F442818
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 433 | 299 | 420 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10036784|Ga0105240_100367845 |
| Length | 324 |
| Sequence | MTVVVTGVAGFVGYHVARALLGRGQHVIGIDSVNDYYDVRLKEARLAQLGQIAGFSFHRLDIADSDSLISVLERARPVSGVVHLAAQAGVRYSLQNPFAYVHSNVLGQVAVFNAVRQLDPAPALVYASSSSVYGGNRKLPFAVADRVDHPVSLYAATKRSGELLAESYAAMYGLASTGLRFFTLYGPWGRPDMAYYSFTAAILGGQPIPVFNEGRLERDFTYIDDAVIGILAALDQPTNPERLHRLYNLGNNKPEPVLRFIEVLERAVGRKAIFRFEPMQPGDVVATAAEIEDSRRDLAFEPATSIDEGLPRFVSWYKAYHGVT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 5 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 6 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 7 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 8 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 9 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 10 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 275 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 287 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 289 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 291 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 292 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 294 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 296 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 297 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 298 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 299 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97 |
| Metatranscriptomes | 0 |
| Isolates | 3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.39 |
| Nodule | 1.85 |
| Rhizoplane | 6 |
| Rhizosphere | 82.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10012611 | 3300003203 | Bacteria | 3658 |
| 2 | JGI25153J46596_10003408 | 3300003215 | Bacteria | 8907 |
| 3 | rootL2_10012969 | 3300003322 | Bacteria | 25272 |
| 4 | rootL2_10063627 | 3300003322 | Bacteria | 1977 |
| 5 | Ga0065715_10013501 | 3300005293 | Bacteria | 1876 |
| 6 | Ga0070658_10062172 | 3300005327 | Bacteria | 3043 |
| 7 | Ga0070676_10176591 | 3300005328 | Bacteria | 1386 |
| 8 | Ga0070680_100015827 | 3300005336 | Bacteria | 5921 |
| 9 | Ga0070680_100144466 | 3300005336 | Bacteria | 1995 |
| 10 | Ga0070682_100048792 | 3300005337 | Bacteria | 2637 |
| 11 | Ga0068868_100112486 | 3300005338 | Bacteria | 2213 |
| 12 | Ga0070660_100034705 | 3300005339 | Bacteria | 3813 |
| 13 | Ga0070660_100156777 | 3300005339 | Bacteria | 1833 |
| 14 | Ga0070689_100038243 | 3300005340 | Bacteria | 3670 |
| 15 | Ga0070689_100134241 | 3300005340 | Bacteria | 1986 |
| 16 | Ga0070689_100315161 | 3300005340 | Bacteria | 1305 |
| 17 | Ga0070691_10088076 | 3300005341 | Bacteria | 1528 |
| 18 | Ga0070661_100139130 | 3300005344 | Bacteria | 1828 |
| 19 | Ga0070668_100054542 | 3300005347 | Bacteria | 3083 |
| 20 | Ga0070675_100175790 | 3300005354 | Bacteria | 1849 |
| 21 | Ga0070675_100206932 | 3300005354 | Bacteria | 1705 |
| 22 | Ga0070671_100039169 | 3300005355 | Bacteria | 3934 |
| 23 | Ga0070673_100191555 | 3300005364 | Bacteria | 1757 |
| 24 | Ga0070688_100035417 | 3300005365 | Bacteria | 3032 |
| 25 | Ga0070667_100097444 | 3300005367 | Bacteria | 2537 |
| 26 | Ga0070709_10007255 | 3300005434 | Bacteria | 6075 |
| 27 | Ga0070709_10145095 | 3300005434 | Bacteria | 1634 |
| 28 | Ga0070714_100006438 | 3300005435 | Bacteria | 9068 |
| 29 | Ga0070714_100145063 | 3300005435 | Bacteria | 2134 |
| 30 | Ga0070713_100002174 | 3300005436 | Bacteria | 12691 |
| 31 | Ga0070710_10001572 | 3300005437 | Bacteria | 10784 |
| 32 | Ga0070710_10070553 | 3300005437 | Bacteria | 2013 |
| 33 | Ga0070701_10079880 | 3300005438 | Bacteria | 1768 |
| 34 | Ga0070711_100014780 | 3300005439 | Bacteria | 4927 |
| 35 | Ga0070711_100120268 | 3300005439 | Bacteria | 1941 |
| 36 | Ga0070705_100065311 | 3300005440 | Bacteria | 2178 |
| 37 | Ga0070694_100115155 | 3300005444 | Bacteria | 1921 |
| 38 | Ga0070662_100200916 | 3300005457 | Bacteria | 1581 |
| 39 | Ga0070685_10003228 | 3300005466 | Bacteria | 8293 |
| 40 | Ga0070685_10047451 | 3300005466 | Bacteria | 2470 |
| 41 | Ga0070699_100228220 | 3300005518 | Bacteria | 1660 |
| 42 | Ga0070679_100007468 | 3300005530 | Bacteria | 10218 |
| 43 | Ga0070679_100113217 | 3300005530 | Bacteria | 2699 |
| 44 | Ga0070684_100137566 | 3300005535 | Bacteria | 2207 |
| 45 | Ga0070684_100191759 | 3300005535 | Bacteria | 1860 |
| 46 | Ga0070672_100131021 | 3300005543 | Bacteria | 2061 |
| 47 | Ga0070686_100008642 | 3300005544 | Bacteria | 5706 |
| 48 | Ga0070695_100050294 | 3300005545 | Bacteria | 2670 |
| 49 | Ga0070696_100019736 | 3300005546 | Bacteria | 4568 |
| 50 | Ga0070696_100096334 | 3300005546 | Bacteria | 2114 |
| 51 | Ga0070696_100328052 | 3300005546 | Bacteria | 1180 |
| 52 | Ga0070693_100029667 | 3300005547 | Bacteria | 2985 |
| 53 | Ga0070665_100003089 | 3300005548 | Bacteria | 17925 |
| 54 | Ga0070665_100100308 | 3300005548 | Bacteria | 2899 |
| 55 | Ga0070665_100325215 | 3300005548 | Bacteria | 1542 |
| 56 | Ga0070704_100099381 | 3300005549 | Bacteria | 2188 |
| 57 | Ga0070664_100205097 | 3300005564 | Bacteria | 1760 |
| 58 | Ga0070664_100393522 | 3300005564 | Bacteria | 1266 |
| 59 | Ga0068854_100161078 | 3300005578 | Bacteria | 1738 |
| 60 | Ga0068856_100214312 | 3300005614 | Bacteria | 1941 |
| 61 | Ga0068856_100268869 | 3300005614 | Bacteria | 1720 |
| 62 | Ga0070702_100071192 | 3300005615 | Bacteria | 2055 |
| 63 | Ga0068852_100502165 | 3300005616 | Bacteria | 1208 |
| 64 | Ga0068859_100108247 | 3300005617 | Bacteria | 2840 |
| 65 | Ga0068859_100324384 | 3300005617 | Bacteria | 1634 |
| 66 | Ga0068859_100634567 | 3300005617 | Bacteria | 1161 |
| 67 | Ga0068864_100022858 | 3300005618 | Bacteria | 5245 |
| 68 | Ga0068861_100046937 | 3300005719 | Bacteria | 3258 |
| 69 | Ga0068861_100071532 | 3300005719 | Bacteria | 2689 |
| 70 | Ga0068863_100325413 | 3300005841 | Bacteria | 1494 |
| 71 | Ga0068858_100264114 | 3300005842 | Bacteria | 1637 |
| 72 | Ga0068860_100161156 | 3300005843 | Bacteria | 2163 |
| 73 | Ga0081455_10002164 | 3300005937 | Bacteria | 23439 |
| 74 | Ga0081455_10005135 | 3300005937 | Bacteria | 14429 |
| 75 | Ga0081455_10017524 | 3300005937 | Bacteria | 6862 |
| 76 | Ga0081455_10075118 | 3300005937 | Bacteria | 2789 |
| 77 | Ga0081540_1000003 | 3300005983 | Bacteria | 233942 |
| 78 | Ga0081540_1003510 | 3300005983 | Bacteria | 12375 |
| 79 | Ga0081540_1069932 | 3300005983 | Bacteria | 1628 |
| 80 | Ga0081539_10006579 | 3300005985 | Bacteria | 11056 |
| 81 | Ga0070717_10000145 | 3300006028 | Bacteria | 52677 |
| 82 | Ga0075365_10021005 | 3300006038 | Bacteria | 4063 |
| 83 | Ga0075365_10074743 | 3300006038 | Bacteria | 2286 |
| 84 | Ga0075368_10013893 | 3300006042 | Bacteria | 2963 |
| 85 | Ga0075363_100032653 | 3300006048 | Bacteria | 2705 |
| 86 | Ga0075364_10036380 | 3300006051 | Bacteria | 3182 |
| 87 | Ga0070715_10010667 | 3300006163 | Bacteria | 3282 |
| 88 | Ga0070715_10031164 | 3300006163 | Bacteria | 2162 |
| 89 | Ga0070716_100001181 | 3300006173 | Bacteria | 11493 |
| 90 | Ga0070712_100049746 | 3300006175 | Bacteria | 2912 |
| 91 | Ga0070712_100181561 | 3300006175 | Bacteria | 1640 |
| 92 | Ga0070712_100365565 | 3300006175 | Bacteria | 1184 |
| 93 | Ga0075362_10048926 | 3300006177 | Bacteria | 1887 |
| 94 | Ga0075362_10050768 | 3300006177 | Bacteria | 1855 |
| 95 | Ga0075367_10121105 | 3300006178 | Bacteria | 1612 |
| 96 | Ga0075369_10023433 | 3300006186 | Bacteria | 2552 |
| 97 | Ga0075366_10000683 | 3300006195 | Bacteria | 16043 |
