F442819

General Info

Members Datasets Scaffolds Average Seq Length
433 187 433 287

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10094322|Ga0105240_100943223
Length 319
Sequence MPISICRANTGKAGIPKKFKNKPLNQKIFVMKKINRREFLEKSTLGLSSALILAQLPKQLFASAHAAGMPVGFQSWSVKDLLGKDLAGTLKMMYGLGYTQIEMCSPKGYADIGFGPMAKMKTSDLRQTIADAGLGCISCHFGFGELGDDKIDESIEFAKEMGLTQMICSTFWLPKTATLSDYQASADKLNQAATKIMKAGMQTGFHNHEFEFATLDGRLIYDALMERFDPELVKMQFQTEVINLGYKAADYFKKYPGRFISSHLSDWTADKKEVPIGQGIIDWKEFFTTAKTGGVKNIFVEMSLNNLKDSAANIHRMRV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
179 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
180 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 1.39
Rhizosphere 95.84
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007616 3300003203 Bacteria 4929
2 rootH1_10095750 3300003316 Bacteria 6476
3 rootH2_10001391 3300003320 Bacteria 106251
4 rootH2_10151089 3300003320 Bacteria 3192
5 Ga0055531_10000189 3300003794 Bacteria 68668
6 Ga0065712_10070468 3300005290 Bacteria 5956
7 Ga0065712_10108820 3300005290 Unclassified 1848
8 Ga0065712_10138725 3300005290 Bacteria 1471
9 Ga0065715_10023940 3300005293 Bacteria 2519
10 Ga0070676_10000913 3300005328 Bacteria 14630
11 Ga0070676_10002017 3300005328 Bacteria 10323
12 Ga0070676_10036984 3300005328 Bacteria 2813
13 Ga0070683_100002301 3300005329 Bacteria 15144
14 Ga0070683_100009988 3300005329 Bacteria 8139
15 Ga0070683_100322516 3300005329 Bacteria 1470
16 Ga0070683_100495540 3300005329 Unclassified 1167
17 Ga0070690_100035142 3300005330 Bacteria 3144
18 Ga0070670_100073438 3300005331 Bacteria 2938
19 Ga0070677_10013671 3300005333 Bacteria 2843
20 Ga0068869_100004876 3300005334 Bacteria 8392
21 Ga0068869_100015501 3300005334 Bacteria 5115
22 Ga0068869_100021412 3300005334 Bacteria 4448
23 Ga0068869_100033803 3300005334 Bacteria 3612
24 Ga0068869_100094660 3300005334 Bacteria 2252
25 Ga0068869_100253902 3300005334 Bacteria 1405
26 Ga0070666_10008712 3300005335 Bacteria 6308
27 Ga0070666_10042028 3300005335 Bacteria 3056
28 Ga0070666_10047776 3300005335 Bacteria 2874
29 Ga0070666_10107664 3300005335 Unclassified 1926
30 Ga0070666_10111130 3300005335 Bacteria 1895
31 Ga0068868_100013665 3300005338 Bacteria 5962
32 Ga0068868_100018809 3300005338 Bacteria 5169
33 Ga0068868_100046412 3300005338 Bacteria 3400
34 Ga0068868_100405850 3300005338 Bacteria 1177
35 Ga0068868_100502985 3300005338 Bacteria 1062
36 Ga0070660_100187221 3300005339 Unclassified 1676
37 Ga0070689_100004927 3300005340 Bacteria 9060
38 Ga0070689_100142054 3300005340 Bacteria 1931
39 Ga0070689_100312121 3300005340 Bacteria 1311
40 Ga0070687_100122026 3300005343 Bacteria 1492
41 Ga0070661_100033693 3300005344 Bacteria 3711
42 Ga0070661_100058106 3300005344 Bacteria 2834
43 Ga0070668_100003528 3300005347 Bacteria 11535
44 Ga0070668_100024075 3300005347 Unclassified 4611
45 Ga0070668_100151380 3300005347 Bacteria 1876
46 Ga0070668_100155139 3300005347 Bacteria 1854
47 Ga0070669_100008252 3300005353 Bacteria 7437
48 Ga0070669_100034114 3300005353 Unclassified 3684
49 Ga0070669_100430102 3300005353 Bacteria 1085
50 Ga0070675_100007506 3300005354 Bacteria 8429
51 Ga0070675_100032672 3300005354 Bacteria 4213
52 Ga0070675_100481881 3300005354 Bacteria 1116
53 Ga0070674_100023486 3300005356 Bacteria 3992
54 Ga0070674_100349248 3300005356 Bacteria 1194
55 Ga0070673_100001315 3300005364 Bacteria 14488
56 Ga0070673_100005564 3300005364 Bacteria 8079
57 Ga0070673_100014386 3300005364 Bacteria 5508
58 Ga0070673_100018321 3300005364 Bacteria 4998
59 Ga0070688_100021866 3300005365 Bacteria 3741
60 Ga0070659_100272112 3300005366 Unclassified 1408
61 Ga0070667_100015427 3300005367 Bacteria 6317
62 Ga0070667_100028944 3300005367 Bacteria 4613
63 Ga0070667_100044195 3300005367 Unclassified 3740
64 Ga0070667_100140211 3300005367 Bacteria 2117
65 Ga0070700_100342121 3300005441 Bacteria 1106
66 Ga0070663_100132010 3300005455 Bacteria 1897
67 Ga0070678_100026557 3300005456 Bacteria 3917
68 Ga0070678_100157014 3300005456 Bacteria 1839
69 Ga0070662_100008946 3300005457 Bacteria 6528
70 Ga0070662_100076741 3300005457 Bacteria 2477
71 Ga0068867_100096023 3300005459 Bacteria 2256
72 Ga0068867_100119134 3300005459 Bacteria 2038
73 Ga0068867_100200662 3300005459 Bacteria 1597
74 Ga0068867_100302821 3300005459 Bacteria 1318
75 Ga0070685_10158969 3300005466 Bacteria 1438
76 Ga0070698_100023552 3300005471 Bacteria 6436
77 Ga0070679_100122338 3300005530 Bacteria 2586
78 Ga0070679_100227256 3300005530 Unclassified 1826
79 Ga0070684_100000880 3300005535 Bacteria 21214
80 Ga0070684_100004343 3300005535 Bacteria 10776
81 Ga0070684_100006484 3300005535 Bacteria 9061
82 Ga0070684_100037971 3300005535 Bacteria 4135
83 Ga0068853_100000817 3300005539 Bacteria 21716
84 Ga0068853_100010124 3300005539 Bacteria 7619
85 Ga0068853_100125060 3300005539 Unclassified 2297
86 Ga0068853_100281130 3300005539 Bacteria 1534
87 Ga0068853_100331598 3300005539 Bacteria 1412
88 Ga0070672_100004032 3300005543 Bacteria 9580
89 Ga0070672_100069526 3300005543 Bacteria 2796
90 Ga0070672_100089731 3300005543 Bacteria 2477
91 Ga0070672_100244197 3300005543 Bacteria 1511
92 Ga0070686_100012910 3300005544 Unclassified 4770
93 Ga0070686_100243061 3300005544 Bacteria 1311
94 Ga0070665_100000008 3300005548 Bacteria 606341
95 Ga0068855_100020595 3300005563 Bacteria 7909
96 Ga0068855_100032915 3300005563 Bacteria 6189
97 Ga0068855_100061550 3300005563 Bacteria 4385
98 Ga0068855_100190374 3300005563 Bacteria 2314
99 Ga0070664_100004175 3300005564 Bacteria 11608
100 Ga0070664_100026056 3300005564 Bacteria 4848
101 Ga0070664_100035332 3300005564 Bacteria 4195
102 Ga0070664_100064579 3300005564 Bacteria 3122
103 Ga0070664_100073235 3300005564 Unclassified 2939
104 Ga0070664_100598004 3300005564 Bacteria 1023
105 Ga0068857_100004008 3300005577 Bacteria 12408
106 Ga0068857_100049908 3300005577 Bacteria 3712
107 Ga0068854_100047635 3300005578 Bacteria 3056
108 Ga0068856_100112035 3300005614 Bacteria 2726
109 Ga0068856_100375713 3300005614 Bacteria 1440
110 Ga0070702_100255977 3300005615 Bacteria 1189
111 Ga0068852_100031682 3300005616 Bacteria 4368
