 Ga0265339_10001034 Ga0265339_1000103411 336
312 3300031250 Ga0265331_10041003 Ga0265331_100410031 336
313 3300031595 Ga0265313_10032472 Ga0265313_100324723 336
314 3300031711 Ga0265314_10002155 Ga0265314_1000215513 336
315 3300031711 Ga0265314_10008989 Ga0265314_100089895 336
316 3300031712 Ga0265342_10000954 Ga0265342_100009548 336
317 3300032004 Ga0307414_10062579 Ga0307414_100625793 336
318 3300035089 Ga0373944_0005309 Ga0373944_0005309_886_1902 336
319 3300035091 Ga0373951_0002572 Ga0373951_0002572_2015_3031 336
320 3300035113 Ga0373936_0022463 Ga0373936_0022463_975_1988 336
321 3300035118 Ga0373954_0005693 Ga0373954_0005693_2650_3672 336
322 3300035118 Ga0373954_0013257 Ga0373954_0013257_2627_3640 336
323 3300035170 Ga0373943_0001738 Ga0373943_0001738_2531_3547 336
324 3300035171 Ga0373946_0054624 Ga0373946_0054624_243_1256 336
325 3300035172 Ga0373955_0002538 Ga0373955_0002538_3290_4303 336
326 3300035241 Ga0373961_0001489 Ga0373961_0001489_3352_4368 336
327 3300035242 Ga0373962_0006224 Ga0373962_0006224_1358_2374 336
328 3300035242 Ga0373962_0040725 Ga0373962_0040725_269_1285 336
329 3300035410 Ga0373924_0005203 Ga0373924_0005203_2111_3124 336
330 3300035410 Ga0373924_0084262 Ga0373924_0084262_295_1317 336
331 3300035691 Ga0373931_0009518 Ga0373931_0009518_1666_2682 336
332 3300035692 Ga0373935_0025423 Ga0373935_0025423_231_1247 336
333 3300035692 Ga0373935_0058894 Ga0373935_0058894_358_1380 336
334 3300035695 Ga0373927_0009273 Ga0373927_0009273_2628_3644 336
335 3300035725 Ga0373947_0007515 Ga0373947_0007515_578_1594 336
336 3300037068 Ga0373925_0026861 Ga0373925_0026861_2854_3870 336
337 3300037068 Ga0373925_0153002 Ga0373925_0153002_265_1278 336
338 3300037853 Ga0436364_0650169 Ga0436364_0650169_1122_2168 336
339 3300039438 Ga0436360_0654994 Ga0436360_0654994_2044_3060 336
340 3300044658 Ga0466972_0144708 Ga0466972_0144708_17_1039 336
341 3300044684 Ga0466966_0106983 Ga0466966_0106983_50_1069 336
342 3300044712 Ga0453684_0073767 Ga0453684_0073767_1101_2123 336
343 3300044901 Ga0466960_0106618 Ga0466960_0106618_188_1210 336
344 3300046455 Ga0495603_0016198 Ga0495603_0016198_2770_3786 336
345 3300046459 Ga0495629_0000875 Ga0495629_0000875_12208_13224 336
346 3300046460 Ga0495638_0000001 Ga0495638_0000001_98203_99222 336
347 3300046461 Ga0495641_0013172 Ga0495641_0013172_3210_4226 336
348 3300046462 Ga0495651_0011085 Ga0495651_0011085_5238_6260 336
349 3300046472 Ga0495580_0139365 Ga0495580_0139365_156_1169 336
350 3300046473 Ga0495582_0002081 Ga0495582_0002081_936_1952 336
351 3300046476 Ga0495662_0010543 Ga0495662_0010543_277_1290 336
352 3300046511 Ga0495608_0187345 Ga0495608_0187345_206_1228 336
353 3300046516 Ga0495628_0180945 Ga0495628_0180945_397_1419 336
354 3300046529 Ga0495652_0054907 Ga0495652_0054907_1452_2474 336
355 3300046531 Ga0495665_0009115 Ga0495665_0009115_838_1851 336
356 3300046536 Ga0495587_0019919 Ga0495587_0019919_55_1077 336
357 3300046557 Ga0495622_0029702 Ga0495622_0029702_338_1354 336
358 3300046559 Ga0495667_0003730 Ga0495667_0003730_8705_9727 336
359 3300046675 Ga0495657_0050996 Ga0495657_0050996_1641_2663 336
360 3300046681 Ga0495647_0026764 Ga0495647_0026764_568_1581 336
361 3300046681 Ga0495647_0039151 Ga0495647_0039151_769_1785 336