| 98 | Ga0097621_100397979 | 3300006237 | Bacteria | 1232 |
| 99 | Ga0075433_10145190 | 3300006852 | Bacteria | 2109 |
| 100 | Ga0075433_10178314 | 3300006852 | Bacteria | 1890 |
| 101 | Ga0075434_100060274 | 3300006871 | Bacteria | 3774 |
| 102 | Ga0075434_100089864 | 3300006871 | Bacteria | 3072 |
| 103 | Ga0068865_100003336 | 3300006881 | Bacteria | 9612 |
| 104 | Ga0068865_100146513 | 3300006881 | Bacteria | 1786 |
| 105 | Ga0097620_100036260 | 3300006931 | Bacteria | 4950 |
| 106 | Ga0097620_100108258 | 3300006931 | Bacteria | 2840 |
| 107 | Ga0097620_100324375 | 3300006931 | Bacteria | 1634 |
| 108 | Ga0097620_100634561 | 3300006931 | Bacteria | 1161 |
| 109 | Ga0075435_100068074 | 3300007076 | Bacteria | 2899 |
| 110 | Ga0075435_100136733 | 3300007076 | Bacteria | 2053 |
| 111 | Ga0105251_10018941 | 3300009011 | Bacteria | 3647 |
| 112 | Ga0105240_10036784 | 3300009093 | Bacteria | 6294 |
| 113 | Ga0105240_10141825 | 3300009093 | Bacteria | 2872 |
| 114 | Ga0111539_10611391 | 3300009094 | Bacteria | 1269 |
| 115 | Ga0105245_10022060 | 3300009098 | Bacteria | 5589 |
| 116 | Ga0105245_10487115 | 3300009098 | Bacteria | 1247 |
| 117 | Ga0105247_10028620 | 3300009101 | Bacteria | 3372 |
| 118 | Ga0105247_10098234 | 3300009101 | Bacteria | 1869 |
| 119 | Ga0114129_10032431 | 3300009147 | Bacteria | 7383 |
| 120 | Ga0105243_10003342 | 3300009148 | Bacteria | 13016 |
| 121 | Ga0105241_10011582 | 3300009174 | Bacteria | 6466 |
| 122 | Ga0105242_10243960 | 3300009176 | Bacteria | 1616 |
| 123 | Ga0105248_10042172 | 3300009177 | Bacteria | 5117 |
| 124 | Ga0105248_10305821 | 3300009177 | Bacteria | 1790 |
| 125 | Ga0105237_10214090 | 3300009545 | Bacteria | 1926 |
| 126 | Ga0105238_10024303 | 3300009551 | Bacteria | 6177 |
| 127 | Ga0105249_10068005 | 3300009553 | Bacteria | 3284 |
| 128 | Ga0105239_10391869 | 3300010375 | Bacteria | 1571 |
| 129 | Ga0105246_10017007 | 3300011119 | Bacteria | 4618 |
| 130 | Ga0105246_10065552 | 3300011119 | Bacteria | 2539 |
| 131 | Ga0157373_10028445 | 3300013100 | Bacteria | 4032 |
| 132 | Ga0157373_10088792 | 3300013100 | Bacteria | 2178 |
| 133 | Ga0157370_10267753 | 3300013104 | Bacteria | 1579 |
| 134 | Ga0157374_10185808 | 3300013296 | Bacteria | 2032 |
| 135 | Ga0157378_10065059 | 3300013297 | Bacteria | 3263 |
| 136 | Ga0157378_10453096 | 3300013297 | Bacteria | 1274 |
| 137 | Ga0163162_10078863 | 3300013306 | Bacteria | 3359 |
| 138 | Ga0163162_10098682 | 3300013306 | Bacteria | 3011 |
| 139 | Ga0163162_10115117 | 3300013306 | Bacteria | 2789 |
| 140 | Ga0163162_10254230 | 3300013306 | Bacteria | 1889 |
| 141 | Ga0157372_10521485 | 3300013307 | Bacteria | 1385 |
| 142 | Ga0157375_10221404 | 3300013308 | Bacteria | 2051 |
| 143 | Ga0163163_10008161 | 3300014325 | Bacteria | 9285 |
| 144 | Ga0163163_10106583 | 3300014325 | Bacteria | 2829 |
| 145 | Ga0157380_10066178 | 3300014326 | Bacteria | 2906 |
| 146 | Ga0157379_10009770 | 3300014968 | Bacteria | 8359 |
| 147 | Ga0157379_10160933 | 3300014968 | Bacteria | 2026 |
| 148 | Ga0163161_10040937 | 3300017792 | Bacteria | 3329 |
| 149 | Ga0213873_10010885 | 3300021358 | Bacteria | 1931 |
| 150 | Ga0213875_10064615 | 3300021388 | Bacteria | 1710 |
| 151 | Ga0209233_1009777 | 3300025261 | Bacteria | 2904 |
| 152 | Ga0209758_1003134 | 3300025297 | Bacteria | 15604 |
| 153 | Ga0207697_10008012 | 3300025315 | Bacteria | 4665 |
| 154 | Ga0207653_10043937 | 3300025885 | Bacteria | 1472 |
| 155 | Ga0207692_10001804 | 3300025898 | Bacteria | 8121 |
| 156 | Ga0207692_10054227 | 3300025898 | Bacteria | 2046 |
| 157 | Ga0207642_10054229 | 3300025899 | Bacteria | 1828 |
| 158 | Ga0207710_10008485 | 3300025900 | Bacteria | 4332 |
| 159 | Ga0207688_10008512 | 3300025901 | Bacteria | 5584 |
| 160 | Ga0207688_10095171 | 3300025901 | Bacteria | 1714 |
| 161 | Ga0207680_10113217 | 3300025903 | Bacteria | 1763 |
| 162 | Ga0207699_10002006 | 3300025906 | Bacteria | 9614 |
| 163 | Ga0207699_10035160 | 3300025906 | Bacteria | 2849 |
| 164 | Ga0207699_10130381 | 3300025906 | Bacteria | 1639 |
| 165 | Ga0207645_10022233 | 3300025907 | Bacteria | 4128 |
| 166 | Ga0207643_10065545 | 3300025908 | Bacteria | 2081 |
| 167 | Ga0207654_10004600 | 3300025911 | Bacteria | 6967 |
| 168 | Ga0207693_10003437 | 3300025915 | Bacteria | 13514 |
| 169 | Ga0207660_10019768 | 3300025917 | Bacteria | 4508 |
| 170 | Ga0207660_10130750 | 3300025917 | Bacteria | 1911 |
| 171 | Ga0207660_10188228 | 3300025917 | Bacteria | 1606 |
| 172 | Ga0207662_10024440 | 3300025918 | Bacteria | 3477 |
| 173 | Ga0207662_10107520 | 3300025918 | Bacteria | 1736 |
| 174 | Ga0207657_10007133 | 3300025919 | Bacteria | 11476 |
| 175 | Ga0207657_10103233 | 3300025919 | Bacteria | 2363 |
| 176 | Ga0207657_10145585 | 3300025919 | Bacteria | 1933 |
| 177 | Ga0207657_10371787 | 3300025919 | Bacteria | 1126 |
| 178 | Ga0207652_10246798 | 3300025921 | Bacteria | 1610 |
| 179 | Ga0207681_10244203 | 3300025923 | Bacteria | 1399 |
| 180 | Ga0207694_10040801 | 3300025924 | Bacteria | 3575 |
| 181 | Ga0207659_10256393 | 3300025926 | Bacteria | 1421 |
| 182 | Ga0207687_10016883 | 3300025927 | Bacteria | 4799 |
| 183 | Ga0207700_10069876 | 3300025928 | Bacteria | 2697 |
| 184 | Ga0207700_10109656 | 3300025928 | Bacteria | 2218 |
| 185 | Ga0207664_10015721 | 3300025929 | Bacteria | 5502 |
| 186 | Ga0207664_10062629 | 3300025929 | Bacteria | 2971 |
| 187 | Ga0207644_10019223 | 3300025931 | Bacteria | 4630 |
| 188 | Ga0207706_10025928 | 3300025933 | Bacteria | 5249 |
| 189 | Ga0207686_10019347 | 3300025934 | Bacteria | 3870 |
| 190 | Ga0207709_10129708 | 3300025935 | Bacteria | 1716 |
| 191 | Ga0207709_10190006 | 3300025935 | Bacteria | 1458 |
| 192 | Ga0207670_10247355 | 3300025936 | Bacteria | 1376 |
| 193 | Ga0207670_10274744 | 3300025936 | Bacteria | 1311 |
| 194 | Ga0207669_10284567 | 3300025937 | Bacteria | 1249 |
| 195 | Ga0207704_10076035 | 3300025938 | Bacteria | 2150 |
| 196 | Ga0207704_10127221 | 3300025938 | Bacteria | 1756 |
| 197 | Ga0207665_10000265 | 3300025939 | Bacteria | 36482 |
| 198 | Ga0207665_10181487 | 3300025939 | Bacteria | 1524 |
| 199 | Ga0207691_10059624 | 3300025940 | Bacteria | 3469 |
| 200 | Ga0207711_10161106 | 3300025941 | Bacteria | 2031 |
| 201 | Ga0207711_10445534 | 3300025941 | Bacteria | 1205 |
| 202 | Ga0207689_10011270 | 3300025942 | Bacteria | 7672 |
| 203 | Ga0207689_10026799 | 3300025942 | Bacteria | 4826 |
| 204 | Ga0207689_10036991 | 3300025942 | Bacteria | 4051 |
| 205 | Ga0207679_10192388 | 3300025945 | Bacteria | 1697 |
| 206 | Ga0207679_10213117 | 3300025945 | Bacteria | 1621 |
| 207 | Ga0207667_10022704 | 3300025949 | Bacteria | 6922 |
| 208 | Ga0207712_10044316 | 3300025961 | Bacteria | 3074 |
| 209 | Ga0207712_10148345 | 3300025961 | Bacteria | 1809 |
| 210 | Ga0207712_10292538 | 3300025961 | Bacteria | 1333 |
| 211 | Ga0207668_10044495 | 3300025972 | Bacteria | 3020 |
| 212 | Ga0207640_10379988 | 3300025981 | Bacteria | 1144 |
| 213 | Ga0207677_10152986 | 3300026023 | Bacteria | 1782 |
| 214 | Ga0207677_10247977 | 3300026023 | Bacteria | 1444 |
| 215 | Ga0207703_10020020 | 3300026035 | Bacteria | 5228 |
| 216 | Ga0207703_10203559 | 3300026035 | Bacteria | 1760 |
| 217 | Ga0207639_10377092 | 3300026041 | Bacteria | 1273 |
| 218 | Ga0207678_10020266 | 3300026067 | Bacteria | 5836 |
| 219 | Ga0207678_10042834 | 3300026067 | Bacteria | 3919 |
| 220 | Ga0207678_10204133 | 3300026067 | Bacteria | 1690 |
| 221 | Ga0207641_10070957 | 3300026088 | Bacteria | 2994 |
| 222 | Ga0207648_10098908 | 3300026089 | Bacteria | 2555 |