112 Ga0068852_100078838 3300005616 Bacteria 2915
113 Ga0068852_100171184 3300005616 Bacteria 2036
114 Ga0068852_100177912 3300005616 Bacteria 1998
115 Ga0068852_100208131 3300005616 Bacteria 1854
116 Ga0068852_100275871 3300005616 Bacteria 1619
117 Ga0068859_100002868 3300005617 Bacteria 17494
118 Ga0068859_100019364 3300005617 Bacteria 6838
119 Ga0068859_100119681 3300005617 Bacteria 2700
120 Ga0068864_100009774 3300005618 Bacteria 7908
121 Ga0068864_100010076 3300005618 Bacteria 7804
122 Ga0068864_100342186 3300005618 Bacteria 1410
123 Ga0068864_100502589 3300005618 Bacteria 1167
124 Ga0068861_100025664 3300005719 Bacteria 4276
125 Ga0068861_100092583 3300005719 Bacteria 2388
126 Ga0068870_10027123 3300005840 Bacteria 2862
127 Ga0068863_100001100 3300005841 Bacteria 27016
128 Ga0068858_100024544 3300005842 Bacteria 5617
129 Ga0068858_100055322 3300005842 Unclassified 3668
130 Ga0068860_100000029 3300005843 Bacteria 259192
131 Ga0068860_100004875 3300005843 Bacteria 13674
132 Ga0068860_100005348 3300005843 Bacteria 13028
133 Ga0068860_100009522 3300005843 Bacteria 9647
134 Ga0068860_100125541 3300005843 Bacteria 2459
135 Ga0068862_100024380 3300005844 Bacteria 5075
136 Ga0068862_100053877 3300005844 Bacteria 3444
137 Ga0068862_100216146 3300005844 Bacteria 1734
138 Ga0068862_100298006 3300005844 Bacteria 1483
139 Ga0081540_1026505 3300005983 Unclassified 3306
140 Ga0081539_10001124 3300005985 Bacteria 48512
141 Ga0097621_100000786 3300006237 Bacteria 22290
142 Ga0097621_100035174 3300006237 Bacteria 4001
143 Ga0097621_100057858 3300006237 Bacteria 3172
144 Ga0068871_100000405 3300006358 Bacteria 29750
145 Ga0068871_100009679 3300006358 Bacteria 6997
146 Ga0068871_100176727 3300006358 Bacteria 1833
147 Ga0068871_100211232 3300006358 Bacteria 1678
148 Ga0075428_100491722 3300006844 Bacteria 1313
149 Ga0068865_100014358 3300006881 Bacteria 5032
150 Ga0068865_100064929 3300006881 Bacteria 2570
151 Ga0068865_100129543 3300006881 Bacteria 1888
152 Ga0068865_100185894 3300006881 Bacteria 1603
153 Ga0068865_100205895 3300006881 Bacteria 1530
154 Ga0097620_100002868 3300006931 Bacteria 17494
155 Ga0097620_100019362 3300006931 Bacteria 6838
156 Ga0097620_100119683 3300006931 Bacteria 2700
157 Ga0105240_10000086 3300009093 Bacteria 188623
158 Ga0105240_10000105 3300009093 Bacteria 172035
159 Ga0105240_10006701 3300009093 Bacteria 16874
160 Ga0105240_10094322 3300009093 Bacteria 3651
161 Ga0105240_10097728 3300009093 Bacteria 3577
162 Ga0105240_10204173 3300009093 Bacteria 2314
163 Ga0111539_10098353 3300009094 Bacteria 3437
164 Ga0105245_10156346 3300009098 Bacteria 2160
165 Ga0105245_10170123 3300009098 Unclassified 2074
166 Ga0105247_10050633 3300009101 Bacteria 2556
167 Ga0105243_10132120 3300009148 Bacteria 2119
168 Ga0105241_10101749 3300009174 Unclassified 2285
169 Ga0105241_10208145 3300009174 Bacteria 1638
170 Ga0105241_10303812 3300009174 Bacteria 1370
171 Ga0105242_10256199 3300009176 Bacteria 1579
172 Ga0105248_10038217 3300009177 Bacteria 5372
173 Ga0105248_10163779 3300009177 Bacteria 2507
174 Ga0105248_10418313 3300009177 Unclassified 1509
175 Ga0105237_10000171 3300009545 Bacteria 90778
176 Ga0105237_10063421 3300009545 Unclassified 3692
177 Ga0105237_10137558 3300009545 Bacteria 2437
178 Ga0105238_10060040 3300009551 Bacteria 3808
179 Ga0105238_10416884 3300009551 Unclassified 1337
180 Ga0105249_10006720 3300009553 Bacteria 10016
181 Ga0105249_10009251 3300009553 Bacteria 8614
182 Ga0105249_10108250 3300009553 Unclassified 2624
183 Ga0105249_10181524 3300009553 Unclassified 2048
184 Ga0105249_10211766 3300009553 Bacteria 1902
185 Ga0105249_10273930 3300009553 Bacteria 1682
186 Ga0105249_10785059 3300009553 Unclassified 1016
187 Ga0105239_10000079 3300010375 Bacteria 135513
188 Ga0105239_10000215 3300010375 Bacteria 85485
189 Ga0105239_10000609 3300010375 Bacteria 50949
190 Ga0105239_10065430 3300010375 Bacteria 3992
191 Ga0105239_10076633 3300010375 Bacteria 3678
192 Ga0105239_10088630 3300010375 Unclassified 3412
193 Ga0105239_10444029 3300010375 Bacteria 1471
194 Ga0105246_10005947 3300011119 Bacteria 7449
195 Ga0105246_10381949 3300011119 Bacteria 1164
196 Ga0105246_10436839 3300011119 Bacteria 1096
197 Ga0157373_10000937 3300013100 Bacteria 22550
198 Ga0157373_10034089 3300013100 Unclassified 3657
199 Ga0157373_10165400 3300013100 Bacteria 1557
200 Ga0157371_10000232 3300013102 Bacteria 79717
201 Ga0157371_10004436 3300013102 Bacteria 12248
202 Ga0157371_10012377 3300013102 Bacteria 6523
203 Ga0157371_10016697 3300013102 Bacteria 5470
204 Ga0157371_10037364 3300013102 Bacteria 3475
205 Ga0157371_10188229 3300013102 Unclassified 1477
206 Ga0157370_10001280 3300013104 Bacteria 31419
207 Ga0157370_10012211 3300013104 Bacteria 8927
208 Ga0157370_10015484 3300013104 Bacteria 7752
209 Ga0157369_10034478 3300013105 Bacteria 5554
210 Ga0157374_10000003 3300013296 Bacteria 854471
211 Ga0157374_10015501 3300013296 Bacteria 6686
212 Ga0157374_10044834 3300013296 Bacteria 4089
213 Ga0157374_10176787 3300013296 Bacteria 2083
214 Ga0157378_10021791 3300013297 Bacteria 5634
215 Ga0157378_10305329 3300013297 Bacteria 1541
216 Ga0157378_10322748 3300013297 Bacteria 1500
217 Ga0157378_10680232 3300013297 Bacteria 1047
218 Ga0163162_10000038 3300013306 Bacteria 138065
219 Ga0163162_10000233 3300013306 Bacteria 50817
220 Ga0163162_10002581 3300013306 Bacteria 17146
221 Ga0163162_10008550 3300013306 Bacteria 9980
222 Ga0163162_10010923 3300013306 Bacteria 8839
223 Ga0163162_10028347 3300013306 Bacteria 5540
224 Ga0163162_10044809 3300013306 Bacteria 4431
225 Ga0163162_10058223 3300013306 Bacteria 3893
226 Ga0163162_10092643 3300013306 Unclassified 3106
227 Ga0163162_10244501 3300013306 Bacteria 1926
228 Ga0157372_10006839 3300013307 Bacteria 12130
229 Ga0157372_10013748 3300013307 Bacteria 8650
230 Ga0157372_10054571 3300013307 Bacteria 4458
231 Ga0157372_10123694 3300013307 Unclassified 2974
232 Ga0157372_10415719 3300013307 Bacteria 1567
233 Ga0157372_10860744 3300013307 Bacteria 1052
234 Ga0157375_10001343 3300013308 Bacteria 21198
235 Ga0157375_10007158 3300013308 Bacteria 9754