362 3300046689 Ga0495613_0025427 Ga0495613_0025427_3068_4084 336
363 3300046694 Ga0495649_0017234 Ga0495649_0017234_384_1406 336
364 3300046809 Ga0495600_0121576 Ga0495600_0121576_619_1635 336
365 3300047315 Ga0495581_0034674 Ga0495581_0034674_385_1398 336
366 3300047317 Ga0495604_0026274 Ga0495604_0026274_3382_4395 336
367 3300047317 Ga0495604_0123031 Ga0495604_0123031_538_1560 336
368 3300047321 Ga0495676_0207563 Ga0495676_0207563_251_1267 336
369 3300047322 Ga0495680_0003824 Ga0495680_0003824_7871_8887 336
370 3300047322 Ga0495680_0062166 Ga0495680_0062166_801_1823 336
371 3300047444 Ga0495675_0083554 Ga0495675_0083554_160_1173 336
372 3300047673 Ga0495593_0018424 Ga0495593_0018424_2324_3340 336
373 3300048089 Ga0495614_0062847 Ga0495614_0062847_181_1197 336
374 3300048904 Ga0496101_0041308 Ga0496101_0041308_184_1209 336
375 3300048904 Ga0496101_0168376 Ga0496101_0168376_522_1538 336
376 3300048905 Ga0496102_0110985 Ga0496102_0110985_762_1778 336
377 3300048906 Ga0496103_0123017 Ga0496103_0123017_493_1518 336
378 3300048908 Ga0496105_0162266 Ga0496105_0162266_97_1113 336
379 3300048911 Ga0496108_0111538 Ga0496108_0111538_1191_2207 336
380 3300048911 Ga0496108_0221945 Ga0496108_0221945_399_1415 336
381 3300048912 Ga0496109_0035838 Ga0496109_0035838_184_1200 336
382 3300048912 Ga0496109_0044564 Ga0496109_0044564_1955_2971 336
383 3300048913 Ga0496110_0107336 Ga0496110_0107336_743_1759 336
384 3300048913 Ga0496110_0140359 Ga0496110_0140359_133_1158 336
385 3300048913 Ga0496110_0148898 Ga0496110_0148898_133_1149 336
386 3300048914 Ga0496111_0032388 Ga0496111_0032388_1672_2688 336
387 3300048915 Ga0496112_0049919 Ga0496112_0049919_2879_3895 336
388 3300048915 Ga0496112_0051378 Ga0496112_0051378_2050_3075 336
389 3300048916 Ga0496113_0016647 Ga0496113_0016647_1062_2078 336
390 3300048916 Ga0496113_0017879 Ga0496113_0017879_2877_3893 336
391 3300048916 Ga0496113_0053175 Ga0496113_0053175_1046_2071 336
392 3300048916 Ga0496113_0158842 Ga0496113_0158842_44_1060 336
393 3300048917 Ga0496114_0010689 Ga0496114_0010689_4061_5086 336
394 3300048918 Ga0496115_0119726 Ga0496115_0119726_1129_2145 336
395 3300048918 Ga0496115_0126245 Ga0496115_0126245_184_1209 336
396 3300048918 Ga0496115_0359122 Ga0496115_0359122_92_1108 336
397 3300049571 Ga0501034_0050543 Ga0501034_0050543_1467_2486 336
398 3300049571 Ga0501034_0166923 Ga0501034_0166923_405_1424 336
399 3300049581 Ga0501047_0310083 Ga0501047_0310083_198_1307 336
400 3300049583 Ga0501067_0024052 Ga0501067_0024052_1408_2427 336
401 3300049586 Ga0501070_0338977 Ga0501070_0338977_146_1165 336
402 3300049590 Ga0501074_0206742 Ga0501074_0206742_160_1179 336
403 3300049670 Ga0501236_002505 Ga0501236_002505_832_1857 336
404 3300049823 Ga0501044_0001046 Ga0501044_0001046_7939_8958 336
405 3300050489 nmdc:mga03683_25880_c1 nmdc:mga03683_25880_c1_575_1588 336
406 3300050489 nmdc:mga03683_39931_c1 nmdc:mga03683_39931_c1_564_1583 336
407 3300050493 nmdc:mga0k408_14171_c1 nmdc:mga0k408_14171_c1_3036_4049 336
408 3300050493 nmdc:mga0k408_17808_c1 nmdc:mga0k408_17808_c1_626_1651 336
409 3300050494 nmdc:mga06z11_39561_c1 nmdc:mga06z11_39561_c1_524_1549 336
410 3300050495 nmdc:mga04h51_5977_c1 nmdc:mga04h51_5977_c1_716_1729 336