| 223 | Ga0207676_10124025 | 3300026095 | Bacteria | 2183 |
| 224 | Ga0207674_10060720 | 3300026116 | Bacteria | 3822 |
| 225 | Ga0207674_10081040 | 3300026116 | Bacteria | 3248 |
| 226 | Ga0207675_100030151 | 3300026118 | Bacteria | 5051 |
| 227 | Ga0207675_100071292 | 3300026118 | Bacteria | 3248 |
| 228 | Ga0207683_10006706 | 3300026121 | Bacteria | 9851 |
| 229 | Ga0207683_10027799 | 3300026121 | Bacteria | 4888 |
| 230 | Ga0207683_10077828 | 3300026121 | Bacteria | 2938 |
| 231 | Ga0207428_10161743 | 3300027907 | Bacteria | 1700 |
| 232 | Ga0268266_10003520 | 3300028379 | Bacteria | 15543 |
| 233 | Ga0268266_10010718 | 3300028379 | Bacteria | 7987 |
| 234 | Ga0268266_10012789 | 3300028379 | Bacteria | 7250 |
| 235 | Ga0268265_10016767 | 3300028380 | Bacteria | 5041 |
| 236 | Ga0268265_10221763 | 3300028380 | Bacteria | 1655 |
| 237 | Ga0268264_10220235 | 3300028381 | Bacteria | 1747 |
| 238 | Ga0265337_1000250 | 3300028556 | Bacteria | 29184 |
| 239 | Ga0265325_10000053 | 3300031241 | Bacteria | 77918 |
| 240 | Ga0265325_10038429 | 3300031241 | Bacteria | 2526 |
| 241 | Ga0265340_10014213 | 3300031247 | Bacteria | 4165 |
| 242 | Ga0265339_10001034 | 3300031249 | Bacteria | 21208 |
| 243 | Ga0265331_10041003 | 3300031250 | Bacteria | 2250 |
| 244 | Ga0265313_10032472 | 3300031595 | Bacteria | 2665 |
| 245 | Ga0265314_10002155 | 3300031711 | Bacteria | 20584 |
| 246 | Ga0265314_10008989 | 3300031711 | Bacteria | 8499 |
| 247 | Ga0265342_10000954 | 3300031712 | Bacteria | 28791 |
| 248 | Ga0307413_10342515 | 3300031824 | Bacteria | 1150 |
| 249 | Ga0307410_10146451 | 3300031852 | Bacteria | 1753 |
| 250 | Ga0307409_100108860 | 3300031995 | Bacteria | 2318 |
| 251 | Ga0307414_10062579 | 3300032004 | Bacteria | 2642 |
| 252 | Ga0307415_100098171 | 3300032126 | Bacteria | 2140 |
| 253 | Ga0373926_0028032 | 3300035083 | Bacteria | 1976 |
| 254 | Ga0373944_0005309 | 3300035089 | Bacteria | 3388 |
| 255 | Ga0373951_0002572 | 3300035091 | Bacteria | 4559 |
| 256 | Ga0373936_0022463 | 3300035113 | Bacteria | 2456 |
| 257 | Ga0373954_0005693 | 3300035118 | Bacteria | 5406 |
| 258 | Ga0373954_0013257 | 3300035118 | Bacteria | 3672 |
| 259 | Ga0373943_0001738 | 3300035170 | Bacteria | 9877 |
| 260 | Ga0373946_0054624 | 3300035171 | Bacteria | 1681 |
| 261 | Ga0373955_0002538 | 3300035172 | Bacteria | 7986 |
| 262 | Ga0373961_0001489 | 3300035241 | Bacteria | 6855 |
| 263 | Ga0373962_0006224 | 3300035242 | Bacteria | 2887 |
| 264 | Ga0373962_0040725 | 3300035242 | Bacteria | 1307 |
| 265 | Ga0373924_0005203 | 3300035410 | Bacteria | 4592 |
| 266 | Ga0373924_0084262 | 3300035410 | Bacteria | 1355 |
| 267 | Ga0373931_0009518 | 3300035691 | Bacteria | 4645 |
| 268 | Ga0373935_0025423 | 3300035692 | Bacteria | 3649 |
| 269 | Ga0373935_0058894 | 3300035692 | Bacteria | 2454 |
| 270 | Ga0373927_0009273 | 3300035695 | Bacteria | 6600 |
| 271 | Ga0373933_0167291 | 3300035724 | Bacteria | 1398 |
| 272 | Ga0373947_0007515 | 3300035725 | Bacteria | 6305 |
| 273 | Ga0373947_0015555 | 3300035725 | Bacteria | 4370 |
| 274 | Ga0373937_0079525 | 3300036401 | Bacteria | 3030 |
| 275 | Ga0373925_0014297 | 3300037068 | Bacteria | 5742 |
| 276 | Ga0373925_0026861 | 3300037068 | Bacteria | 4214 |
| 277 | Ga0373925_0153002 | 3300037068 | Bacteria | 1812 |
| 278 | Ga0436364_0650169 | 3300037853 | Bacteria | 2410 |
| 279 | Ga0436360_0654994 | 3300039438 | Bacteria | 8074 |
| 280 | Ga0466972_0144708 | 3300044658 | Bacteria | 1118 |
| 281 | Ga0466966_0106983 | 3300044684 | Bacteria | 1726 |
| 282 | Ga0453684_0073767 | 3300044712 | Bacteria | 4300 |
| 283 | Ga0466957_0020434 | 3300044842 | Bacteria | 3897 |
| 284 | Ga0466960_0106618 | 3300044901 | Bacteria | 1450 |
| 285 | Ga0495592_0013943 | 3300046454 | Bacteria | 6105 |
| 286 | Ga0495603_0013671 | 3300046455 | Bacteria | 4912 |
| 287 | Ga0495603_0016198 | 3300046455 | Bacteria | 4510 |
| 288 | Ga0495629_0000875 | 3300046459 | Bacteria | 24261 |
| 289 | Ga0495638_0000001 | 3300046460 | Bacteria | 1114121 |
| 290 | Ga0495641_0013172 | 3300046461 | Bacteria | 4566 |
| 291 | Ga0495651_0011085 | 3300046462 | Bacteria | 6933 |
| 292 | Ga0495580_0139365 | 3300046472 | Bacteria | 1681 |
| 293 | Ga0495582_0002081 | 3300046473 | Bacteria | 11192 |
| 294 | Ga0495662_0010543 | 3300046476 | Bacteria | 4521 |
| 295 | Ga0495608_0187345 | 3300046511 | Bacteria | 1307 |
| 296 | Ga0495628_0041236 | 3300046516 | Bacteria | 3685 |
| 297 | Ga0495628_0180945 | 3300046516 | Bacteria | 1595 |
| 298 | Ga0495652_0054907 | 3300046529 | Bacteria | 3390 |
| 299 | Ga0495665_0009115 | 3300046531 | Bacteria | 5377 |
| 300 | Ga0495640_0010134 | 3300046533 | Bacteria | 7304 |
| 301 | Ga0495587_0019919 | 3300046536 | Bacteria | 4146 |
| 302 | Ga0495622_0029702 | 3300046557 | Bacteria | 2554 |
| 303 | Ga0495667_0003730 | 3300046559 | Bacteria | 10251 |
| 304 | Ga0495657_0050996 | 3300046675 | Bacteria | 2780 |
| 305 | Ga0495647_0026764 | 3300046681 | Bacteria | 2115 |
| 306 | Ga0495647_0039151 | 3300046681 | Bacteria | 1796 |
| 307 | Ga0495613_0025427 | 3300046689 | Bacteria | 4411 |
| 308 | Ga0495624_0077277 | 3300046690 | Bacteria | 2065 |
| 309 | Ga0495624_0089814 | 3300046690 | Bacteria | 1895 |
| 310 | Ga0495649_0017234 | 3300046694 | Bacteria | 4079 |
| 311 | Ga0495600_0121576 | 3300046809 | Bacteria | 1698 |
| 312 | Ga0495581_0034674 | 3300047315 | Bacteria | 2919 |
| 313 | Ga0495581_0142860 | 3300047315 | Bacteria | 1397 |
| 314 | Ga0495604_0026274 | 3300047317 | Bacteria | 4636 |
| 315 | Ga0495604_0123031 | 3300047317 | Bacteria | 1875 |
| 316 | Ga0495676_0106802 | 3300047321 | Bacteria | 2062 |
| 317 | Ga0495676_0207563 | 3300047321 | Bacteria | 1357 |
| 318 | Ga0495676_0225735 | 3300047321 | Bacteria | 1289 |
| 319 | Ga0495680_0003824 | 3300047322 | Bacteria | 14615 |
| 320 | Ga0495680_0062166 | 3300047322 | Bacteria | 2872 |
| 321 | Ga0495675_0083554 | 3300047444 | Bacteria | 2010 |
| 322 | Ga0495593_0018424 | 3300047673 | Bacteria | 3922 |
| 323 | Ga0495614_0062847 | 3300048089 | Bacteria | 1596 |
| 324 | Ga0496101_0041308 | 3300048904 | Bacteria | 3288 |
| 325 | Ga0496101_0168376 | 3300048904 | Bacteria | 1683 |
| 326 | Ga0496102_0110985 | 3300048905 | Bacteria | 2556 |
| 327 | Ga0496103_0123017 | 3300048906 | Bacteria | 1653 |
| 328 | Ga0496105_0162266 | 3300048908 | Bacteria | 1835 |
| 329 | Ga0496106_0449219 | 3300048909 | Bacteria | 1035 |
| 330 | Ga0496108_0111538 | 3300048911 | Bacteria | 2339 |
| 331 | Ga0496108_0221945 | 3300048911 | Bacteria | 1642 |
| 332 | Ga0496109_0035838 | 3300048912 | Bacteria | 4478 |
| 333 | Ga0496109_0044564 | 3300048912 | Bacteria | 4024 |
| 334 | Ga0496109_0326184 | 3300048912 | Bacteria | 1449 |
| 335 | Ga0496110_0107336 | 3300048913 | Bacteria | 2506 |
| 336 | Ga0496110_0140359 | 3300048913 | Bacteria | 2184 |
| 337 | Ga0496110_0148898 | 3300048913 | Bacteria | 2118 |
| 338 | Ga0496111_0032388 | 3300048914 | Bacteria | 3727 |
| 339 | Ga0496112_0049919 | 3300048915 | Bacteria | 4101 |
| 340 | Ga0496112_0051378 | 3300048915 | Bacteria | 4043 |
| 341 | Ga0496112_0555820 | 3300048915 | Bacteria | 1081 |
| 342 | Ga0496113_0016647 | 3300048916 | Bacteria | 5083 |
| 343 | Ga0496113_0017879 | 3300048916 | Bacteria | 4928 |
| 344 | Ga0496113_0053175 | 3300048916 | Bacteria | 3027 |
| 345 | Ga0496113_0158842 | 3300048916 | Bacteria | 1786 |
| 346 | Ga0496114_0010689 | 3300048917 | Bacteria | 7305 |
| 347 | Ga0496115_0119726 | 3300048918 | Bacteria | 2165 |
| 348 | Ga0496115_0126245 | 3300048918 | Bacteria | 2107 |