236 Ga0157375_10016804 3300013308 Bacteria 6587
237 Ga0157375_10348765 3300013308 Bacteria 1646
238 Ga0163163_10000781 3300014325 Bacteria 26993
239 Ga0163163_10030450 3300014325 Bacteria 5200
240 Ga0163163_10240785 3300014325 Bacteria 1859
241 Ga0163163_10531350 3300014325 Bacteria 1238
242 Ga0157380_10031172 3300014326 Bacteria 4091
243 Ga0157377_10008768 3300014745 Bacteria 4944
244 Ga0157377_10009101 3300014745 Bacteria 4864
245 Ga0157379_10024305 3300014968 Bacteria 5380
246 Ga0157376_10022690 3300014969 Bacteria 4898
247 Ga0157376_10025307 3300014969 Bacteria 4673
248 Ga0157376_10048405 3300014969 Bacteria 3515
249 Ga0157376_10066368 3300014969 Unclassified 3050
250 Ga0157376_10113088 3300014969 Bacteria 2393
251 Ga0157376_10261705 3300014969 Unclassified 1621
252 Ga0163161_10000711 3300017792 Bacteria 26325
253 Ga0163161_10002390 3300017792 Bacteria 13449
254 Ga0163161_10030544 3300017792 Bacteria 3836
255 Ga0163161_10175775 3300017792 Bacteria 1639
256 Ga0213876_10007023 3300021384 Bacteria 6137
257 Ga0209257_1000005 3300025304 Bacteria 1592528
258 Ga0207682_10037898 3300025893 Bacteria 1954
259 Ga0207688_10003753 3300025901 Bacteria 8292
260 Ga0207688_10043737 3300025901 Bacteria 2494
261 Ga0207680_10010331 3300025903 Bacteria 4667
262 Ga0207680_10010471 3300025903 Bacteria 4639
263 Ga0207680_10096096 3300025903 Bacteria 1895
264 Ga0207680_10097636 3300025903 Bacteria 1881
265 Ga0207680_10113662 3300025903 Bacteria 1760
266 Ga0207647_10026002 3300025904 Unclassified 3835
267 Ga0207645_10000240 3300025907 Bacteria 45336
268 Ga0207645_10001621 3300025907 Bacteria 18359
269 Ga0207645_10004698 3300025907 Bacteria 10047
270 Ga0207645_10013306 3300025907 Bacteria 5551
271 Ga0207645_10241327 3300025907 Bacteria 1194
272 Ga0207643_10016513 3300025908 Bacteria 4028
273 Ga0207705_10085073 3300025909 Bacteria 2310
274 Ga0207654_10067381 3300025911 Unclassified 2114
275 Ga0207695_10000089 3300025913 Bacteria 273463
276 Ga0207695_10000175 3300025913 Bacteria 188658
277 Ga0207695_10000193 3300025913 Bacteria 172070
278 Ga0207695_10017906 3300025913 Bacteria 8206
279 Ga0207695_10057468 3300025913 Bacteria 4041
280 Ga0207695_10086377 3300025913 Bacteria 3164
281 Ga0207695_10246167 3300025913 Bacteria 1688
282 Ga0207671_10001757 3300025914 Bacteria 24379
283 Ga0207660_10140356 3300025917 Unclassified 1847
284 Ga0207662_10030482 3300025918 Bacteria 3130
285 Ga0207662_10132742 3300025918 Bacteria 1571
286 Ga0207657_10275765 3300025919 Bacteria 1336
287 Ga0207657_10313354 3300025919 Unclassified 1242
288 Ga0207649_10004807 3300025920 Bacteria 7302
289 Ga0207649_10009170 3300025920 Bacteria 5411
290 Ga0207652_10337493 3300025921 Bacteria 1360
291 Ga0207681_10030910 3300025923 Bacteria 3495
292 Ga0207681_10446570 3300025923 Bacteria 1051
293 Ga0207694_10070802 3300025924 Unclassified 2725
294 Ga0207694_10183629 3300025924 Bacteria 1697
295 Ga0207650_10109870 3300025925 Bacteria 2133
296 Ga0207650_10157423 3300025925 Bacteria 1797
297 Ga0207659_10049314 3300025926 Bacteria 2986
298 Ga0207659_10051444 3300025926 Bacteria 2930
299 Ga0207659_10073625 3300025926 Bacteria 2501
300 Ga0207690_10082944 3300025932 Unclassified 2243
301 Ga0207706_10015177 3300025933 Bacteria 6970
302 Ga0207706_10034009 3300025933 Bacteria 4536
303 Ga0207706_10049179 3300025933 Bacteria 3727
304 Ga0207706_10107596 3300025933 Bacteria 2454
305 Ga0207686_10448421 3300025934 Bacteria 992
306 Ga0207670_10102627 3300025936 Bacteria 2045
307 Ga0207670_10168862 3300025936 Bacteria 1639
308 Ga0207670_10195932 3300025936 Bacteria 1532
309 Ga0207704_10014891 3300025938 Bacteria 3945
310 Ga0207704_10017162 3300025938 Bacteria 3744
311 Ga0207704_10216802 3300025938 Bacteria 1413
312 Ga0207691_10000285 3300025940 Bacteria 49947
313 Ga0207691_10019162 3300025940 Bacteria 6478
314 Ga0207691_10029679 3300025940 Bacteria 5114
315 Ga0207711_10062526 3300025941 Bacteria 3211
316 Ga0207711_10375412 3300025941 Bacteria 1319
317 Ga0207689_10001932 3300025942 Bacteria 19612
318 Ga0207689_10005070 3300025942 Bacteria 11867
319 Ga0207689_10005499 3300025942 Bacteria 11332
320 Ga0207689_10033653 3300025942 Bacteria 4257
321 Ga0207661_10004770 3300025944 Bacteria 9492
322 Ga0207661_10008894 3300025944 Bacteria 7189
323 Ga0207661_10164369 3300025944 Unclassified 1927
324 Ga0207661_10458303 3300025944 Bacteria 1162
325 Ga0207679_10000611 3300025945 Bacteria 23793
326 Ga0207679_10006318 3300025945 Bacteria 7482
327 Ga0207679_10014670 3300025945 Bacteria 5158
328 Ga0207679_10046999 3300025945 Unclassified 3133
329 Ga0207679_10355409 3300025945 Bacteria 1278
330 Ga0207667_10000211 3300025949 Bacteria 82245
331 Ga0207667_10027574 3300025949 Bacteria 6180
332 Ga0207667_10364856 3300025949 Unclassified 1473
333 Ga0207667_10498535 3300025949 Unclassified 1235
334 Ga0207651_10007698 3300025960 Bacteria 5756
335 Ga0207651_10127300 3300025960 Bacteria 1943
336 Ga0207712_10030211 3300025961 Bacteria 3641
337 Ga0207712_10477368 3300025961 Bacteria 1062
338 Ga0207668_10005422 3300025972 Bacteria 7505
339 Ga0207668_10137902 3300025972 Bacteria 1872
340 Ga0207640_10029316 3300025981 Bacteria 3377
341 Ga0207640_10058885 3300025981 Bacteria 2532
342 Ga0207658_10267941 3300025986 Bacteria 1458
343 Ga0207677_10021467 3300026023 Bacteria 3946
344 Ga0207677_10032347 3300026023 Bacteria 3362
345 Ga0207677_10168332 3300026023 Bacteria 1710
346 Ga0207703_10016400 3300026035 Bacteria 5775
347 Ga0207703_10050119 3300026035 Bacteria 3378
348 Ga0207639_10004093 3300026041 Bacteria 9833
349 Ga0207639_10052504 3300026041 Bacteria 3107
350 Ga0207639_10064828 3300026041 Unclassified 2833
351 Ga0207639_10239932 3300026041 Bacteria 1575
352 Ga0207639_10402768 3300026041 Bacteria 1233
353 Ga0207678_10046685 3300026067 Unclassified 3745
354 Ga0207702_10110922 3300026078 Bacteria 2439
355 Ga0207641_10154275 3300026088 Bacteria 2082
356 Ga0207648_10012456 3300026089 Bacteria 7962
357 Ga0207648_10017086 3300026089 Bacteria 6613
358 Ga0207648_10061369 3300026089 Bacteria 3278
359 Ga0207648_10077588 3300026089 Unclassified 2896
360 Ga0207648_10095363 3300026089 Bacteria 2602
361 Ga0207648_10172099 3300026089 Bacteria 1915