411 3300050496 nmdc:mga07m45_31280_c1 nmdc:mga07m45_31280_c1_1301_2317 336
412 3300050496 nmdc:mga07m45_31947_c1 nmdc:mga07m45_31947_c1_1348_2361 336
413 3300050507 nmdc:mga05p37_21969_c1 nmdc:mga05p37_21969_c1_2379_3416 336
414 3300050511 nmdc:mga08y16_26137_c1 nmdc:mga08y16_26137_c1_2318_3349 336
415 3300050512 nmdc:mga0n895_7805_c1 nmdc:mga0n895_7805_c1_2538_3575 336
416 3300050513 nmdc:mga0rr50_63076_c1 nmdc:mga0rr50_63076_c1_522_1538 336
417 3300050513 nmdc:mga0rr50_73140_c1 nmdc:mga0rr50_73140_c1_88_1125 336
418 3300050515 nmdc:mga0a205_24887_c1 nmdc:mga0a205_24887_c1_1056_2093 336
419 3300050515 nmdc:mga0a205_64992_c1 nmdc:mga0a205_64992_c1_1555_2577 336
420 3300053078 Ga0495612_0008457 Ga0495612_0008457_2354_3376 336
421 3300053084 Ga0495595_0036015 Ga0495595_0036015_340_1359 336
422 3300053085 Ga0495619_0043925 Ga0495619_0043925_329_1345 336
423 3300053085 Ga0495619_0208993 Ga0495619_0208993_150_1166 336
424 3300053087 Ga0500643_004385 Ga0500643_004385_624_1643 336
425 3300053088 Ga0500644_0000369 Ga0500644_0000369_1413_2432 336
426 3300053094 Ga0500566_0012802 Ga0500566_0012802_2369_3388 336
427 3300053096 Ga0500641_0033274 Ga0500641_0033274_191_1210 336
428 3300053119 Ga0500595_000029 Ga0500595_000029_84340_85359 336
429 3300053153 Ga0500616_0000009 Ga0500616_0000009_632592_633611 336
430 3300053155 Ga0500620_028566 Ga0500620_028566_387_1400 336
431 3300053158 Ga0500627_0026978 Ga0500627_0026978_517_1530 336
432 3300053163 Ga0500639_040115 Ga0500639_040115_843_1859 336
433 3300053730 Ga0500645_000143 Ga0500645_000143_11256_12275 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

250

0.93

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

295

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

313

0.83

PF08659

KR

KR domain

1

161

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

272

0.72

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

243

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9643 2 336
5u4q-assembly1.cif.gz_B 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9612 2 336
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9603 2 335
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9516 2 335
6zla-assembly2.cif.gz_D-2 crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad 0.9233 4 332
ID Description Score Start End Superfamily
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 4 335 3.40.50.720
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.947 4 34 3.50.50.60
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 4 335 3.40.50.720
af_O65936_46_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9219 3 34 3.50.50.60
af_O65404_36_399_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9214 3 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A529I3D6-F1-model_v4 deleted 0.9891 180 335
AF-A0A523M0X6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9863 4 129
AF-A0A2E1M331-F1-model_v4 Capsular biosynthesis protein CpsI 0.984 4 335
AF-B9TG48-F1-model_v4 UDP-glucuronate 5-epimerase, putative (EC 5.1.3.12) 0.9836 193 335 GO:0016853
AF-A0A3C0Q6Z7-F1-model_v4 Capsular biosynthesis protein CpsI 0.9825 164 335

Feature Viewer

pLDDT pTM Quality
90.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map