| 349 | Ga0496115_0359122 | 3300048918 | Bacteria | 1187 |
| 350 | Ga0496121_0077879 | 3300048924 | Bacteria | 2638 |
| 351 | Ga0496121_0109884 | 3300048924 | Bacteria | 2105 |
| 352 | Ga0496124_0209480 | 3300048927 | Bacteria | 1476 |
| 353 | Ga0501031_0020555 | 3300049568 | Bacteria | 4304 |
| 354 | Ga0501032_0010657 | 3300049569 | Bacteria | 6617 |
| 355 | Ga0501033_0218137 | 3300049570 | Bacteria | 1358 |
| 356 | Ga0501034_0050543 | 3300049571 | Bacteria | 4193 |
| 357 | Ga0501034_0052315 | 3300049571 | Bacteria | 4114 |
| 358 | Ga0501034_0062682 | 3300049571 | Bacteria | 3734 |
| 359 | Ga0501034_0166923 | 3300049571 | Bacteria | 2170 |
| 360 | Ga0501036_0058223 | 3300049572 | Bacteria | 3273 |
| 361 | Ga0501037_0006555 | 3300049573 | Bacteria | 8520 |
| 362 | Ga0501037_0225449 | 3300049573 | Bacteria | 1317 |
| 363 | Ga0501038_0012755 | 3300049574 | Bacteria | 7676 |
| 364 | Ga0501038_0335843 | 3300049574 | Bacteria | 1179 |
| 365 | Ga0501039_0013895 | 3300049575 | Bacteria | 6160 |
| 366 | Ga0501042_0116899 | 3300049578 | Bacteria | 1920 |
| 367 | Ga0501043_0147370 | 3300049579 | Bacteria | 1842 |
| 368 | Ga0501043_0187665 | 3300049579 | Bacteria | 1609 |
| 369 | Ga0501047_0310083 | 3300049581 | Bacteria | 1419 |
| 370 | Ga0501048_0008156 | 3300049582 | Bacteria | 7922 |
| 371 | Ga0501067_0024052 | 3300049583 | Bacteria | 3378 |
| 372 | Ga0501067_0107955 | 3300049583 | Bacteria | 1547 |
| 373 | Ga0501069_0088783 | 3300049585 | Bacteria | 1747 |
| 374 | Ga0501070_0338977 | 3300049586 | Bacteria | 1221 |
| 375 | Ga0501071_0197316 | 3300049587 | Bacteria | 1511 |
| 376 | Ga0501073_0017482 | 3300049589 | Bacteria | 5194 |
| 377 | Ga0501073_0112399 | 3300049589 | Bacteria | 1889 |
| 378 | Ga0501074_0206742 | 3300049590 | Bacteria | 1399 |
| 379 | Ga0501076_0360254 | 3300049592 | Bacteria | 1195 |
| 380 | Ga0501236_002505 | 3300049670 | Bacteria | 2111 |
| 381 | Ga0501079_0052021 | 3300049741 | Bacteria | 3163 |
| 382 | Ga0501080_0004302 | 3300049742 | Bacteria | 12645 |
| 383 | Ga0501083_0024209 | 3300049744 | Bacteria | 4208 |
| 384 | Ga0501035_0058046 | 3300049822 | Bacteria | 3449 |
| 385 | Ga0501044_0001046 | 3300049823 | Bacteria | 33251 |
| 386 | Ga0501044_0325863 | 3300049823 | Bacteria | 1459 |
| 387 | Ga0501044_0346885 | 3300049823 | Bacteria | 1405 |
| 388 | Ga0501045_0006385 | 3300049824 | Bacteria | 8162 |
| 389 | nmdc:mga03683_25880_c1 | 3300050489 | Bacteria | 2309 |
| 390 | nmdc:mga03683_39931_c1 | 3300050489 | Bacteria | 1922 |
| 391 | nmdc:mga0k408_14171_c1 | 3300050493 | Bacteria | 4387 |
| 392 | nmdc:mga0k408_17808_c1 | 3300050493 | Bacteria | 3960 |
| 393 | nmdc:mga06z11_39561_c1 | 3300050494 | Bacteria | 2347 |
| 394 | nmdc:mga04h51_5977_c1 | 3300050495 | Bacteria | 2049 |
| 395 | nmdc:mga07m45_31280_c1 | 3300050496 | Bacteria | 2949 |
| 396 | nmdc:mga07m45_31947_c1 | 3300050496 | Bacteria | 2919 |
| 397 | nmdc:mga05p37_169120_c1 | 3300050507 | Bacteria | 2666 |
| 398 | nmdc:mga05p37_21969_c1 | 3300050507 | Bacteria | 7730 |
| 399 | nmdc:mga08y16_26137_c1 | 3300050511 | Bacteria | 6157 |
| 400 | nmdc:mga0n895_7805_c1 | 3300050512 | Bacteria | 9222 |
| 401 | nmdc:mga0rr50_63076_c1 | 3300050513 | Bacteria | 2798 |
| 402 | nmdc:mga0rr50_73140_c1 | 3300050513 | Bacteria | 2620 |
| 403 | nmdc:mga0a205_24887_c1 | 3300050515 | Bacteria | 5697 |
| 404 | nmdc:mga0a205_64992_c1 | 3300050515 | Bacteria | 3524 |
| 405 | Ga0495612_0008457 | 3300053078 | Bacteria | 4174 |
| 406 | Ga0495595_0026424 | 3300053084 | Bacteria | 2580 |
| 407 | Ga0495595_0036015 | 3300053084 | Bacteria | 2244 |
| 408 | Ga0495619_0043925 | 3300053085 | Bacteria | 2931 |
| 409 | Ga0495619_0208993 | 3300053085 | Bacteria | 1352 |
| 410 | Ga0500643_004385 | 3300053087 | Bacteria | 6403 |
| 411 | Ga0500644_0000369 | 3300053088 | Bacteria | 22061 |
| 412 | Ga0500566_0012802 | 3300053094 | Bacteria | 4938 |
| 413 | Ga0500641_0033274 | 3300053096 | Bacteria | 2045 |
| 414 | Ga0500595_000029 | 3300053119 | Bacteria | 122318 |
| 415 | Ga0500588_0048742 | 3300053146 | Bacteria | 1311 |
| 416 | Ga0500616_0000009 | 3300053153 | Bacteria | 779095 |
| 417 | Ga0500620_028566 | 3300053155 | Bacteria | 1745 |
| 418 | Ga0500627_0026978 | 3300053158 | Bacteria | 2375 |
| 419 | Ga0500639_040115 | 3300053163 | Bacteria | 2464 |
| 420 | Ga0500645_000143 | 3300053730 | Bacteria | 56081 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1003510 | Ga0081540_10035103 | 299 |
| 2 | 3300046454 | Ga0495592_0013943 | Ga0495592_0013943_5177_6085 | 302 |
| 3 | 3300046516 | Ga0495628_0041236 | Ga0495628_0041236_24_932 | 302 |
| 4 | 3300046690 | Ga0495624_0089814 | Ga0495624_0089814_974_1882 | 302 |
| 5 | 3300048915 | Ga0496112_0555820 | Ga0496112_0555820_38_1000 | 308 |
| 6 | 3300049571 | Ga0501034_0052315 | Ga0501034_0052315_23_970 | 314 |
| 7 | 3300049585 | Ga0501069_0088783 | Ga0501069_0088783_780_1727 | 314 |
| 8 | 3300049579 | Ga0501043_0187665 | Ga0501043_0187665_12_974 | 319 |
| 9 | 3300009093 | Ga0105240_10036784 | Ga0105240_100367845 | 320 |
| 10 | 3300053146 | Ga0500588_0048742 | Ga0500588_0048742_299_1276 | 320 |
| 11 | 3300005355 | Ga0070671_100039169 | Ga0070671_1000391691 | 324 |
| 12 | 3300005367 | Ga0070667_100097444 | Ga0070667_1000974442 | 324 |
| 13 | 3300006038 | Ga0075365_10074743 | Ga0075365_100747433 | 324 |
| 14 | 3300013306 | Ga0163162_10078863 | Ga0163162_100788634 | 324 |
| 15 | 3300025911 | Ga0207654_10004600 | Ga0207654_100046008 | 324 |
| 16 | 3300025942 | Ga0207689_10011270 | Ga0207689_100112708 | 324 |
| 17 | 3300025972 | Ga0207668_10044495 | Ga0207668_100444952 | 324 |
| 18 | 3300026035 | Ga0207703_10020020 | Ga0207703_100200207 | 324 |
| 19 | 3300026116 | Ga0207674_10060720 | Ga0207674_100607204 | 324 |
| 20 | 3300026121 | Ga0207683_10077828 | Ga0207683_100778284 | 324 |
| 21 | 3300005347 | Ga0070668_100054542 | Ga0070668_1000545422 | 325 |
| 22 | 3300005364 | Ga0070673_100191555 | Ga0070673_1001915551 | 325 |
| 23 | 3300005546 | Ga0070696_100328052 | Ga0070696_1003280522 | 325 |
| 24 | 3300005547 | Ga0070693_100029667 | Ga0070693_1000296673 | 325 |
| 25 | 3300005614 | Ga0068856_100268869 | Ga0068856_1002688691 | 325 |
| 26 | 3300005618 | Ga0068864_100022858 | Ga0068864_1000228586 | 325 |
| 27 | 3300005719 | Ga0068861_100046937 | Ga0068861_1000469373 | 325 |
| 28 | 3300006048 | Ga0075363_100032653 | Ga0075363_1000326534 | 325 |
| 29 | 3300006178 | Ga0075367_10121105 | Ga0075367_101211052 | 325 |
| 30 | 3300006186 | Ga0075369_10023433 | Ga0075369_100234332 | 325 |
| 31 | 3300006237 | Ga0097621_100397979 | Ga0097621_1003979791 | 325 |
| 32 | 3300006871 | Ga0075434_100089864 | Ga0075434_1000898643 | 325 |
| 33 | 3300007076 | Ga0075435_100136733 | Ga0075435_1001367333 | 325 |
| 34 | 3300009098 | Ga0105245_10022060 | Ga0105245_100220604 | 325 |
| 35 | 3300009101 | Ga0105247_10098234 | Ga0105247_100982342 | 325 |
| 36 | 3300009174 | Ga0105241_10011582 | Ga0105241_100115823 | 325 |
| 37 | 3300009176 | Ga0105242_10243960 | Ga0105242_102439603 | 325 |
| 38 | 3300009177 | Ga0105248_10305821 | Ga0105248_103058212 | 325 |
| 39 | 3300011119 | Ga0105246_10065552 | Ga0105246_100655523 | 325 |
| 40 | 3300013297 | Ga0157378_10065059 | Ga0157378_100650592 | 325 |
| 41 | 3300014968 | Ga0157379_10009770 | Ga0157379_100097703 | 325 |
| 42 | 3300025901 | Ga0207688_10008512 | Ga0207688_100085124 | 325 |
| 43 | 3300025945 | Ga0207679_10213117 | Ga0207679_102131172 | 325 |
| 44 | 3300025949 | Ga0207667_10022704 | Ga0207667_100227044 | 325 |