362 Ga0207648_10231605 3300026089 Bacteria 1643
363 Ga0207676_10003921 3300026095 Bacteria 10504
364 Ga0207674_10007811 3300026116 Bacteria 12434
365 Ga0207674_10133423 3300026116 Bacteria 2446
366 Ga0207675_100016538 3300026118 Bacteria 6888
367 Ga0207675_100253955 3300026118 Bacteria 1702
368 Ga0207683_10002445 3300026121 Bacteria 16201
369 Ga0207683_10053566 3300026121 Bacteria 3538
370 Ga0207698_10051385 3300026142 Bacteria 3151
371 Ga0207698_10242214 3300026142 Bacteria 1644
372 Ga0207698_10559002 3300026142 Bacteria 1123
373 Ga0207428_10281987 3300027907 Bacteria 1233
374 Ga0268266_10000016 3300028379 Bacteria 629101
375 Ga0268266_10003148 3300028379 Bacteria 16758
376 Ga0268266_10032414 3300028379 Bacteria 4440
377 Ga0268266_10187579 3300028379 Unclassified 1887
378 Ga0268265_10047518 3300028380 Bacteria 3216
379 Ga0268265_10219757 3300028380 Bacteria 1662
380 Ga0268264_10000072 3300028381 Bacteria 260791
381 Ga0268264_10004183 3300028381 Bacteria 12328
382 Ga0268264_10063161 3300028381 Bacteria 3112
383 Ga0268264_10232242 3300028381 Bacteria 1704
384 Ga0268264_10662094 3300028381 Bacteria 1034
385 Ga0307509_10253544 3300031507 Bacteria 1541
386 Ga0373923_0122343 3300035111 Bacteria 1164
387 Ga0373943_0182278 3300035170 Bacteria 1155
388 Ga0373955_0042495 3300035172 Bacteria 2441
389 Ga0373924_0061994 3300035410 Bacteria 1566
390 Ga0373935_0143674 3300035692 Bacteria 1614
391 Ga0373947_0307341 3300035725 Bacteria 1058
392 Ga0373937_0044919 3300036401 Bacteria 4036
393 Ga0373937_0264714 3300036401 Bacteria 1622
394 Ga0395899_0155615 3300037312 Unclassified 1617
395 Ga0395900_0075315 3300037418 Bacteria 3469
396 Ga0395900_0275301 3300037418 Unclassified 1677
397 Ga0395901_0011741 3300038443 Bacteria 8879
398 Ga0436365_0473715 3300039437 Bacteria 54513
399 Ga0451800_0540795 3300041459 Bacteria 1272
400 Ga0466969_0000696 3300044656 Bacteria 18235
401 Ga0453683_0208255 3300044673 Unclassified 1242
402 Ga0466966_0018657 3300044684 Bacteria 4571
403 Ga0466968_0122610 3300044735 Bacteria 1177
404 Ga0466959_0000029 3300045049 Bacteria 112104
405 Ga0495592_0061772 3300046454 Bacteria 2753
406 Ga0495638_0045224 3300046460 Bacteria 2770
407 Ga0495628_0045635 3300046516 Bacteria 3483
408 Ga0495630_0016500 3300046517 Bacteria 5398
409 Ga0495648_0006649 3300046524 Bacteria 9362
410 Ga0495586_0092622 3300046535 Bacteria 1671
411 Ga0495587_0050776 3300046536 Unclassified 2454
412 Ga0495674_0085778 3300047319 Bacteria 2697
413 Ga0495674_0145362 3300047319 Bacteria 1991
414 Ga0495672_0095598 3300047320 Bacteria 1622
415 Ga0495672_0235254 3300047320 Bacteria 897
416 Ga0495680_0074886 3300047322 Bacteria 2570
417 Ga0495687_000004 3300047443 Bacteria 779298
418 Ga0496100_0170983 3300048903 Bacteria 1565
419 Ga0496104_0270175 3300048907 Unclassified 1613
420 Ga0496109_0008733 3300048912 Bacteria 8627
421 Ga0496110_0154445 3300048913 Bacteria 2079
422 Ga0496111_0068756 3300048914 Bacteria 2575
423 Ga0501257_037844 3300049686 Bacteria 1178
424 Ga0501259_013503 3300049688 Bacteria 1373
425 Ga0501221_048434 3300049704 Bacteria 951
426 Ga0501225_0064143 3300049705 Bacteria 1036
427 Ga0501080_0400444 3300049742 Bacteria 1235
428 nmdc:mga08y16_29121_c1 3300050511 Bacteria 5820
429 Ga0495619_0107602 3300053085 Bacteria 1902
430 Ga0500583_0001559 3300053092 Bacteria 6628
431 Ga0500642_0011022 3300053130 Unclassified 3217
432 Ga0500622_0001401 3300053156 Bacteria 19430
433 Ga0500637_0036594 3300053178 Unclassified 2756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049704 Ga0501221_048434 Ga0501221_048434_50_766 238
2 3300005329 Ga0070683_100002301 Ga0070683_10000230110 249
3 3300005535 Ga0070684_100004343 Ga0070684_1000043436 249
4 3300013307 Ga0157372_10860744 Ga0157372_108607442 255
5 3300003320 rootH2_10151089 rootH2_101510891 258
6 3300003316 rootH1_10095750 rootH1_100957501 259
7 3300003320 rootH2_10001391 rootH2_1000139153 267
8 3300005616 Ga0068852_100208131 Ga0068852_1002081312 268
9 3300013102 Ga0157371_10004436 Ga0157371_100044363 268
10 3300041459 Ga0451800_0540795 Ga0451800_0540795_248_1057 269
11 3300049742 Ga0501080_0400444 Ga0501080_0400444_224_1033 269
12 3300025961 Ga0207712_10477368 Ga0207712_104773681 270
13 3300014969 Ga0157376_10066368 Ga0157376_100663682 271
14 3300005530 Ga0070679_100122338 Ga0070679_1001223385 272
15 3300025921 Ga0207652_10337493 Ga0207652_103374931 272
16 3300035170 Ga0373943_0182278 Ga0373943_0182278_21_839 272
17 3300047320 Ga0495672_0235254 Ga0495672_0235254_56_880 272
18 3300009545 Ga0105237_10137558 Ga0105237_101375582 276
19 3300010375 Ga0105239_10000079 Ga0105239_1000007925 276
20 3300025913 Ga0207695_10086377 Ga0207695_100863773 276
21 3300025949 Ga0207667_10364856 Ga0207667_103648562 276
22 3300005328 Ga0070676_10000913 Ga0070676_100009139 277
23 3300005340 Ga0070689_100142054 Ga0070689_1001420542 277
24 3300005539 Ga0068853_100331598 Ga0068853_1003315981 277
25 3300005543 Ga0070672_100089731 Ga0070672_1000897313 277
26 3300006881 Ga0068865_100185894 Ga0068865_1001858942 277
27 3300017792 Ga0163161_10175775 Ga0163161_101757751 277
28 3300025901 Ga0207688_10043737 Ga0207688_100437371 277
29 3300025907 Ga0207645_10013306 Ga0207645_100133062 277
30 3300025923 Ga0207681_10030910 Ga0207681_100309103 277
31 3300025936 Ga0207670_10195932 Ga0207670_101959322 277
32 3300025972 Ga0207668_10137902 Ga0207668_101379023 277
33 3300025981 Ga0207640_10058885 Ga0207640_100588852 277
34 3300026089 Ga0207648_10095363 Ga0207648_100953633 277
35 3300006358 Ga0068871_100211232 Ga0068871_1002112322 278
36 3300013306 Ga0163162_10092643 Ga0163162_100926432 278
37 3300005563 Ga0068855_100020595 Ga0068855_1000205956 279
38 3300005616 Ga0068852_100275871 Ga0068852_1002758712 279
39 3300010375 Ga0105239_10444029 Ga0105239_104440292 279
40 3300013100 Ga0157373_10165400 Ga0157373_101654001 279
41 3300013104 Ga0157370_10015484 Ga0157370_100154843 279
42 3300025913 Ga0207695_10000089 Ga0207695_10000089127 279
43 3300025944 Ga0207661_10004770 Ga0207661_100047706 279
44 3300025949 Ga0207667_10000211 Ga0207667_1000021112 279
45 3300026142 Ga0207698_10242214 Ga0207698_102422142 279