| 45 | 3300025961 | Ga0207712_10292538 | Ga0207712_102925382 | 325 |
| 46 | 3300026067 | Ga0207678_10020266 | Ga0207678_100202664 | 325 |
| 47 | 3300028379 | Ga0268266_10003520 | Ga0268266_1000352013 | 325 |
| 48 | 3300031824 | Ga0307413_10342515 | Ga0307413_103425151 | 325 |
| 49 | 3300031852 | Ga0307410_10146451 | Ga0307410_101464512 | 325 |
| 50 | 3300031995 | Ga0307409_100108860 | Ga0307409_1001088602 | 325 |
| 51 | 3300032126 | Ga0307415_100098171 | Ga0307415_1000981712 | 325 |
| 52 | 3300048912 | Ga0496109_0326184 | Ga0496109_0326184_58_1077 | 325 |
| 53 | 3300048924 | Ga0496121_0077879 | Ga0496121_0077879_1071_2090 | 325 |
| 54 | 3300048924 | Ga0496121_0109884 | Ga0496121_0109884_410_1411 | 325 |
| 55 | 3300046690 | Ga0495624_0077277 | Ga0495624_0077277_10_1002 | 329 |
| 56 | 3300048909 | Ga0496106_0449219 | Ga0496106_0449219_17_1012 | 330 |
| 57 | 3300049571 | Ga0501034_0062682 | Ga0501034_0062682_438_1472 | 330 |
| 58 | 3300049573 | Ga0501037_0225449 | Ga0501037_0225449_144_1175 | 330 |
| 59 | 3300049574 | Ga0501038_0335843 | Ga0501038_0335843_66_1100 | 330 |
| 60 | 3300049589 | Ga0501073_0112399 | Ga0501073_0112399_166_1197 | 330 |
| 61 | 3300049744 | Ga0501083_0024209 | Ga0501083_0024209_2638_3672 | 330 |
| 62 | 3300049823 | Ga0501044_0346885 | Ga0501044_0346885_124_1155 | 330 |
| 63 | iso_pu_bacteria | 2523533628 | 2524002035 | 330 |
| 64 | 3300049587 | Ga0501071_0197316 | Ga0501071_0197316_73_1071 | 331 |
| 65 | iso_pu_bacteria | 2508501128 | 2509152946 | 333 |
| 66 | iso_pu_bacteria | 2513237098 | 2513676203 | 333 |
| 67 | iso_pu_bacteria | 2513237141 | 2513891790 | 333 |
| 68 | iso_pu_bacteria | 2879110137 | 2879113469 | 333 |
| 69 | iso_pu_bacteria | 2885383462 | 2885387758 | 333 |
| 70 | iso_pu_bacteria | 2903768456 | 2903776058 | 333 |
| 71 | iso_pu_bacteria | 2922361189 | 2922367593 | 333 |
| 72 | iso_pu_bacteria | 8006984368 | 8006986130 | 333 |
| 73 | iso_pu_bacteria | 8056681323 | 8056684949 | 333 |
| 74 | 3300025937 | Ga0207669_10284567 | Ga0207669_102845672 | 334 |
| 75 | 3300049592 | Ga0501076_0360254 | Ga0501076_0360254_54_1061 | 334 |
| 76 | 3300050507 | nmdc:mga05p37_169120_c1 | nmdc:mga05p37_169120_c1_1536_2543 | 334 |
| 77 | iso_pu_bacteria | 2876808645 | 2876817297 | 334 |
| 78 | iso_pu_bacteria | 2922386360 | 2922391570 | 334 |
| 79 | 3300003215 | JGI25153J46596_10003408 | JGI25153J46596_100034082 | 335 |
| 80 | 3300005937 | Ga0081455_10017524 | Ga0081455_100175243 | 335 |
| 81 | 3300013104 | Ga0157370_10267753 | Ga0157370_102677532 | 335 |
| 82 | 3300013297 | Ga0157378_10453096 | Ga0157378_104530961 | 335 |
| 83 | 3300025928 | Ga0207700_10109656 | Ga0207700_101096562 | 335 |
| 84 | 3300025938 | Ga0207704_10076035 | Ga0207704_100760351 | 335 |
| 85 | 3300035083 | Ga0373926_0028032 | Ga0373926_0028032_103_1116 | 335 |
| 86 | 3300035724 | Ga0373933_0167291 | Ga0373933_0167291_217_1230 | 335 |
| 87 | 3300035725 | Ga0373947_0015555 | Ga0373947_0015555_1390_2403 | 335 |
| 88 | 3300036401 | Ga0373937_0079525 | Ga0373937_0079525_1723_2736 | 335 |
| 89 | 3300037068 | Ga0373925_0014297 | Ga0373925_0014297_3053_4066 | 335 |
| 90 | 3300044842 | Ga0466957_0020434 | Ga0466957_0020434_1520_2530 | 335 |
| 91 | 3300046455 | Ga0495603_0013671 | Ga0495603_0013671_1505_2518 | 335 |
| 92 | 3300046533 | Ga0495640_0010134 | Ga0495640_0010134_17_1030 | 335 |
| 93 | 3300047315 | Ga0495581_0142860 | Ga0495581_0142860_21_1034 | 335 |
| 94 | 3300047321 | Ga0495676_0106802 | Ga0495676_0106802_998_2011 | 335 |
| 95 | 3300047321 | Ga0495676_0225735 | Ga0495676_0225735_77_1090 | 335 |
| 96 | 3300048927 | Ga0496124_0209480 | Ga0496124_0209480_436_1452 | 335 |
| 97 | 3300049568 | Ga0501031_0020555 | Ga0501031_0020555_820_1830 | 335 |
| 98 | 3300049569 | Ga0501032_0010657 | Ga0501032_0010657_4443_5453 | 335 |
| 99 | 3300049570 | Ga0501033_0218137 | Ga0501033_0218137_231_1241 | 335 |
| 100 | 3300049572 | Ga0501036_0058223 | Ga0501036_0058223_1905_2915 | 335 |
| 101 | 3300049573 | Ga0501037_0006555 | Ga0501037_0006555_4363_5373 | 335 |
| 102 | 3300049574 | Ga0501038_0012755 | Ga0501038_0012755_6485_7495 | 335 |
| 103 | 3300049575 | Ga0501039_0013895 | Ga0501039_0013895_2388_3398 | 335 |
| 104 | 3300049578 | Ga0501042_0116899 | Ga0501042_0116899_712_1722 | 335 |
| 105 | 3300049579 | Ga0501043_0147370 | Ga0501043_0147370_182_1192 | 335 |
| 106 | 3300049582 | Ga0501048_0008156 | Ga0501048_0008156_3469_4479 | 335 |
| 107 | 3300049583 | Ga0501067_0107955 | Ga0501067_0107955_398_1408 | 335 |
| 108 | 3300049589 | Ga0501073_0017482 | Ga0501073_0017482_1796_2806 | 335 |
| 109 | 3300049741 | Ga0501079_0052021 | Ga0501079_0052021_1974_2984 | 335 |
| 110 | 3300049742 | Ga0501080_0004302 | Ga0501080_0004302_2637_3647 | 335 |
| 111 | 3300049822 | Ga0501035_0058046 | Ga0501035_0058046_208_1218 | 335 |
| 112 | 3300049823 | Ga0501044_0325863 | Ga0501044_0325863_268_1278 | 335 |
| 113 | 3300049824 | Ga0501045_0006385 | Ga0501045_0006385_4546_5556 | 335 |
| 114 | 3300053084 | Ga0495595_0026424 | Ga0495595_0026424_896_1909 | 335 |
| 115 | iso_pu_bacteria | 8019648815 | 8019659198 | 335 |
| 116 | 3300003203 | JGI25406J46586_10012611 | JGI25406J46586_100126113 | 336 |
| 117 | 3300003322 | rootL2_10012969 | rootL2_100129692 | 336 |
| 118 | 3300003322 | rootL2_10063627 | rootL2_100636272 | 336 |
| 119 | 3300005293 | Ga0065715_10013501 | Ga0065715_100135012 | 336 |
| 120 | 3300005327 | Ga0070658_10062172 | Ga0070658_100621723 | 336 |
| 121 | 3300005328 | Ga0070676_10176591 | Ga0070676_101765911 | 336 |
| 122 | 3300005336 | Ga0070680_100015827 | Ga0070680_1000158276 | 336 |
| 123 | 3300005336 | Ga0070680_100144466 | Ga0070680_1001444662 | 336 |
| 124 | 3300005337 | Ga0070682_100048792 | Ga0070682_1000487922 | 336 |
| 125 | 3300005338 | Ga0068868_100112486 | Ga0068868_1001124862 | 336 |
| 126 | 3300005339 | Ga0070660_100034705 | Ga0070660_1000347053 | 336 |
| 127 | 3300005339 | Ga0070660_100156777 | Ga0070660_1001567772 | 336 |
| 128 | 3300005340 | Ga0070689_100038243 | Ga0070689_1000382432 | 336 |
| 129 | 3300005340 | Ga0070689_100134241 | Ga0070689_1001342412 | 336 |
| 130 | 3300005340 | Ga0070689_100315161 | Ga0070689_1003151612 | 336 |
| 131 | 3300005341 | Ga0070691_10088076 | Ga0070691_100880762 | 336 |
| 132 | 3300005344 | Ga0070661_100139130 | Ga0070661_1001391302 | 336 |
| 133 | 3300005354 | Ga0070675_100175790 | Ga0070675_1001757902 | 336 |
| 134 | 3300005354 | Ga0070675_100206932 | Ga0070675_1002069322 | 336 |
| 135 | 3300005365 | Ga0070688_100035417 | Ga0070688_1000354172 | 336 |
| 136 | 3300005434 | Ga0070709_10007255 | Ga0070709_100072552 | 336 |
| 137 | 3300005434 | Ga0070709_10145095 | Ga0070709_101450952 | 336 |
| 138 | 3300005435 | Ga0070714_100006438 | Ga0070714_1000064381 | 336 |
| 139 | 3300005435 | Ga0070714_100145063 | Ga0070714_1001450631 | 336 |
| 140 | 3300005436 | Ga0070713_100002174 | Ga0070713_10000217411 | 336 |
| 141 | 3300005437 | Ga0070710_10001572 | Ga0070710_100015722 | 336 |
| 142 | 3300005437 | Ga0070710_10070553 | Ga0070710_100705531 | 336 |
| 143 | 3300005438 | Ga0070701_10079880 | Ga0070701_100798802 | 336 |
| 144 | 3300005439 | Ga0070711_100014780 | Ga0070711_1000147801 | 336 |
| 145 | 3300005439 | Ga0070711_100120268 | Ga0070711_1001202682 | 336 |
| 146 | 3300005440 | Ga0070705_100065311 | Ga0070705_1000653112 | 336 |
| 147 | 3300005444 | Ga0070694_100115155 | Ga0070694_1001151552 | 336 |
| 148 | 3300005457 | Ga0070662_100200916 | Ga0070662_1002009162 | 336 |
| 149 | 3300005466 | Ga0070685_10003228 | Ga0070685_100032282 | 336 |
| 150 | 3300005466 | Ga0070685_10047451 | Ga0070685_100474512 | 336 |
| 151 | 3300005518 | Ga0070699_100228220 | Ga0070699_1002282202 | 336 |
| 152 | 3300005530 | Ga0070679_100007468 | Ga0070679_1000074689 | 336 |
| 153 | 3300005530 | Ga0070679_100113217 | Ga0070679_1001132172 | 336 |
| 154 | 3300005535 | Ga0070684_100137566 | Ga0070684_1001375662 | 336 |
| 155 | 3300005535 | Ga0070684_100191759 | Ga0070684_1001917592 | 336 |
| 156 | 3300005543 | Ga0070672_100131021 | Ga0070672_1001310212 | 336 |
| 157 | 3300005544 | Ga0070686_100008642 | Ga0070686_1000086423 | 336 |
| 158 | 3300005545 | Ga0070695_100050294 | Ga0070695_1000502942 | 336 |
| 159 | 3300005546 | Ga0070696_100019736 | Ga0070696_1000197363 | 336 |
| 160 | 3300005546 | Ga0070696_100096334 | Ga0070696_1000963342 | 336 |
| 161 | 3300005548 | Ga0070665_100003089 | Ga0070665_1000030894 | 336 |
| 162 | 3300005548 | Ga0070665_100100308 | Ga0070665_1001003083 | 336 |
| 163 | 3300005548 | Ga0070665_100325215 | Ga0070665_1003252152 | 336 |
| 164 | 3300005549 | Ga0070704_100099381 | Ga0070704_1000993812 | 336 |
| 165 | 3300005564 | Ga0070664_100205097 | Ga0070664_1002050971 | 336 |
| 166 | 3300005564 | Ga0070664_100393522 | Ga0070664_1003935222 | 336 |
| 167 | 3300005578 | Ga0068854_100161078 | Ga0068854_1001610781 | 336 |
| 168 | 3300005614 | Ga0068856_100214312 | Ga0068856_1002143122 | 336 |
| 169 | 3300005615 | Ga0070702_100071192 | Ga0070702_1000711922 | 336 |
| 170 | 3300005616 | Ga0068852_100502165 | Ga0068852_1005021652 | 336 |
| 171 | 3300005617 | Ga0068859_100108247 | Ga0068859_1001082472 | 336 |
| 172 | 3300005617 | Ga0068859_100324384 | Ga0068859_1003243841 | 336 |
| 173 | 3300005617 | Ga0068859_100634567 | Ga0068859_1006345671 | 336 |
| 174 | 3300005719 | Ga0068861_100071532 | Ga0068861_1000715322 | 336 |
| 175 | 3300005841 | Ga0068863_100325413 | Ga0068863_1003254131 | 336 |
| 176 | 3300005842 | Ga0068858_100264114 | Ga0068858_1002641142 | 336 |
| 177 | 3300005843 | Ga0068860_100161156 | Ga0068860_1001611562 | 336 |
| 178 | 3300005937 | Ga0081455_10002164 | Ga0081455_1000216410 | 336 |
| 179 | 3300005937 | Ga0081455_10005135 | Ga0081455_100051357 | 336 |
| 180 | 3300005937 | Ga0081455_10075118 | Ga0081455_100751182 | 336 |
| 181 | 3300005983 | Ga0081540_1000003 | Ga0081540_100000372 | 336 |
| 182 | 3300005983 | Ga0081540_1069932 | Ga0081540_10699321 | 336 |
| 183 | 3300005985 | Ga0081539_10006579 | Ga0081539_100065793 | 336 |
| 184 | 3300006028 | Ga0070717_10000145 | Ga0070717_1000014517 | 336 |
| 185 | 3300006038 | Ga0075365_10021005 | Ga0075365_100210053 | 336 |
| 186 | 3300006042 | Ga0075368_10013893 | Ga0075368_100138932 | 336 |
| 187 | 3300006051 | Ga0075364_10036380 | Ga0075364_100363803 | 336 |
| 188 | 3300006163 | Ga0070715_10010667 | Ga0070715_100106674 | 336 |
| 189 | 3300006163 | Ga0070715_10031164 | Ga0070715_100311642 | 336 |
| 190 | 3300006173 | Ga0070716_100001181 | Ga0070716_1000011817 | 336 |
| 191 | 3300006175 | Ga0070712_100049746 | Ga0070712_1000497462 | 336 |
| 192 | 3300006175 | Ga0070712_100181561 | Ga0070712_1001815612 | 336 |
| 193 | 3300006175 | Ga0070712_100365565 | Ga0070712_1003655651 | 336 |
| 194 | 3300006177 | Ga0075362_10048926 | Ga0075362_100489262 | 336 |
| 195 | 3300006177 | Ga0075362_10050768 | Ga0075362_100507682 | 336 |
| 196 | 3300006195 | Ga0075366_10000683 | Ga0075366_1000068324 | 336 |
| 197 | 3300006852 | Ga0075433_10145190 | Ga0075433_101451902 | 336 |
| 198 | 3300006852 | Ga0075433_10178314 | Ga0075433_101783142 | 336 |
| 199 | 3300006871 | Ga0075434_100060274 | Ga0075434_1000602743 | 336 |
| 200 | 3300006881 | Ga0068865_100003336 | Ga0068865_1000033362 | 336 |
| 201 | 3300006881 | Ga0068865_100146513 | Ga0068865_1001465132 | 336 |
| 202 | 3300006931 | Ga0097620_100036260 | Ga0097620_1000362603 | 336 |
| 203 | 3300006931 | Ga0097620_100108258 | Ga0097620_1001082582 | 336 |
| 204 | 3300006931 | Ga0097620_100324375 | Ga0097620_1003243751 | 336 |
| 205 | 3300006931 | Ga0097620_100634561 | Ga0097620_1006345611 | 336 |
| 206 | 3300007076 | Ga0075435_100068074 | Ga0075435_1000680742 | 336 |
| 207 | 3300009011 | Ga0105251_10018941 | Ga0105251_100189414 | 336 |
| 208 | 3300009093 | Ga0105240_10141825 | Ga0105240_101418252 | 336 |
| 209 | 3300009094 | Ga0111539_10611391 | Ga0111539_106113911 | 336 |
| 210 | 3300009098 | Ga0105245_10487115 | Ga0105245_104871152 | 336 |
| 211 | 3300009101 | Ga0105247_10028620 | Ga0105247_100286203 | 336 |
| 212 | 3300009147 | Ga0114129_10032431 | Ga0114129_100324313 | 336 |
| 213 | 3300009148 | Ga0105243_10003342 | Ga0105243_1000334213 | 336 |
| 214 | 3300009177 | Ga0105248_10042172 | Ga0105248_100421723 | 336 |
| 215 | 3300009545 | Ga0105237_10214090 | Ga0105237_102140902 | 336 |
| 216 | 3300009551 | Ga0105238_10024303 | Ga0105238_100243037 | 336 |
| 217 | 3300009553 | Ga0105249_10068005 | Ga0105249_100680052 | 336 |
| 218 | 3300010375 | Ga0105239_10391869 | Ga0105239_103918692 | 336 |
| 219 | 3300011119 | Ga0105246_10017007 | Ga0105246_100170075 | 336 |
| 220 | 3300013100 | Ga0157373_10028445 | Ga0157373_100284451 | 336 |
| 221 | 3300013100 | Ga0157373_10088792 | Ga0157373_100887922 | 336 |
| 222 | 3300013296 | Ga0157374_10185808 | Ga0157374_101858082 | 336 |
| 223 | 3300013306 | Ga0163162_10098682 | Ga0163162_100986825 | 336 |
| 224 | 3300013306 | Ga0163162_10115117 | Ga0163162_101151172 | 336 |
| 225 | 3300013306 | Ga0163162_10254230 | Ga0163162_102542301 | 336 |
| 226 | 3300013307 | Ga0157372_10521485 | Ga0157372_105214852 | 336 |
| 227 | 3300013308 | Ga0157375_10221404 | Ga0157375_102214042 | 336 |
| 228 | 3300014325 | Ga0163163_10008161 | Ga0163163_100081617 | 336 |
| 229 | 3300014325 | Ga0163163_10106583 | Ga0163163_101065833 | 336 |
| 230 | 3300014326 | Ga0157380_10066178 | Ga0157380_100661782 | 336 |
| 231 | 3300014968 | Ga0157379_10160933 | Ga0157379_101609332 | 336 |
| 232 | 3300017792 | Ga0163161_10040937 | Ga0163161_100409371 | 336 |
| 233 | 3300021358 | Ga0213873_10010885 | Ga0213873_100108851 | 336 |
| 234 | 3300021388 | Ga0213875_10064615 | Ga0213875_100646152 | 336 |
| 235 | 3300025261 | Ga0209233_1009777 | Ga0209233_10097771 | 336 |
| 236 | 3300025297 | Ga0209758_1003134 | Ga0209758_100313410 | 336 |
| 237 | 3300025315 | Ga0207697_10008012 | Ga0207697_100080123 | 336 |
| 238 | 3300025885 | Ga0207653_10043937 | Ga0207653_100439372 | 336 |
| 239 | 3300025898 | Ga0207692_10001804 | Ga0207692_100018045 | 336 |
| 240 | 3300025898 | Ga0207692_10054227 | Ga0207692_100542271 | 336 |
| 241 | 3300025899 | Ga0207642_10054229 | Ga0207642_100542291 | 336 |
| 242 | 3300025900 | Ga0207710_10008485 | Ga0207710_100084854 | 336 |
| 243 | 3300025901 | Ga0207688_10095171 | Ga0207688_100951712 | 336 |
| 244 | 3300025903 | Ga0207680_10113217 | Ga0207680_101132172 | 336 |
| 245 | 3300025906 | Ga0207699_10002006 | Ga0207699_100020067 | 336 |
| 246 | 3300025906 | Ga0207699_10035160 | Ga0207699_100351602 | 336 |
| 247 | 3300025906 | Ga0207699_10130381 | Ga0207699_101303811 | 336 |
| 248 | 3300025907 | Ga0207645_10022233 | Ga0207645_100222332 | 336 |
| 249 | 3300025908 | Ga0207643_10065545 | Ga0207643_100655452 | 336 |
| 250 | 3300025915 | Ga0207693_10003437 | Ga0207693_100034378 | 336 |
| 251 | 3300025917 | Ga0207660_10019768 | Ga0207660_100197682 | 336 |
| 252 | 3300025917 | Ga0207660_10130750 | Ga0207660_101307502 | 336 |
| 253 | 3300025917 | Ga0207660_10188228 | Ga0207660_101882281 | 336 |
| 254 | 3300025918 | Ga0207662_10024440 | Ga0207662_100244405 | 336 |
| 255 | 3300025918 | Ga0207662_10107520 | Ga0207662_101075201 | 336 |