46 3300005614 Ga0068856_100375713 Ga0068856_1003757131 280
47 3300009093 Ga0105240_10000105 Ga0105240_1000010555 280
48 3300010375 Ga0105239_10000215 Ga0105239_1000021528 280
49 3300025913 Ga0207695_10000193 Ga0207695_1000019383 280
50 3300026078 Ga0207702_10110922 Ga0207702_101109222 280
51 3300009093 Ga0105240_10000086 Ga0105240_1000008653 281
52 3300013296 Ga0157374_10000003 Ga0157374_10000003686 281
53 3300014969 Ga0157376_10048405 Ga0157376_100484053 281
54 3300025913 Ga0207695_10000175 Ga0207695_1000017593 281
55 3300005539 Ga0068853_100000817 Ga0068853_1000008177 282
56 3300005616 Ga0068852_100078838 Ga0068852_1000788382 282
57 3300009093 Ga0105240_10097728 Ga0105240_100977282 282
58 3300010375 Ga0105239_10065430 Ga0105239_100654302 282
59 3300025913 Ga0207695_10057468 Ga0207695_100574682 282
60 3300026041 Ga0207639_10004093 Ga0207639_100040935 282
61 3300005334 Ga0068869_100253902 Ga0068869_1002539021 283
62 3300005338 Ga0068868_100405850 Ga0068868_1004058501 283
63 3300005367 Ga0070667_100015427 Ga0070667_1000154272 283
64 3300005843 Ga0068860_100005348 Ga0068860_1000053484 283
65 3300009093 Ga0105240_10006701 Ga0105240_100067015 283
66 3300009174 Ga0105241_10303812 Ga0105241_103038122 283
67 3300009545 Ga0105237_10000171 Ga0105237_1000017129 283
68 3300009551 Ga0105238_10416884 Ga0105238_104168842 283
69 3300010375 Ga0105239_10000609 Ga0105239_100006096 283
70 3300013296 Ga0157374_10015501 Ga0157374_100155014 283
71 3300013307 Ga0157372_10054571 Ga0157372_100545712 283
72 3300021384 Ga0213876_10007023 Ga0213876_100070237 283
73 3300025913 Ga0207695_10017906 Ga0207695_100179062 283
74 3300025914 Ga0207671_10001757 Ga0207671_1000175721 283
75 3300028381 Ga0268264_10063161 Ga0268264_100631612 283
76 3300039437 Ga0436365_0473715 Ga0436365_0473715_21776_22630 283
77 3300003794 Ga0055531_10000189 Ga0055531_1000018922 284
78 3300005334 Ga0068869_100094660 Ga0068869_1000946602 284
79 3300005335 Ga0070666_10047776 Ga0070666_100477762 284
80 3300005347 Ga0070668_100155139 Ga0070668_1001551391 284
81 3300005353 Ga0070669_100034114 Ga0070669_1000341143 284
82 3300005367 Ga0070667_100044195 Ga0070667_1000441953 284
83 3300005844 Ga0068862_100053877 Ga0068862_1000538774 284
84 3300005844 Ga0068862_100216146 Ga0068862_1002161461 284
85 3300005983 Ga0081540_1026505 Ga0081540_10265052 284
86 3300009553 Ga0105249_10108250 Ga0105249_101082502 284
87 3300009553 Ga0105249_10273930 Ga0105249_102739302 284
88 3300025304 Ga0209257_1000005 Ga0209257_1000005543 284
89 3300025893 Ga0207682_10037898 Ga0207682_100378982 284
90 3300025903 Ga0207680_10113662 Ga0207680_101136622 284
91 3300025907 Ga0207645_10000240 Ga0207645_1000024026 284
92 3300025942 Ga0207689_10001932 Ga0207689_100019326 284
93 3300028380 Ga0268265_10219757 Ga0268265_102197571 284
94 3300031507 Ga0307509_10253544 Ga0307509_102535441 284
95 3300005328 Ga0070676_10036984 Ga0070676_100369843 285
96 3300005331 Ga0070670_100073438 Ga0070670_1000734382 285
97 3300005333 Ga0070677_10013671 Ga0070677_100136713 285
98 3300005334 Ga0068869_100033803 Ga0068869_1000338032 285
99 3300005335 Ga0070666_10042028 Ga0070666_100420282 285
100 3300005347 Ga0070668_100151380 Ga0070668_1001513802 285
101 3300005353 Ga0070669_100430102 Ga0070669_1004301021 285
102 3300005354 Ga0070675_100481881 Ga0070675_1004818811 285
103 3300005356 Ga0070674_100023486 Ga0070674_1000234862 285
104 3300005364 Ga0070673_100014386 Ga0070673_1000143866 285
105 3300005367 Ga0070667_100140211 Ga0070667_1001402111 285
106 3300005456 Ga0070678_100026557 Ga0070678_1000265571 285
107 3300005466 Ga0070685_10158969 Ga0070685_101589691 285
108 3300005539 Ga0068853_100125060 Ga0068853_1001250602 285
109 3300005539 Ga0068853_100281130 Ga0068853_1002811302 285
110 3300005543 Ga0070672_100069526 Ga0070672_1000695263 285
111 3300005563 Ga0068855_100032915 Ga0068855_1000329152 285
112 3300005614 Ga0068856_100112035 Ga0068856_1001120352 285
113 3300005843 Ga0068860_100125541 Ga0068860_1001255412 285
114 3300006237 Ga0097621_100057858 Ga0097621_1000578583 285
115 3300006358 Ga0068871_100176727 Ga0068871_1001767271 285
116 3300006881 Ga0068865_100064929 Ga0068865_1000649291 285
117 3300009093 Ga0105240_10204173 Ga0105240_102041732 285
118 3300009098 Ga0105245_10170123 Ga0105245_101701232 285
119 3300009174 Ga0105241_10208145 Ga0105241_102081452 285
120 3300009177 Ga0105248_10163779 Ga0105248_101637791 285
121 3300009545 Ga0105237_10063421 Ga0105237_100634212 285
122 3300011119 Ga0105246_10005947 Ga0105246_100059472 285
123 3300013297 Ga0157378_10322748 Ga0157378_103227482 285
124 3300014325 Ga0163163_10531350 Ga0163163_105313502 285
125 3300025901 Ga0207688_10003753 Ga0207688_100037536 285
126 3300025907 Ga0207645_10004698 Ga0207645_100046987 285
127 3300025908 Ga0207643_10016513 Ga0207643_100165132 285
128 3300025913 Ga0207695_10246167 Ga0207695_102461672 285
129 3300025923 Ga0207681_10446570 Ga0207681_104465701 285
130 3300025925 Ga0207650_10157423 Ga0207650_101574232 285
131 3300025926 Ga0207659_10073625 Ga0207659_100736251 285
132 3300025934 Ga0207686_10448421 Ga0207686_104484211 285
133 3300025938 Ga0207704_10017162 Ga0207704_100171622 285
134 3300025942 Ga0207689_10005070 Ga0207689_100050708 285
135 3300025949 Ga0207667_10027574 Ga0207667_100275742 285
136 3300026023 Ga0207677_10032347 Ga0207677_100323472 285
137 3300026041 Ga0207639_10052504 Ga0207639_100525042 285
138 3300026041 Ga0207639_10239932 Ga0207639_102399322 285
139 3300026089 Ga0207648_10012456 Ga0207648_100124567 285
140 3300026116 Ga0207674_10133423 Ga0207674_101334232 285
141 3300026121 Ga0207683_10002445 Ga0207683_100024458 285
142 3300005290 Ga0065712_10138725 Ga0065712_101387252 286
143 3300005329 Ga0070683_100009988 Ga0070683_1000099882 286
144 3300005329 Ga0070683_100322516 Ga0070683_1003225161 286
145 3300005334 Ga0068869_100004876 Ga0068869_1000048769 286
146 3300005334 Ga0068869_100015501 Ga0068869_1000155013 286
147 3300005335 Ga0070666_10107664 Ga0070666_101076642 286
148 3300005338 Ga0068868_100018809 Ga0068868_1000188093 286
149 3300005338 Ga0068868_100046412 Ga0068868_1000464122 286