| 256 | 3300025919 | Ga0207657_10007133 | Ga0207657_100071334 | 336 |
| 257 | 3300025919 | Ga0207657_10103233 | Ga0207657_101032332 | 336 |
| 258 | 3300025919 | Ga0207657_10145585 | Ga0207657_101455852 | 336 |
| 259 | 3300025919 | Ga0207657_10371787 | Ga0207657_103717871 | 336 |
| 260 | 3300025921 | Ga0207652_10246798 | Ga0207652_102467982 | 336 |
| 261 | 3300025923 | Ga0207681_10244203 | Ga0207681_102442031 | 336 |
| 262 | 3300025924 | Ga0207694_10040801 | Ga0207694_100408014 | 336 |
| 263 | 3300025926 | Ga0207659_10256393 | Ga0207659_102563931 | 336 |
| 264 | 3300025927 | Ga0207687_10016883 | Ga0207687_100168832 | 336 |
| 265 | 3300025928 | Ga0207700_10069876 | Ga0207700_100698762 | 336 |
| 266 | 3300025929 | Ga0207664_10015721 | Ga0207664_100157213 | 336 |
| 267 | 3300025929 | Ga0207664_10062629 | Ga0207664_100626292 | 336 |
| 268 | 3300025931 | Ga0207644_10019223 | Ga0207644_100192234 | 336 |
| 269 | 3300025933 | Ga0207706_10025928 | Ga0207706_100259285 | 336 |
| 270 | 3300025934 | Ga0207686_10019347 | Ga0207686_100193472 | 336 |
| 271 | 3300025935 | Ga0207709_10129708 | Ga0207709_101297081 | 336 |
| 272 | 3300025935 | Ga0207709_10190006 | Ga0207709_101900062 | 336 |
| 273 | 3300025936 | Ga0207670_10247355 | Ga0207670_102473552 | 336 |
| 274 | 3300025936 | Ga0207670_10274744 | Ga0207670_102747441 | 336 |
| 275 | 3300025938 | Ga0207704_10127221 | Ga0207704_101272212 | 336 |
| 276 | 3300025939 | Ga0207665_10000265 | Ga0207665_1000026522 | 336 |
| 277 | 3300025939 | Ga0207665_10181487 | Ga0207665_101814871 | 336 |
| 278 | 3300025940 | Ga0207691_10059624 | Ga0207691_100596244 | 336 |
| 279 | 3300025941 | Ga0207711_10161106 | Ga0207711_101611062 | 336 |
| 280 | 3300025941 | Ga0207711_10445534 | Ga0207711_104455342 | 336 |
| 281 | 3300025942 | Ga0207689_10026799 | Ga0207689_100267994 | 336 |
| 282 | 3300025942 | Ga0207689_10036991 | Ga0207689_100369912 | 336 |
| 283 | 3300025945 | Ga0207679_10192388 | Ga0207679_101923882 | 336 |
| 284 | 3300025961 | Ga0207712_10044316 | Ga0207712_100443162 | 336 |
| 285 | 3300025961 | Ga0207712_10148345 | Ga0207712_101483452 | 336 |
| 286 | 3300025981 | Ga0207640_10379988 | Ga0207640_103799881 | 336 |
| 287 | 3300026023 | Ga0207677_10152986 | Ga0207677_101529862 | 336 |
| 288 | 3300026023 | Ga0207677_10247977 | Ga0207677_102479772 | 336 |
| 289 | 3300026035 | Ga0207703_10203559 | Ga0207703_102035591 | 336 |
| 290 | 3300026041 | Ga0207639_10377092 | Ga0207639_103770921 | 336 |
| 291 | 3300026067 | Ga0207678_10042834 | Ga0207678_100428344 | 336 |
| 292 | 3300026067 | Ga0207678_10204133 | Ga0207678_102041332 | 336 |
| 293 | 3300026088 | Ga0207641_10070957 | Ga0207641_100709572 | 336 |
| 294 | 3300026089 | Ga0207648_10098908 | Ga0207648_100989082 | 336 |
| 295 | 3300026095 | Ga0207676_10124025 | Ga0207676_101240252 | 336 |
| 296 | 3300026116 | Ga0207674_10081040 | Ga0207674_100810402 | 336 |
| 297 | 3300026118 | Ga0207675_100030151 | Ga0207675_1000301512 | 336 |
| 298 | 3300026118 | Ga0207675_100071292 | Ga0207675_1000712923 | 336 |
| 299 | 3300026121 | Ga0207683_10006706 | Ga0207683_100067067 | 336 |
| 300 | 3300026121 | Ga0207683_10027799 | Ga0207683_100277993 | 336 |
| 301 | 3300027907 | Ga0207428_10161743 | Ga0207428_101617433 | 336 |
| 302 | 3300028379 | Ga0268266_10010718 | Ga0268266_100107186 | 336 |
| 303 | 3300028379 | Ga0268266_10012789 | Ga0268266_100127895 | 336 |
| 304 | 3300028380 | Ga0268265_10016767 | Ga0268265_100167674 | 336 |
| 305 | 3300028380 | Ga0268265_10221763 | Ga0268265_102217632 | 336 |
| 306 | 3300028381 | Ga0268264_10220235 | Ga0268264_102202351 | 336 |
| 307 | 3300028556 | Ga0265337_1000250 | Ga0265337_100025019 | 336 |
| 308 | 3300031241 | Ga0265325_10000053 | Ga0265325_1000005376 | 336 |
| 309 | 3300031241 | Ga0265325_10038429 | Ga0265325_100384291 | 336 |
| 310 | 3300031247 | Ga0265340_10014213 | Ga0265340_100142132 | 336 |
| 311 | 3300031249 | Ga0265339_10001034 | Ga0265339_1000103411 | 336 |
| 312 | 3300031250 | Ga0265331_10041003 | Ga0265331_100410031 | 336 |
| 313 | 3300031595 | Ga0265313_10032472 | Ga0265313_100324723 | 336 |
| 314 | 3300031711 | Ga0265314_10002155 | Ga0265314_1000215513 | 336 |
| 315 | 3300031711 | Ga0265314_10008989 | Ga0265314_100089895 | 336 |
| 316 | 3300031712 | Ga0265342_10000954 | Ga0265342_100009548 | 336 |
| 317 | 3300032004 | Ga0307414_10062579 | Ga0307414_100625793 | 336 |
| 318 | 3300035089 | Ga0373944_0005309 | Ga0373944_0005309_886_1902 | 336 |
| 319 | 3300035091 | Ga0373951_0002572 | Ga0373951_0002572_2015_3031 | 336 |
| 320 | 3300035113 | Ga0373936_0022463 | Ga0373936_0022463_975_1988 | 336 |
| 321 | 3300035118 | Ga0373954_0005693 | Ga0373954_0005693_2650_3672 | 336 |
| 322 | 3300035118 | Ga0373954_0013257 | Ga0373954_0013257_2627_3640 | 336 |
| 323 | 3300035170 | Ga0373943_0001738 | Ga0373943_0001738_2531_3547 | 336 |
| 324 | 3300035171 | Ga0373946_0054624 | Ga0373946_0054624_243_1256 | 336 |
| 325 | 3300035172 | Ga0373955_0002538 | Ga0373955_0002538_3290_4303 | 336 |
| 326 | 3300035241 | Ga0373961_0001489 | Ga0373961_0001489_3352_4368 | 336 |
| 327 | 3300035242 | Ga0373962_0006224 | Ga0373962_0006224_1358_2374 | 336 |
| 328 | 3300035242 | Ga0373962_0040725 | Ga0373962_0040725_269_1285 | 336 |
| 329 | 3300035410 | Ga0373924_0005203 | Ga0373924_0005203_2111_3124 | 336 |
| 330 | 3300035410 | Ga0373924_0084262 | Ga0373924_0084262_295_1317 | 336 |
| 331 | 3300035691 | Ga0373931_0009518 | Ga0373931_0009518_1666_2682 | 336 |
| 332 | 3300035692 | Ga0373935_0025423 | Ga0373935_0025423_231_1247 | 336 |
| 333 | 3300035692 | Ga0373935_0058894 | Ga0373935_0058894_358_1380 | 336 |
| 334 | 3300035695 | Ga0373927_0009273 | Ga0373927_0009273_2628_3644 | 336 |
| 335 | 3300035725 | Ga0373947_0007515 | Ga0373947_0007515_578_1594 | 336 |
| 336 | 3300037068 | Ga0373925_0026861 | Ga0373925_0026861_2854_3870 | 336 |
| 337 | 3300037068 | Ga0373925_0153002 | Ga0373925_0153002_265_1278 | 336 |
| 338 | 3300037853 | Ga0436364_0650169 | Ga0436364_0650169_1122_2168 | 336 |
| 339 | 3300039438 | Ga0436360_0654994 | Ga0436360_0654994_2044_3060 | 336 |
| 340 | 3300044658 | Ga0466972_0144708 | Ga0466972_0144708_17_1039 | 336 |
| 341 | 3300044684 | Ga0466966_0106983 | Ga0466966_0106983_50_1069 | 336 |
| 342 | 3300044712 | Ga0453684_0073767 | Ga0453684_0073767_1101_2123 | 336 |
| 343 | 3300044901 | Ga0466960_0106618 | Ga0466960_0106618_188_1210 | 336 |
| 344 | 3300046455 | Ga0495603_0016198 | Ga0495603_0016198_2770_3786 | 336 |
| 345 | 3300046459 | Ga0495629_0000875 | Ga0495629_0000875_12208_13224 | 336 |
| 346 | 3300046460 | Ga0495638_0000001 | Ga0495638_0000001_98203_99222 | 336 |
| 347 | 3300046461 | Ga0495641_0013172 | Ga0495641_0013172_3210_4226 | 336 |
| 348 | 3300046462 | Ga0495651_0011085 | Ga0495651_0011085_5238_6260 | 336 |
| 349 | 3300046472 | Ga0495580_0139365 | Ga0495580_0139365_156_1169 | 336 |
| 350 | 3300046473 | Ga0495582_0002081 | Ga0495582_0002081_936_1952 | 336 |
| 351 | 3300046476 | Ga0495662_0010543 | Ga0495662_0010543_277_1290 | 336 |
| 352 | 3300046511 | Ga0495608_0187345 | Ga0495608_0187345_206_1228 | 336 |
| 353 | 3300046516 | Ga0495628_0180945 | Ga0495628_0180945_397_1419 | 336 |
| 354 | 3300046529 | Ga0495652_0054907 | Ga0495652_0054907_1452_2474 | 336 |
| 355 | 3300046531 | Ga0495665_0009115 | Ga0495665_0009115_838_1851 | 336 |
| 356 | 3300046536 | Ga0495587_0019919 | Ga0495587_0019919_55_1077 | 336 |
| 357 | 3300046557 | Ga0495622_0029702 | Ga0495622_0029702_338_1354 | 336 |
| 358 | 3300046559 | Ga0495667_0003730 | Ga0495667_0003730_8705_9727 | 336 |