150 3300005338 Ga0068868_100502985 Ga0068868_1005029851 286
151 3300005344 Ga0070661_100033693 Ga0070661_1000336932 286
152 3300005344 Ga0070661_100058106 Ga0070661_1000581064 286
153 3300005354 Ga0070675_100032672 Ga0070675_1000326723 286
154 3300005356 Ga0070674_100349248 Ga0070674_1003492481 286
155 3300005364 Ga0070673_100018321 Ga0070673_1000183217 286
156 3300005365 Ga0070688_100021866 Ga0070688_1000218664 286
157 3300005366 Ga0070659_100272112 Ga0070659_1002721121 286
158 3300005455 Ga0070663_100132010 Ga0070663_1001320102 286
159 3300005459 Ga0068867_100096023 Ga0068867_1000960232 286
160 3300005459 Ga0068867_100119134 Ga0068867_1001191342 286
161 3300005471 Ga0070698_100023552 Ga0070698_1000235524 286
162 3300005535 Ga0070684_100000880 Ga0070684_1000008807 286
163 3300005535 Ga0070684_100006484 Ga0070684_1000064843 286
164 3300005539 Ga0068853_100010124 Ga0068853_1000101248 286
165 3300005544 Ga0070686_100012910 Ga0070686_1000129107 286
166 3300005548 Ga0070665_100000008 Ga0070665_100000008193 286
167 3300005563 Ga0068855_100061550 Ga0068855_1000615505 286
168 3300005564 Ga0070664_100004175 Ga0070664_1000041755 286
169 3300005564 Ga0070664_100026056 Ga0070664_1000260564 286
170 3300005564 Ga0070664_100064579 Ga0070664_1000645791 286
171 3300005564 Ga0070664_100073235 Ga0070664_1000732352 286
172 3300005564 Ga0070664_100598004 Ga0070664_1005980041 286
173 3300005577 Ga0068857_100004008 Ga0068857_10000400816 286
174 3300005577 Ga0068857_100049908 Ga0068857_1000499086 286
175 3300005578 Ga0068854_100047635 Ga0068854_1000476351 286
176 3300005615 Ga0070702_100255977 Ga0070702_1002559772 286
177 3300005616 Ga0068852_100171184 Ga0068852_1001711843 286
178 3300005616 Ga0068852_100177912 Ga0068852_1001779121 286
179 3300005617 Ga0068859_100119681 Ga0068859_1001196812 286
180 3300005618 Ga0068864_100010076 Ga0068864_1000100762 286
181 3300005618 Ga0068864_100342186 Ga0068864_1003421861 286
182 3300005842 Ga0068858_100055322 Ga0068858_1000553222 286
183 3300005843 Ga0068860_100000029 Ga0068860_10000002942 286
184 3300005844 Ga0068862_100298006 Ga0068862_1002980062 286
185 3300006237 Ga0097621_100000786 Ga0097621_1000007861 286
186 3300006237 Ga0097621_100035174 Ga0097621_1000351743 286
187 3300006358 Ga0068871_100000405 Ga0068871_10000040510 286
188 3300006881 Ga0068865_100129543 Ga0068865_1001295431 286
189 3300006931 Ga0097620_100119683 Ga0097620_1001196832 286
190 3300009174 Ga0105241_10101749 Ga0105241_101017492 286
191 3300009176 Ga0105242_10256199 Ga0105242_102561992 286
192 3300009551 Ga0105238_10060040 Ga0105238_100600405 286
193 3300009553 Ga0105249_10181524 Ga0105249_101815242 286
194 3300009553 Ga0105249_10785059 Ga0105249_107850592 286
195 3300010375 Ga0105239_10088630 Ga0105239_100886306 286
196 3300011119 Ga0105246_10381949 Ga0105246_103819492 286
197 3300013100 Ga0157373_10034089 Ga0157373_100340892 286
198 3300013102 Ga0157371_10037364 Ga0157371_100373642 286
199 3300013105 Ga0157369_10034478 Ga0157369_100344782 286
200 3300013296 Ga0157374_10044834 Ga0157374_100448344 286
201 3300013297 Ga0157378_10305329 Ga0157378_103053292 286
202 3300013297 Ga0157378_10680232 Ga0157378_106802321 286
203 3300013306 Ga0163162_10000038 Ga0163162_1000003820 286
204 3300013306 Ga0163162_10002581 Ga0163162_100025818 286
205 3300013306 Ga0163162_10010923 Ga0163162_100109233 286
206 3300013306 Ga0163162_10058223 Ga0163162_100582232 286
207 3300013307 Ga0157372_10013748 Ga0157372_100137483 286
208 3300013308 Ga0157375_10001343 Ga0157375_100013438 286
209 3300013308 Ga0157375_10016804 Ga0157375_100168041 286
210 3300013308 Ga0157375_10348765 Ga0157375_103487652 286
211 3300014325 Ga0163163_10000781 Ga0163163_1000078112 286
212 3300014325 Ga0163163_10240785 Ga0163163_102407851 286
213 3300014745 Ga0157377_10009101 Ga0157377_100091014 286
214 3300014968 Ga0157379_10024305 Ga0157379_100243053 286
215 3300014969 Ga0157376_10022690 Ga0157376_100226905 286
216 3300017792 Ga0163161_10000711 Ga0163161_100007117 286
217 3300017792 Ga0163161_10002390 Ga0163161_1000239011 286
218 3300025903 Ga0207680_10010471 Ga0207680_100104715 286
219 3300025903 Ga0207680_10097636 Ga0207680_100976361 286
220 3300025904 Ga0207647_10026002 Ga0207647_100260023 286
221 3300025907 Ga0207645_10241327 Ga0207645_102413271 286
222 3300025911 Ga0207654_10067381 Ga0207654_100673812 286
223 3300025919 Ga0207657_10275765 Ga0207657_102757652 286
224 3300025920 Ga0207649_10004807 Ga0207649_100048072 286
225 3300025920 Ga0207649_10009170 Ga0207649_100091705 286
226 3300025924 Ga0207694_10070802 Ga0207694_100708022 286
227 3300025924 Ga0207694_10183629 Ga0207694_101836292 286
228 3300025926 Ga0207659_10049314 Ga0207659_100493143 286
229 3300025933 Ga0207706_10015177 Ga0207706_100151778 286
230 3300025933 Ga0207706_10049179 Ga0207706_100491794 286
231 3300025940 Ga0207691_10019162 Ga0207691_100191622 286
232 3300025941 Ga0207711_10062526 Ga0207711_100625263 286
233 3300025941 Ga0207711_10375412 Ga0207711_103754122 286
234 3300025942 Ga0207689_10005499 Ga0207689_100054994 286
235 3300025944 Ga0207661_10008894 Ga0207661_100088945 286
236 3300025944 Ga0207661_10164369 Ga0207661_101643692 286
237 3300025944 Ga0207661_10458303 Ga0207661_104583031 286
238 3300025945 Ga0207679_10000611 Ga0207679_1000061113 286
239 3300025945 Ga0207679_10006318 Ga0207679_100063183 286
240 3300025945 Ga0207679_10046999 Ga0207679_100469992 286
241 3300025960 Ga0207651_10127300 Ga0207651_101273002 286
242 3300025981 Ga0207640_10029316 Ga0207640_100293164 286
243 3300025986 Ga0207658_10267941 Ga0207658_102679412 286
244 3300026023 Ga0207677_10021467 Ga0207677_100214675 286
245 3300026041 Ga0207639_10064828 Ga0207639_100648282 286
246 3300026067 Ga0207678_10046685 Ga0207678_100466853 286
247 3300026089 Ga0207648_10172099 Ga0207648_101720992 286
248 3300026095 Ga0207676_10003921 Ga0207676_100039214 286
249 3300026116 Ga0207674_10007811 Ga0207674_1000781115 286
250 3300026142 Ga0207698_10051385 Ga0207698_100513851 286
251 3300026142 Ga0207698_10559002 Ga0207698_105590022 286
252 3300028379 Ga0268266_10000016 Ga0268266_10000016191 286
253 3300028379 Ga0268266_10032414 Ga0268266_100324145 286
254 3300028381 Ga0268264_10000072 Ga0268264_1000007243 286
255 3300028381 Ga0268264_10662094 Ga0268264_106620941 286
256 3300035111 Ga0373923_0122343 Ga0373923_0122343_130_990 286
257 3300035172 Ga0373955_0042495 Ga0373955_0042495_1300_2160 286
258 3300035410 Ga0373924_0061994 Ga0373924_0061994_73_933 286
259 3300035692 Ga0373935_0143674 Ga0373935_0143674_201_1061 286
260 3300035725 Ga0373947_0307341 Ga0373947_0307341_126_989 286
261 3300036401 Ga0373937_0044919 Ga0373937_0044919_1204_2064 286
262 3300036401 Ga0373937_0264714 Ga0373937_0264714_193_1059 286
263 3300044656 Ga0466969_0000696 Ga0466969_0000696_3155_4015 286
264 3300044673 Ga0453683_0208255 Ga0453683_0208255_289_1152 286
265 3300044684 Ga0466966_0018657 Ga0466966_0018657_3125_3985 286
266 3300044735 Ga0466968_0122610 Ga0466968_0122610_251_1159 286
267 3300045049 Ga0466959_0000029 Ga0466959_0000029_108130_108990 286
268 3300046454 Ga0495592_0061772 Ga0495592_0061772_236_1096 286
269 3300046460 Ga0495638_0045224 Ga0495638_0045224_1634_2494 286
270 3300046516 Ga0495628_0045635 Ga0495628_0045635_1101_1961 286
271 3300046517 Ga0495630_0016500 Ga0495630_0016500_3441_4301 286
272 3300046524 Ga0495648_0006649 Ga0495648_0006649_7856_8716 286
273 3300046535 Ga0495586_0092622 Ga0495586_0092622_264_1130 286
274 3300046536 Ga0495587_0050776 Ga0495587_0050776_97_963 286
275 3300047319 Ga0495674_0085778 Ga0495674_0085778_914_1774 286
276 3300047319 Ga0495674_0145362 Ga0495674_0145362_1043_1909 286
277 3300047320 Ga0495672_0095598 Ga0495672_0095598_26_892 286
278 3300047322 Ga0495680_0074886 Ga0495680_0074886_47_907 286
279 3300047443 Ga0495687_000004 Ga0495687_000004_308936_309796 286
280 3300048903 Ga0496100_0170983 Ga0496100_0170983_539_1399 286
281 3300048914 Ga0496111_0068756 Ga0496111_0068756_886_1746 286
282 3300053085 Ga0495619_0107602 Ga0495619_0107602_790_1650 286
283 3300053092 Ga0500583_0001559 Ga0500583_0001559_4954_5814 286
284 3300053130 Ga0500642_0011022 Ga0500642_0011022_679_1539 286
285 3300053156 Ga0500622_0001401 Ga0500622_0001401_4701_5561 286
286 3300053178 Ga0500637_0036594 Ga0500637_0036594_1315_2181 286
287 3300005290 Ga0065712_10108820 Ga0065712_101088202 287
288 3300005330 Ga0070690_100035142 Ga0070690_1000351422 287
289 3300005335 Ga0070666_10111130 Ga0070666_101111303 287
290 3300005340 Ga0070689_100004927 Ga0070689_1000049278 287
291 3300005459 Ga0068867_100302821 Ga0068867_1003028212 287
292 3300005535 Ga0070684_100037971 Ga0070684_1000379714 287
293 3300005564 Ga0070664_100035332 Ga0070664_1000353322 287
294 3300005617 Ga0068859_100019364 Ga0068859_1000193642 287
295 3300005618 Ga0068864_100502589 Ga0068864_1005025891 287
296 3300006881 Ga0068865_100205895 Ga0068865_1002058952 287
297 3300006931 Ga0097620_100019362 Ga0097620_1000193622 287
298 3300009177 Ga0105248_10418313 Ga0105248_104183132 287
299 3300013104 Ga0157370_10001280 Ga0157370_1000128028 287
300 3300013306 Ga0163162_10028347 Ga0163162_100283475 287
301 3300013306 Ga0163162_10044809 Ga0163162_100448093 287
302 3300014969 Ga0157376_10261705 Ga0157376_102617052 287
303 3300025903 Ga0207680_10096096 Ga0207680_100960961 287
304 3300025938 Ga0207704_10216802 Ga0207704_102168021 287
305 3300025945 Ga0207679_10014670 Ga0207679_100146702 287
306 3300026035 Ga0207703_10050119 Ga0207703_100501191 287
307 3300026089 Ga0207648_10231605 Ga0207648_102316052 287
308 3300028379 Ga0268266_10187579 Ga0268266_101875792 287
309 3300048907 Ga0496104_0270175 Ga0496104_0270175_138_1001 287
310 3300048913 Ga0496110_0154445 Ga0496110_0154445_888_1757 287
311 3300005290 Ga0065712_10070468 Ga0065712_100704682 288
312 3300005293 Ga0065715_10023940 Ga0065715_100239402 288
313 3300005328 Ga0070676_10002017 Ga0070676_100020176 288
314 3300005334 Ga0068869_100021412 Ga0068869_1000214124 288
315 3300005335 Ga0070666_10008712 Ga0070666_100087122 288
316 3300005338 Ga0068868_100013665 Ga0068868_1000136653 288
317 3300005339 Ga0070660_100187221 Ga0070660_1001872212 288
318 3300005340 Ga0070689_100312121 Ga0070689_1003121211 288
319 3300005343 Ga0070687_100122026 Ga0070687_1001220262 288
320 3300005347 Ga0070668_100003528 Ga0070668_1000035287 288
321 3300005347 Ga0070668_100024075 Ga0070668_1000240754 288
322 3300005353 Ga0070669_100008252 Ga0070669_1000082528 288
323 3300005354 Ga0070675_100007506 Ga0070675_1000075063 288
324 3300005364 Ga0070673_100001315 Ga0070673_1000013153 288
325 3300005364 Ga0070673_100005564 Ga0070673_1000055648 288
326 3300005367 Ga0070667_100028944 Ga0070667_1000289443 288
327 3300005441 Ga0070700_100342121 Ga0070700_1003421211 288
328 3300005456 Ga0070678_100157014 Ga0070678_1001570142 288
329 3300005457 Ga0070662_100008946 Ga0070662_1000089463 288
330 3300005457 Ga0070662_100076741 Ga0070662_1000767412 288
331 3300005459 Ga0068867_100200662 Ga0068867_1002006622 288
332 3300005530 Ga0070679_100227256 Ga0070679_1002272561 288
333 3300005543 Ga0070672_100004032 Ga0070672_1000040323 288
334 3300005543 Ga0070672_100244197 Ga0070672_1002441972 288
335 3300005544 Ga0070686_100243061 Ga0070686_1002430611 288
336 3300005563 Ga0068855_100190374 Ga0068855_1001903742 288
337 3300005617 Ga0068859_100002868 Ga0068859_10000286816 288
338 3300005618 Ga0068864_100009774 Ga0068864_1000097743 288
339 3300005719 Ga0068861_100025664 Ga0068861_1000256642 288
340 3300005719 Ga0068861_100092583 Ga0068861_1000925833 288
341 3300005840 Ga0068870_10027123 Ga0068870_100271232 288
342 3300005841 Ga0068863_100001100 Ga0068863_1000011003 288
343 3300005842 Ga0068858_100024544 Ga0068858_1000245443 288
344 3300005843 Ga0068860_100009522 Ga0068860_1000095227 288
345 3300005844 Ga0068862_100024380 Ga0068862_1000243806 288
346 3300006358 Ga0068871_100009679 Ga0068871_1000096796 288
347 3300006844 Ga0075428_100491722 Ga0075428_1004917222 288
348 3300006881 Ga0068865_100014358 Ga0068865_1000143584 288
349 3300006931 Ga0097620_100002868 Ga0097620_10000286816 288
350 3300009093 Ga0105240_10094322 Ga0105240_100943223 288
351 3300009094 Ga0111539_10098353 Ga0111539_100983532 288
352 3300009098 Ga0105245_10156346 Ga0105245_101563463 288
353 3300009101 Ga0105247_10050633 Ga0105247_100506332 288
354 3300009148 Ga0105243_10132120 Ga0105243_101321202 288
355 3300009177 Ga0105248_10038217 Ga0105248_100382174 288
356 3300009553 Ga0105249_10006720 Ga0105249_100067206 288
357 3300009553 Ga0105249_10009251 Ga0105249_100092513 288
358 3300009553 Ga0105249_10211766 Ga0105249_102117662 288
359 3300010375 Ga0105239_10076633 Ga0105239_100766333 288
360 3300011119 Ga0105246_10436839 Ga0105246_104368391 288
361 3300013100 Ga0157373_10000937 Ga0157373_100009374 288
362 3300013102 Ga0157371_10000232 Ga0157371_1000023238 288
363 3300013102 Ga0157371_10012377 Ga0157371_100123774 288
364 3300013102 Ga0157371_10016697 Ga0157371_100166974 288
365 3300013102 Ga0157371_10188229 Ga0157371_101882292 288
366 3300013104 Ga0157370_10012211 Ga0157370_100122114 288
367 3300013296 Ga0157374_10176787 Ga0157374_101767872 288
368 3300013297 Ga0157378_10021791 Ga0157378_100217914 288
369 3300013306 Ga0163162_10008550 Ga0163162_100085507 288
370 3300013306 Ga0163162_10244501 Ga0163162_102445012 288
371 3300013307 Ga0157372_10006839 Ga0157372_100068394 288
372 3300013307 Ga0157372_10123694 Ga0157372_101236942 288
373 3300013307 Ga0157372_10415719 Ga0157372_104157192 288
374 3300013308 Ga0157375_10007158 Ga0157375_100071587 288
375 3300014325 Ga0163163_10030450 Ga0163163_100304501 288
376 3300014326 Ga0157380_10031172 Ga0157380_100311724 288
377 3300014745 Ga0157377_10008768 Ga0157377_100087686 288
378 3300014969 Ga0157376_10025307 Ga0157376_100253072 288
379 3300014969 Ga0157376_10113088 Ga0157376_101130882 288
380 3300017792 Ga0163161_10030544 Ga0163161_100305443 288
381 3300025903 Ga0207680_10010331 Ga0207680_100103312 288
382 3300025907 Ga0207645_10001621 Ga0207645_1000162113 288
383 3300025909 Ga0207705_10085073 Ga0207705_100850732 288
384 3300025917 Ga0207660_10140356 Ga0207660_101403562 288
385 3300025918 Ga0207662_10030482 Ga0207662_100304822 288
386 3300025918 Ga0207662_10132742 Ga0207662_101327421 288
387 3300025919 Ga0207657_10313354 Ga0207657_103133542 288
388 3300025925 Ga0207650_10109870 Ga0207650_101098702 288
389 3300025926 Ga0207659_10051444 Ga0207659_100514443 288
390 3300025932 Ga0207690_10082944 Ga0207690_100829442 288
391 3300025933 Ga0207706_10034009 Ga0207706_100340092 288
392 3300025933 Ga0207706_10107596 Ga0207706_101075962 288
393 3300025936 Ga0207670_10102627 Ga0207670_101026272 288
394 3300025936 Ga0207670_10168862 Ga0207670_101688621 288
395 3300025938 Ga0207704_10014891 Ga0207704_100148912 288
396 3300025940 Ga0207691_10000285 Ga0207691_100002859 288
397 3300025940 Ga0207691_10029679 Ga0207691_100296792 288
398 3300025942 Ga0207689_10033653 Ga0207689_100336532 288
399 3300025945 Ga0207679_10355409 Ga0207679_103554091 288
400 3300025949 Ga0207667_10498535 Ga0207667_104985351 288
401 3300025960 Ga0207651_10007698 Ga0207651_100076983 288
402 3300025961 Ga0207712_10030211 Ga0207712_100302111 288
403 3300025972 Ga0207668_10005422 Ga0207668_100054223 288
404 3300026023 Ga0207677_10168332 Ga0207677_101683322 288
405 3300026035 Ga0207703_10016400 Ga0207703_100164002 288
406 3300026041 Ga0207639_10402768 Ga0207639_104027681 288
407 3300026088 Ga0207641_10154275 Ga0207641_101542752 288
408 3300026089 Ga0207648_10017086 Ga0207648_100170864 288
409 3300026089 Ga0207648_10061369 Ga0207648_100613692 288
410 3300026089 Ga0207648_10077588 Ga0207648_100775883 288
411 3300026118 Ga0207675_100016538 Ga0207675_1000165385 288
412 3300026118 Ga0207675_100253955 Ga0207675_1002539552 288
413 3300026121 Ga0207683_10053566 Ga0207683_100535662 288
414 3300027907 Ga0207428_10281987 Ga0207428_102819871 288
415 3300028379 Ga0268266_10003148 Ga0268266_100031486 288
416 3300028380 Ga0268265_10047518 Ga0268265_100475181 288
417 3300028381 Ga0268264_10232242 Ga0268264_102322422 288
418 3300037312 Ga0395899_0155615 Ga0395899_0155615_660_1529 288
419 3300037418 Ga0395900_0075315 Ga0395900_0075315_1754_2623 288
420 3300037418 Ga0395900_0275301 Ga0395900_0275301_83_952 288
421 3300038443 Ga0395901_0011741 Ga0395901_0011741_2427_3296 288
422 3300048912 Ga0496109_0008733 Ga0496109_0008733_2547_3422 288
423 3300049686 Ga0501257_037844 Ga0501257_037844_253_1119 288
424 3300049688 Ga0501259_013503 Ga0501259_013503_166_1032 288
425 3300049705 Ga0501225_0064143 Ga0501225_0064143_141_1007 288
426 3300050511 nmdc:mga08y16_29121_c1 nmdc:mga08y16_29121_c1_3833_4702 288
427 3300005329 Ga0070683_100495540 Ga0070683_1004955402 289
428 3300005616 Ga0068852_100031682 Ga0068852_1000316822 289
429 3300005843 Ga0068860_100004875 Ga0068860_10000487512 290
430 3300013306 Ga0163162_10000233 Ga0163162_1000023333 290
431 3300028381 Ga0268264_10004183 Ga0268264_1000418312 290
432 3300003203 JGI25406J46586_10007616 JGI25406J46586_100076163 292
433 3300005985 Ga0081539_10001124 Ga0081539_100011247 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

92

317

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8716 39 284
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.869 37 272
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8614 37 272
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.857 39 284
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8529 40 273
ID Description Score Start End Superfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.829 38 284 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7726 38 282 3.20.20.150
af_P32134_16_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7461 38 269 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7438 38 284 3.20.20.150
3dx5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7387 41 279 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A3N5NKD4-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9879 56 285 GO:0016853
AF-A0A662CCS7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9858 104 285 GO:0016853
AF-A0A0S8JUC0-F1-model_v4 Xylose isomerase 0.982 130 285 GO:0016853
AF-A0A3N5NKD4-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9753 56 285 GO:0016853
AF-A0A662CCS7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.97 104 285 GO:0016853

Feature Viewer

pLDDT pTM Quality
89.2 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map