| 359 | 3300046675 | Ga0495657_0050996 | Ga0495657_0050996_1641_2663 | 336 |
| 360 | 3300046681 | Ga0495647_0026764 | Ga0495647_0026764_568_1581 | 336 |
| 361 | 3300046681 | Ga0495647_0039151 | Ga0495647_0039151_769_1785 | 336 |
| 362 | 3300046689 | Ga0495613_0025427 | Ga0495613_0025427_3068_4084 | 336 |
| 363 | 3300046694 | Ga0495649_0017234 | Ga0495649_0017234_384_1406 | 336 |
| 364 | 3300046809 | Ga0495600_0121576 | Ga0495600_0121576_619_1635 | 336 |
| 365 | 3300047315 | Ga0495581_0034674 | Ga0495581_0034674_385_1398 | 336 |
| 366 | 3300047317 | Ga0495604_0026274 | Ga0495604_0026274_3382_4395 | 336 |
| 367 | 3300047317 | Ga0495604_0123031 | Ga0495604_0123031_538_1560 | 336 |
| 368 | 3300047321 | Ga0495676_0207563 | Ga0495676_0207563_251_1267 | 336 |
| 369 | 3300047322 | Ga0495680_0003824 | Ga0495680_0003824_7871_8887 | 336 |
| 370 | 3300047322 | Ga0495680_0062166 | Ga0495680_0062166_801_1823 | 336 |
| 371 | 3300047444 | Ga0495675_0083554 | Ga0495675_0083554_160_1173 | 336 |
| 372 | 3300047673 | Ga0495593_0018424 | Ga0495593_0018424_2324_3340 | 336 |
| 373 | 3300048089 | Ga0495614_0062847 | Ga0495614_0062847_181_1197 | 336 |
| 374 | 3300048904 | Ga0496101_0041308 | Ga0496101_0041308_184_1209 | 336 |
| 375 | 3300048904 | Ga0496101_0168376 | Ga0496101_0168376_522_1538 | 336 |
| 376 | 3300048905 | Ga0496102_0110985 | Ga0496102_0110985_762_1778 | 336 |
| 377 | 3300048906 | Ga0496103_0123017 | Ga0496103_0123017_493_1518 | 336 |
| 378 | 3300048908 | Ga0496105_0162266 | Ga0496105_0162266_97_1113 | 336 |
| 379 | 3300048911 | Ga0496108_0111538 | Ga0496108_0111538_1191_2207 | 336 |
| 380 | 3300048911 | Ga0496108_0221945 | Ga0496108_0221945_399_1415 | 336 |
| 381 | 3300048912 | Ga0496109_0035838 | Ga0496109_0035838_184_1200 | 336 |
| 382 | 3300048912 | Ga0496109_0044564 | Ga0496109_0044564_1955_2971 | 336 |
| 383 | 3300048913 | Ga0496110_0107336 | Ga0496110_0107336_743_1759 | 336 |
| 384 | 3300048913 | Ga0496110_0140359 | Ga0496110_0140359_133_1158 | 336 |
| 385 | 3300048913 | Ga0496110_0148898 | Ga0496110_0148898_133_1149 | 336 |
| 386 | 3300048914 | Ga0496111_0032388 | Ga0496111_0032388_1672_2688 | 336 |
| 387 | 3300048915 | Ga0496112_0049919 | Ga0496112_0049919_2879_3895 | 336 |
| 388 | 3300048915 | Ga0496112_0051378 | Ga0496112_0051378_2050_3075 | 336 |
| 389 | 3300048916 | Ga0496113_0016647 | Ga0496113_0016647_1062_2078 | 336 |
| 390 | 3300048916 | Ga0496113_0017879 | Ga0496113_0017879_2877_3893 | 336 |
| 391 | 3300048916 | Ga0496113_0053175 | Ga0496113_0053175_1046_2071 | 336 |
| 392 | 3300048916 | Ga0496113_0158842 | Ga0496113_0158842_44_1060 | 336 |
| 393 | 3300048917 | Ga0496114_0010689 | Ga0496114_0010689_4061_5086 | 336 |
| 394 | 3300048918 | Ga0496115_0119726 | Ga0496115_0119726_1129_2145 | 336 |
| 395 | 3300048918 | Ga0496115_0126245 | Ga0496115_0126245_184_1209 | 336 |
| 396 | 3300048918 | Ga0496115_0359122 | Ga0496115_0359122_92_1108 | 336 |
| 397 | 3300049571 | Ga0501034_0050543 | Ga0501034_0050543_1467_2486 | 336 |
| 398 | 3300049571 | Ga0501034_0166923 | Ga0501034_0166923_405_1424 | 336 |
| 399 | 3300049581 | Ga0501047_0310083 | Ga0501047_0310083_198_1307 | 336 |
| 400 | 3300049583 | Ga0501067_0024052 | Ga0501067_0024052_1408_2427 | 336 |
| 401 | 3300049586 | Ga0501070_0338977 | Ga0501070_0338977_146_1165 | 336 |
| 402 | 3300049590 | Ga0501074_0206742 | Ga0501074_0206742_160_1179 | 336 |
| 403 | 3300049670 | Ga0501236_002505 | Ga0501236_002505_832_1857 | 336 |
| 404 | 3300049823 | Ga0501044_0001046 | Ga0501044_0001046_7939_8958 | 336 |
| 405 | 3300050489 | nmdc:mga03683_25880_c1 | nmdc:mga03683_25880_c1_575_1588 | 336 |
| 406 | 3300050489 | nmdc:mga03683_39931_c1 | nmdc:mga03683_39931_c1_564_1583 | 336 |
| 407 | 3300050493 | nmdc:mga0k408_14171_c1 | nmdc:mga0k408_14171_c1_3036_4049 | 336 |
| 408 | 3300050493 | nmdc:mga0k408_17808_c1 | nmdc:mga0k408_17808_c1_626_1651 | 336 |
| 409 | 3300050494 | nmdc:mga06z11_39561_c1 | nmdc:mga06z11_39561_c1_524_1549 | 336 |
| 410 | 3300050495 | nmdc:mga04h51_5977_c1 | nmdc:mga04h51_5977_c1_716_1729 | 336 |
| 411 | 3300050496 | nmdc:mga07m45_31280_c1 | nmdc:mga07m45_31280_c1_1301_2317 | 336 |
| 412 | 3300050496 | nmdc:mga07m45_31947_c1 | nmdc:mga07m45_31947_c1_1348_2361 | 336 |
| 413 | 3300050507 | nmdc:mga05p37_21969_c1 | nmdc:mga05p37_21969_c1_2379_3416 | 336 |
| 414 | 3300050511 | nmdc:mga08y16_26137_c1 | nmdc:mga08y16_26137_c1_2318_3349 | 336 |
| 415 | 3300050512 | nmdc:mga0n895_7805_c1 | nmdc:mga0n895_7805_c1_2538_3575 | 336 |
| 416 | 3300050513 | nmdc:mga0rr50_63076_c1 | nmdc:mga0rr50_63076_c1_522_1538 | 336 |
| 417 | 3300050513 | nmdc:mga0rr50_73140_c1 | nmdc:mga0rr50_73140_c1_88_1125 | 336 |
| 418 | 3300050515 | nmdc:mga0a205_24887_c1 | nmdc:mga0a205_24887_c1_1056_2093 | 336 |
| 419 | 3300050515 | nmdc:mga0a205_64992_c1 | nmdc:mga0a205_64992_c1_1555_2577 | 336 |
| 420 | 3300053078 | Ga0495612_0008457 | Ga0495612_0008457_2354_3376 | 336 |
| 421 | 3300053084 | Ga0495595_0036015 | Ga0495595_0036015_340_1359 | 336 |
| 422 | 3300053085 | Ga0495619_0043925 | Ga0495619_0043925_329_1345 | 336 |
| 423 | 3300053085 | Ga0495619_0208993 | Ga0495619_0208993_150_1166 | 336 |
| 424 | 3300053087 | Ga0500643_004385 | Ga0500643_004385_624_1643 | 336 |
| 425 | 3300053088 | Ga0500644_0000369 | Ga0500644_0000369_1413_2432 | 336 |
| 426 | 3300053094 | Ga0500566_0012802 | Ga0500566_0012802_2369_3388 | 336 |
| 427 | 3300053096 | Ga0500641_0033274 | Ga0500641_0033274_191_1210 | 336 |
| 428 | 3300053119 | Ga0500595_000029 | Ga0500595_000029_84340_85359 | 336 |
| 429 | 3300053153 | Ga0500616_0000009 | Ga0500616_0000009_632592_633611 | 336 |
| 430 | 3300053155 | Ga0500620_028566 | Ga0500620_028566_387_1400 | 336 |
| 431 | 3300053158 | Ga0500627_0026978 | Ga0500627_0026978_517_1530 | 336 |
| 432 | 3300053163 | Ga0500639_040115 | Ga0500639_040115_843_1859 | 336 |
| 433 | 3300053730 | Ga0500645_000143 | Ga0500645_000143_11256_12275 | 336 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u4q-assembly1.cif.gz_B | 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. | 0.9643 | 2 | 336 |
| 5u4q-assembly1.cif.gz_B | 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. | 0.9612 | 2 | 336 |
| 5u4q-assembly1.cif.gz_A | 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. | 0.9603 | 2 | 335 |
| 5u4q-assembly1.cif.gz_A | 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. | 0.9516 | 2 | 335 |
| 6zla-assembly2.cif.gz_D-2 | crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad | 0.9233 | 4 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5u4qA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9499 | 4 | 335 | 3.40.50.720 |
| 3zdnC01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.947 | 4 | 34 | 3.50.50.60 |
| 5u4qA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9379 | 4 | 335 | 3.40.50.720 |
| af_O65936_46_234_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9219 | 3 | 34 | 3.50.50.60 |
| af_O65404_36_399_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9214 | 3 | 34 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529I3D6-F1-model_v4 | deleted | 0.9891 | 180 | 335 |
|
| AF-A0A523M0X6-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9863 | 4 | 129 |
|
| AF-A0A2E1M331-F1-model_v4 | Capsular biosynthesis protein CpsI | 0.984 | 4 | 335 |
|
| AF-B9TG48-F1-model_v4 | UDP-glucuronate 5-epimerase, putative (EC 5.1.3.12) | 0.9836 | 193 | 335 |
GO:0016853
|
| AF-A0A3C0Q6Z7-F1-model_v4 | Capsular biosynthesis protein CpsI | 0.9825 | 164 | 335 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar