F442830

General Info

Members Datasets Scaffolds Average Seq Length
433 246 867 426

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10022435|Ga0105239_100224354
Length 461
Sequence MKCLRRKGRCHENVLPISKKYFKISKRNFYMIATIKPSSLSGAITAPASKSSMQRACAAALVRNGETLIHNPGISNDDNAALGVIKALGAEWKMVDGELHVTSNGVNAVANEVNCGESGLGIRMFAPLVALNNREITINGEGSLLSRPMDFFDEVLPLLDVEVSSNSGKLPLKLKGPLQPKDITIDGSLSSQFLTGLLMAYAASDAKGVTITVTNLKSKPYVDLTLKVMEAYGLKAPENINYEKFYFGLEPANSQATFVDYTVEGDWSGGAFLLVSGAIAGNIIIKGLDVTSTQADKAVLSALMDCGSKISIQSDEIEIAPGELKAFQFNATDCPDLFPPLVALAAYCKGTTVIEGVHRLTHKESNRALTLQEEFAKLGIEITLQDNLMLIKGGTGIKGATVHSRHDHRIAMACAVAALKAEGETVIEEAQAVSKSYPNFYEHIQSLGANVSIQDASVKAL

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
204 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
205 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
206 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
207 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
217 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2738541278 Niastella sp. CF465 Isolate Unclassified
231 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
232 2818991444 Filimonas endophytica 3197 Isolate Unclassified
233 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
234 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
235 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
236 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
237 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
238 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
239 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
240 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
241 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
242 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
243 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
244 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
245 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
246 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 0
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.09
Nodule 0
Rhizoplane 1.15
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 9.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10022435 3300010375 Bacteria 6959
2 JGI24740J21852_10005073 3300001979 Bacteria 5589
3 JGI24739J22299_10004842 3300001989 Bacteria 5131
4 JGI25154J39366_1000007 3300002738 Bacteria 335932
5 JGI25153J46596_10002043 3300003215 Bacteria 11895
6 JGI25153J46596_10014510 3300003215 Bacteria 3269
7 rootH2_10129754 3300003320 Bacteria 4334
8 rootH2_10168824 3300003320 Bacteria 3662
9 rootL2_10026791 3300003322 Bacteria 4704
10 rootL2_10026792 3300003322 Bacteria 5792
11 rootL2_10040257 3300003322 Bacteria 5357
12 rootL2_10221152 3300003322 Bacteria 1782
13 rootH1_10000019 3300003316 Bacteria 18606
14 rootH1_10000019 3300003323 Bacteria 34919
15 rootH1_10103763 3300003323 Bacteria 6165
16 rootH1_10104246 3300003323 Bacteria 6163
17 rootH1_10318491 3300003323 Unclassified 3145
18 rootH1_10321485 3300003323 Bacteria 2089
19 JGI25160J50197_1000745 3300003354 Bacteria 17705
20 JGI25160J50197_1007043 3300003354 Bacteria 4451
21 Ga0055535_1002298 3300003761 Bacteria 7052
22 Ga0055542_1010567 3300003762 Bacteria 1681
23 Ga0055528_1001519 3300003790 Bacteria 14022
24 Ga0055530_10006732 3300003791 Bacteria 5028
25 Ga0055531_10000020 3300003794 Bacteria 170186
26 Ga0065165_1000010 3300005262 Bacteria 323737
27 Ga0065165_1013843 3300005262 Bacteria 3173
28 Ga0070658_10064430 3300005327 Bacteria 2989
29 Ga0070658_10154188 3300005327 Bacteria 1925
30 Ga0070676_10035216 3300005328 Bacteria 2878
31 Ga0070683_100011868 3300005329 Bacteria 7550
32 Ga0070683_100026191 3300005329 Bacteria 5247
33 Ga0070683_100146208 3300005329 Bacteria 2240
34 Ga0070690_100024767 3300005330 Unclassified 3693
35 Ga0070670_100043770 3300005331 Bacteria 3848
36 Ga0070677_10050930 3300005333 Bacteria 1674
37 Ga0068869_100006827 3300005334 Bacteria 7261
38 Ga0068869_100013130 3300005334 Bacteria 5500
39 Ga0070666_10000833 3300005335 Bacteria 18712
40 Ga0070666_10003710 3300005335 Bacteria 9255
41 Ga0070666_10005940 3300005335 Bacteria 7494
42 Ga0070680_100056802 3300005336 Unclassified 3199
43 Ga0070682_100000173 3300005337 Bacteria 47981
44 Ga0070682_100006926 3300005337 Bacteria 6371
45 Ga0068868_100010161 3300005338 Bacteria 6802
46 Ga0068868_100011608 3300005338 Bacteria 6417
47 Ga0068868_100045052 3300005338 Unclassified 3450
48 Ga0070660_100012793 3300005339 Bacteria 6000
49 Ga0070689_100068546 3300005340 Bacteria 2767
50 Ga0070691_10024793 3300005341 Bacteria 2790
51 Ga0070687_100002130 3300005343 Bacteria 7317
52 Ga0070661_100003273 3300005344 Bacteria 11185
53 Ga0070668_100000043 3300005347 Bacteria 78564
54 Ga0070675_100021470 3300005354 Bacteria 5160
55 Ga0070675_100095286 3300005354 Bacteria 2499
56 Ga0070671_100070074 3300005355 Bacteria 2925
57 Ga0070671_100092071 3300005355 Bacteria 2540
58 Ga0070673_100003480 3300005364 Bacteria 9802
59 Ga0070673_100019594 3300005364 Bacteria 4860
60 Ga0070673_100345670 3300005364 Unclassified 1319
61 Ga0070688_100143944 3300005365 Bacteria 1622
62 Ga0070667_100000254 3300005367 Bacteria 60664
63 Ga0070667_100017602 3300005367 Bacteria 5921
64 Ga0070667_100131364 3300005367 Bacteria 2186
65 Ga0070662_100002089 3300005457 Bacteria 12246
66 Ga0070662_100007119 3300005457 Bacteria 7239
67 Ga0070681_10075464 3300005458 Bacteria 3331
68 Ga0068867_100014081 3300005459 Bacteria 5665
69 Ga0068867_100017634 3300005459 Bacteria 5070
70 Ga0070685_10022806 3300005466 Bacteria 3418
71 Ga0070679_100003920 3300005530 Bacteria 13685
72 Ga0070679_100039551 3300005530 Bacteria 4686
73 Ga0070684_100003498 3300005535 Bacteria 11793
74 Ga0070684_100043118 3300005535 Bacteria 3895
75 Ga0068853_100025782 3300005539 Bacteria 4935
76 Ga0068853_100051908 3300005539 Unclassified 3531
77 Ga0070672_100004549 3300005543 Bacteria 9081
78 Ga0070672_100007506 3300005543 Bacteria 7405
79 Ga0070686_100022729 3300005544 Bacteria 3739
80 Ga0070693_100002584 3300005547 Bacteria 8335
81 Ga0070665_100000350 3300005548 Bacteria 69455
82 Ga0068855_100013922 3300005563 Bacteria 9701
83 Ga0068855_100014782 3300005563 Bacteria 9401
84 Ga0068855_100033470 3300005563 Bacteria 6133
85 Ga0070664_100004097 3300005564 Bacteria 11708
86 Ga0070664_100005960 3300005564 Bacteria 9850
87 Ga0070664_100017133 3300005564 Bacteria 5948
88 Ga0070664_100023769 3300005564 Bacteria 5062
89 Ga0068857_100000416 3300005577 Bacteria 30150
90 Ga0068857_100092720 3300005577 Bacteria 2704
91 Ga0068854_100042048 3300005578 Unclassified 3232
92 Ga0068856_100010342 3300005614 Bacteria 9064
93 Ga0068856_100016424 3300005614 Bacteria 7162
94 Ga0068856_100059468 3300005614 Bacteria 3775
95 Ga0068852_100003650 3300005616 Bacteria 10781
96 Ga0068852_100177994 3300005616 Unclassified 1998
97 Ga0068859_100000227 3300005617 Bacteria 55148
98 Ga0068859_100001471 3300005617 Bacteria 24005
99 Ga0068859_100080214 3300005617 Bacteria 3304
100 Ga0068864_100001192 3300005618 Bacteria 21573
101 Ga0068861_100048044 3300005719 Bacteria 3224
102 Ga0068851_10012344 3300005834 Bacteria 4025
103 Ga0068863_100003656 3300005841 Bacteria 15182
104 Ga0068863_100026992 3300005841 Bacteria 5476
105 Ga0068863_100055849 3300005841 Bacteria 3739
106 Ga0068858_100000199 3300005842 Bacteria 64607
107 Ga0068858_100003030 3300005842 Bacteria 16839
108 Ga0068860_100003203 3300005843 Bacteria 16892
109 Ga0068860_100004214 3300005843 Bacteria 14735
110 Ga0068860_100010759 3300005843 Bacteria 9031
111 Ga0068860_100023461 3300005843 Bacteria 5962
112 Ga0068860_100070685 3300005843 Bacteria 3318
113 Ga0081539_10000037 3300005985 Bacteria 296160
114 Ga0075366_10034768 3300006195 Bacteria 2970
115 Ga0097621_100000063 3300006237 Bacteria 55571
116 Ga0097621_100003359 3300006237 Bacteria 11008
117 Ga0097621_100016337 3300006237 Bacteria 5609
118 Ga0097621_100082976 3300006237 Bacteria 2670
119 Ga0068871_100000952 3300006358 Bacteria 19348
120 Ga0068871_100002768 3300006358 Bacteria 11972
121 Ga0068871_100007723 3300006358 Bacteria 7699
122 Ga0068871_100021180 3300006358 Bacteria 4993
123 Ga0075429_100059332 3300006880 Unclassified 3333
124 Ga0097620_100000227 3300006931 Bacteria 55148
125 Ga0097620_100001471 3300006931 Bacteria 24005
126 Ga0097620_100019949 3300006931 Bacteria 6730
127 Ga0097620_100080207 3300006931 Bacteria 3304
128 Ga0105240_10032774 3300009093 Bacteria 6721
129 Ga0105240_10045255 3300009093 Bacteria 5584
130 Ga0105240_10074365 3300009093 Bacteria 4194
131 Ga0111539_10043454 3300009094 Bacteria 5387
132 Ga0111539_10081953 3300009094 Bacteria 3794
133 Ga0105245_10065487 3300009098 Bacteria 3286
134 Ga0105247_10001601 3300009101 Bacteria 16023
135 Ga0105243_10014910 3300009148 Bacteria 5881
136 Ga0105241_10000674 3300009174 Bacteria 25718
137 Ga0105241_10027376 3300009174 Bacteria 4245
138 Ga0105242_10098670 3300009176 Bacteria 2471
139 Ga0105242_10153648 3300009176 Bacteria 2009
140 Ga0105248_10009934 3300009177 Bacteria 10475
141 Ga0105248_10019350 3300009177 Bacteria 7533
142 Ga0105237_10002860 3300009545 Bacteria 20998
143 Ga0105237_10005745 3300009545 Bacteria 13938
144 Ga0105237_10030881 3300009545 Bacteria 5436
145 Ga0105237_10112805 3300009545 Unclassified 2711
146 Ga0105237_10193627 3300009545 Unclassified 2033
147 Ga0105238_10032861 3300009551 Bacteria 5281
148 Ga0105249_10008538 3300009553 Bacteria 8930
149 Ga0105249_10024983 3300009553 Bacteria 5375
150 Ga0105249_10025237 3300009553 Bacteria 5348
151 Ga0105249_10042775 3300009553 Bacteria 4121
152 Ga0105239_10001973 3300010375 Bacteria 26693
153 Ga0105239_10006841 3300010375 Bacteria 13158
154 Ga0105239_10082566 3300010375 Bacteria 3539
155 Ga0105246_10027738 3300011119 Bacteria 3714
156 Ga0157373_10007968 3300013100 Bacteria 7877
157 Ga0157371_10069224 3300013102 Bacteria 2499
158 Ga0157370_10015864 3300013104 Bacteria 7644
159 Ga0157370_10044808 3300013104 Bacteria 4248
160 Ga0157370_10058913 3300013104 Bacteria 3650
161 Ga0157369_10039596 3300013105 Bacteria 5150
162 Ga0157369_10103758 3300013105 Unclassified 3029
163 Ga0157369_10133705 3300013105 Bacteria 2627
164 Ga0157369_10189812 3300013105 Unclassified 2159
165 Ga0157369_10274654 3300013105 Bacteria 1756
166 Ga0157374_10000084 3300013296 Bacteria 94138
167 Ga0157374_10013214 3300013296 Bacteria 7204
168 Ga0157374_10056710 3300013296 Bacteria 3658
169 Ga0157378_10004836 3300013297 Bacteria 11808
170 Ga0157378_10005892 3300013297 Bacteria 10736
171 Ga0157378_10008288 3300013297 Bacteria 9058
172 Ga0157378_10043377 3300013297 Bacteria 3993
173 Ga0157378_10073339 3300013297 Bacteria 3077
174 Ga0157378_10155737 3300013297 Bacteria 2133
175 Ga0163162_10000113 3300013306 Bacteria 71491
176 Ga0163162_10000158 3300013306 Bacteria 62514
177 Ga0163162_10000524 3300013306 Bacteria 35554
178 Ga0163162_10001702 3300013306 Bacteria 20630
179 Ga0163162_10001883 3300013306 Bacteria 19750
180 Ga0163162_10003737 3300013306 Bacteria 14581
181 Ga0163162_10157667 3300013306 Bacteria 2390
182 Ga0163162_10360571 3300013306 Bacteria 1587
183 Ga0157372_10002055 3300013307 Bacteria 21888
184 Ga0157372_10059213 3300013307 Bacteria 4283
185 Ga0157372_10093628 3300013307 Bacteria 3420
186 Ga0157372_10118046 3300013307 Bacteria 3043
187 Ga0157372_10147301 3300013307 Unclassified 2715
188 Ga0157372_10188579 3300013307 Unclassified 2388
189 Ga0157375_10000228 3300013308 Bacteria 52278
190 Ga0157375_10000565 3300013308 Bacteria 33320
191 Ga0163163_10000332 3300014325 Bacteria 45415
192 Ga0163163_10099452 3300014325 Unclassified 2930
193 Ga0163163_10121704 3300014325 Bacteria 2644
194 Ga0157377_10037121 3300014745 Bacteria 2684
195 Ga0157377_10096416 3300014745 Unclassified 1754
196 Ga0157379_10000245 3300014968 Bacteria 42570
197 Ga0157379_10046499 3300014968 Bacteria 3871
198 Ga0157379_10049824 3300014968 Bacteria 3739
199 Ga0157376_10000439 3300014969 Bacteria 26775
200 Ga0157376_10067094 3300014969 Bacteria 3034
201 Ga0157376_10208451 3300014969 Bacteria 1803
202 Ga0182005_1000450 3300015265 Bacteria 21827
203 Ga0163161_10002605 3300017792 Bacteria 12857
204 Ga0163161_10017161 3300017792 Bacteria 5062
205 Ga0213876_10016529 3300021384 Bacteria 3900
206 Ga0213876_10088856 3300021384 Bacteria 1636
207 Ga0209436_102616 3300025208 Bacteria 5277
208 Ga0209436_108599 3300025208 Bacteria 2017
209 Ga0209258_100293 3300025242 Bacteria 82199
210 Ga0209646_1000002 3300025246 Bacteria 1425781
211 Ga0209646_1001787 3300025246 Bacteria 5381
212 Ga0209026_1000524 3300025250 Bacteria 27023
213 Ga0209148_1000278 3300025254 Bacteria 79641
214 Ga0209673_1000530 3300025273 Bacteria 62542
215 Ga0209130_1002093 3300025284 Bacteria 10689
216 Ga0209564_1008430 3300025295 Bacteria 5086
217 Ga0209758_1007117 3300025297 Bacteria 7738
218 Ga0209758_1013883 3300025297 Bacteria 4341
219 Ga0209050_1000134 3300025298 Bacteria 184417
220 Ga0207426_1000002 3300025302 Bacteria 1249660
221 Ga0207426_1000051 3300025302 Bacteria 391700
222 Ga0207426_1000841 3300025302 Bacteria 32428
223 Ga0207426_1001206 3300025302 Bacteria 22940
224 Ga0207426_1013534 3300025302 Bacteria 3020
225 Ga0209257_1000001 3300025304 Bacteria 2274655
226 Ga0209257_1001323 3300025304 Bacteria 30130
227 Ga0207656_10011356 3300025321 Bacteria 3364
228 Ga0207710_10006910 3300025900 Bacteria 4829
229 Ga0207680_10000939 3300025903 Bacteria 13760
230 Ga0207647_10000418 3300025904 Bacteria 34995
231 Ga0207645_10000378 3300025907 Bacteria 36697
232 Ga0207705_10000717 3300025909 Bacteria 27323
233 Ga0207705_10109398 3300025909 Bacteria 2041
234 Ga0207705_10132119 3300025909 Bacteria 1858
235 Ga0207654_10007301 3300025911 Bacteria 5569
236 Ga0207654_10019431 3300025911 Bacteria 3586
237 Ga0207707_10042937 3300025912 Bacteria 3945
238 Ga0207695_10035293 3300025913 Bacteria 5426
239 Ga0207671_10003626 3300025914 Bacteria 15252
240 Ga0207671_10124901 3300025914 Unclassified 1970
241 Ga0207660_10012932 3300025917 Bacteria 5467
242 Ga0207657_10006443 3300025919 Bacteria 12164
243 Ga0207657_10077406 3300025919 Bacteria 2803
244 Ga0207652_10000986 3300025921 Bacteria 26359
245 Ga0207694_10010268 3300025924 Bacteria 7059
246 Ga0207650_10023539 3300025925 Bacteria 4369
247 Ga0207659_10011462 3300025926 Bacteria 5602
248 Ga0207659_10132734 3300025926 Bacteria 1924
249 Ga0207687_10021107 3300025927 Bacteria 4323
250 Ga0207644_10018411 3300025931 Bacteria 4725
251 Ga0207644_10032097 3300025931 Bacteria 3662
252 Ga0207690_10029876 3300025932 Bacteria 3469
253 Ga0207706_10010506 3300025933 Bacteria 8461
254 Ga0207686_10108172 3300025934 Bacteria 1870
255 Ga0207691_10000227 3300025940 Bacteria 54652
256 Ga0207691_10002263 3300025940 Bacteria 18853
257 Ga0207691_10019151 3300025940 Bacteria 6480
258 Ga0207689_10002228 3300025942 Bacteria 18158
259 Ga0207689_10016253 3300025942 Bacteria 6304
260 Ga0207689_10034261 3300025942 Bacteria 4217
261 Ga0207661_10022254 3300025944 Bacteria 4769
262 Ga0207661_10037017 3300025944 Unclassified 3813
263 Ga0207679_10003549 3300025945 Bacteria 9658
264 Ga0207679_10041082 3300025945 Unclassified 3315
265 Ga0207679_10058462 3300025945 Bacteria 2857
266 Ga0207667_10000135 3300025949 Bacteria 111565
267 Ga0207667_10218190 3300025949 Bacteria 1954
268 Ga0207651_10001541 3300025960 Bacteria 10518
269 Ga0207712_10007643 3300025961 Bacteria 6835
270 Ga0207712_10046980 3300025961 Unclassified 2995
271 Ga0207712_10059269 3300025961 Unclassified 2709
272 Ga0207668_10000679 3300025972 Bacteria 20879
273 Ga0207640_10014080 3300025981 Bacteria 4597
274 Ga0207658_10000176 3300025986 Bacteria 68501
275 Ga0207658_10162189 3300025986 Bacteria 1833
276 Ga0207677_10006136 3300026023 Bacteria 6565
277 Ga0207677_10010354 3300026023 Bacteria 5273
278 Ga0207677_10022177 3300026023 Bacteria 3897
279 Ga0207677_10036299 3300026023 Bacteria 3211
280 Ga0207703_10000433 3300026035 Bacteria 44015
281 Ga0207703_10016940 3300026035 Bacteria 5683
282 Ga0207703_10085453 3300026035 Bacteria 2640
283 Ga0207639_10022784 3300026041 Bacteria 4515
284 Ga0207678_10049899 3300026067 Unclassified 3616
285 Ga0207678_10073566 3300026067 Bacteria 2928
286 Ga0207702_10009327 3300026078 Bacteria 8244
287 Ga0207702_10213867 3300026078 Bacteria 1793
288 Ga0207641_10001151 3300026088 Bacteria 26569
289 Ga0207641_10002208 3300026088 Bacteria 18318
290 Ga0207648_10003768 3300026089 Bacteria 15840
291 Ga0207648_10013016 3300026089 Bacteria 7761
292 Ga0207648_10031274 3300026089 Unclassified 4706
293 Ga0207648_10059714 3300026089 Bacteria 3326
294 Ga0207648_10080462 3300026089 Bacteria 2842
295 Ga0207648_10120700 3300026089 Unclassified 2305
296 Ga0207676_10001240 3300026095 Bacteria 18994
297 Ga0207676_10163688 3300026095 Bacteria 1930
298 Ga0207674_10002454 3300026116 Bacteria 23401
299 Ga0207674_10004100 3300026116 Bacteria 17648
300 Ga0207675_100074499 3300026118 Bacteria 3176
301 Ga0207683_10050506 3300026121 Bacteria 3643
302 Ga0207698_10007891 3300026142 Bacteria 6702
303 Ga0207698_10094394 3300026142 Bacteria 2459
304 Ga0207698_10245536 3300026142 Bacteria 1635
305 Ga0268266_10003258 3300028379 Bacteria 16362
306 Ga0268264_10003175 3300028381 Bacteria 14234
307 Ga0268264_10003379 3300028381 Bacteria 13782
308 Ga0268264_10007560 3300028381 Bacteria 9064
309 Ga0268264_10046986 3300028381 Bacteria 3588
310 Ga0307515_10000002 3300028794 Bacteria 1231751
311 Ga0265327_10000168 3300031251 Bacteria 141392
312 Ga0265327_10000531 3300031251 Bacteria 65562
313 Ga0307509_10044077 3300031507 Bacteria 4821
314 Ga0307509_10148777 3300031507 Bacteria 2262
315 Ga0307408_100002354 3300031548 Bacteria 13345
316 Ga0307508_10000923 3300031616 Bacteria 34113
317 Ga0307413_10060616 3300031824 Bacteria 2330
318 Ga0307416_100392119 3300032002 Bacteria 1423
319 Ga0307415_100063855 3300032126 Bacteria 2560
320 Ga0373955_0025758 3300035172 Unclassified 3024
321 Ga0395900_0140899 3300037418 Bacteria 2469
322 Ga0395900_0318255 3300037418 Bacteria 1537
323 Ga0395900_0323165 3300037418 Bacteria 1523
324 Ga0395905_0002545 3300037471 Bacteria 20113
325 Ga0395905_0078545 3300037471 Unclassified 3093
326 Ga0395905_0177048 3300037471 Unclassified 2002
327 Ga0395901_0195567 3300038443 Bacteria 2121
328 Ga0436365_0343949 3300039437 Bacteria 5370
329 Ga0436365_0646455 3300039437 Bacteria 14028
330 Ga0451791_0654002 3300041451 Bacteria 1593
331 Ga0439431_0000931 3300041997 Bacteria 6343
332 Ga0439457_000560 3300042014 Bacteria 10851
333 Ga0439457_005859 3300042014 Bacteria 3048
334 Ga0439462_0016339 3300042015 Bacteria 1917
335 Ga0439462_0021891 3300042015 Bacteria 1672
336 Ga0451577_0082284 3300042876 Bacteria 2872
337 Ga0466972_0000003 3300044658 Bacteria 391452
338 Ga0466972_0000013 3300044658 Bacteria 229345
339 Ga0466966_0000045 3300044684 Bacteria 92504
340 Ga0453684_0227410 3300044712 Unclassified 2156
341 Ga0466970_0000561 3300044765 Bacteria 18151
342 Ga0466957_0000070 3300044842 Bacteria 39824
343 Ga0466957_0021182 3300044842 Bacteria 3829
344 Ga0466959_0000023 3300045049 Bacteria 124545
345 Ga0466959_0024780 3300045049 Bacteria 4444
346 Ga0495638_0047392 3300046460 Unclassified 2694
347 Ga0495580_0009622 3300046472 Bacteria 7590
348 Ga0495648_0004547 3300046524 Bacteria 11817
349 Ga0495633_0000090 3300046558 Bacteria 122693
350 Ga0495633_0037814 3300046558 Unclassified 2308
351 Ga0495668_0003561 3300046616 Bacteria 11572
352 Ga0495686_0000616 3300047472 Bacteria 49206
353 Ga0496101_0219762 3300048904 Bacteria 1474
354 Ga0496108_0213864 3300048911 Bacteria 1674
355 Ga0496109_0038819 3300048912 Bacteria 4307
356 Ga0496115_0140460 3300048918 Unclassified 1993
357 Ga0496121_0000020 3300048924 Bacteria 498732
358 Ga0496124_0055008 3300048927 Bacteria 3366
359 Ga0496126_0006540 3300048929 Bacteria 12973
360 Ga0501298_000128 3300049521 Bacteria 9130
361 Ga0501031_0117082 3300049568 Unclassified 1741
362 Ga0501033_0049182 3300049570 Bacteria 3130
363 Ga0501034_0023947 3300049571 Bacteria 6213
364 Ga0501034_0080598 3300049571 Bacteria 3258
365 Ga0501034_0129119 3300049571 Unclassified 2511
366 Ga0501034_0263734 3300049571 Bacteria 1665
367 Ga0501036_0012338 3300049572 Bacteria 7075
368 Ga0501038_0041100 3300049574 Bacteria 4033
369 Ga0501039_0055924 3300049575 Unclassified 3056
370 Ga0501043_0042858 3300049579 Unclassified 3557
371 Ga0501043_0059618 3300049579 Unclassified 2996
372 Ga0501047_0027022 3300049581 Bacteria 5528
373 Ga0501047_0120128 3300049581 Bacteria 2510
374 Ga0501071_0093775 3300049587 Bacteria 2208
375 Ga0501073_0012434 3300049589 Bacteria 6211
376 Ga0501207_005035 3300049654 Bacteria 1816
377 Ga0501223_000493 3300049663 Bacteria 9571
378 Ga0501224_007905 3300049664 Bacteria 1549
379 Ga0501242_005289 3300049674 Bacteria 1450
380 Ga0501259_000401 3300049688 Bacteria 6869
381 Ga0501261_003057 3300049690 Bacteria 2055
382 Ga0501219_000027 3300049703 Bacteria 23249
383 Ga0501221_006106 3300049704 Bacteria 2028
384 Ga0501221_007938 3300049704 Bacteria 1834
385 Ga0501225_0000367 3300049705 Bacteria 14177
386 Ga0501225_0000846 3300049705 Bacteria 9521
387 Ga0501083_0029262 3300049744 Bacteria 3790
388 Ga0501280_004160 3300049776 Bacteria 2147
389 Ga0501044_0003348 3300049823 Bacteria 18071
390 Ga0501044_0028532 3300049823 Bacteria 5891
391 Ga0501044_0061379 3300049823 Bacteria 3846
392 Ga0501044_0076052 3300049823 Bacteria 3409
393 Ga0501044_0187031 3300049823 Unclassified 2035
394 Ga0501284_00021 3300050005 Bacteria 89729
395 nmdc:mga0k408_4623_c1 3300050493 Bacteria 7296
396 nmdc:mga0k408_73383_c1 3300050493 Bacteria 1998
397 nmdc:mga0k408_92227_c1 3300050493 Bacteria 1780
398 nmdc:mga09592_161786_c1 3300050508 Unclassified 1934
399 Ga0500578_0001147 3300053086 Bacteria 28253
400 Ga0500644_0000119 3300053088 Bacteria 49309
401 Ga0500644_0005525 3300053088 Bacteria 3196
402 Ga0500646_0000342 3300053090 Bacteria 14036
403 Ga0500646_0003291 3300053090 Bacteria 4150
404 Ga0500646_0011677 3300053090 Unclassified 2261
405 Ga0500583_0000108 3300053092 Bacteria 41760
406 Ga0500641_0044664 3300053096 Bacteria 1802
407 Ga0500562_000138 3300053108 Bacteria 21490
408 Ga0500577_0002302 3300053142 Bacteria 4865
409 Ga0500622_0000929 3300053156 Bacteria 24916
410 Ga0500622_0002384 3300053156 Bacteria 13622
411 Ga0500622_0002452 3300053156 Bacteria 13375
412 Ga0500636_0001575 3300053177 Bacteria 12413
413 Ga0500645_005922 3300053730 Bacteria 4430
414 Ga0501084_0107020 3300054114 Bacteria 2349
415 Ga0500661_004058 3300055283 Bacteria 2738
416 Ga0501082_0044963 3300060353 Bacteria 3808
417 Ga0466962_0096826 3300061719 Bacteria 1415
418 2738726364 2738541278 Bacteria 9755573
419 2819573742 2818991442 Bacteria 8318214
420 2819590759 2818991444 Bacteria 6968812
421 2819680761 2818991460 Bacteria 7595395
422 2821137076 2821136567 Bacteria 8080116
423 2883072702 2883068021 Bacteria 6192739
424 2884795508 2884791551 Bacteria 8511252
425 2896087864 2896085136 Bacteria 6129793
426 2896112413 2896109856 Bacteria 7140722
427 2904468182 2904467357 Bacteria 8057758
428 2929157782 2929154850 Bacteria 6753285
429 2929178917 2929177148 Bacteria 7883697
430 2929241356 2929239360 Bacteria 7745570
431 2929923370 2929921140 Bacteria 8649150
432 2945981322 2945977869 Bacteria 7777518
433 2946019277 2946013367 Bacteria 7766675
434 8003152240 8003151029 Bacteria 8187759
435 Ga0105239_10022435
436 JGI24740J21852_10005073
437 JGI24739J22299_10004842
438 JGI25154J39366_1000007
439 JGI25153J46596_10002043
440 JGI25153J46596_10014510
441 rootH2_10129754
442 rootH2_10168824
443 rootL2_10026791
444 rootL2_10026792
445 rootL2_10040257
446 rootL2_10221152
447 rootH1_10000019
448 rootH1_10103763
449 rootH1_10104246
450 rootH1_10318491
451 rootH1_10321485
452 JGI25160J50197_1000745
453 JGI25160J50197_1007043
454 Ga0055535_1002298
455 Ga0055542_1010567
456 Ga0055528_1001519
457 Ga0055530_10006732
458 Ga0055531_10000020
459 Ga0065165_1000010
460 Ga0065165_1013843
461 Ga0070658_10064430
462 Ga0070658_10154188
463 Ga0070676_10035216
464 Ga0070683_100011868
465 Ga0070683_100026191
466 Ga0070683_100146208
467 Ga0070690_100024767
468 Ga0070670_100043770
469 Ga0070677_10050930
470 Ga0068869_100006827
471 Ga0068869_100013130
472 Ga0070666_10000833
473 Ga0070666_10003710
474 Ga0070666_10005940
475 Ga0070680_100056802
476 Ga0070682_100000173
477 Ga0070682_100006926
478 Ga0068868_100010161
479 Ga0068868_100011608
480 Ga0068868_100045052
481 Ga0070660_100012793
482 Ga0070689_100068546
483 Ga0070691_10024793
484 Ga0070687_100002130
485 Ga0070661_100003273
486 Ga0070668_100000043
487 Ga0070675_100021470
488 Ga0070675_100095286
489 Ga0070671_100070074
490 Ga0070671_100092071
491 Ga0070673_100003480
492 Ga0070673_100019594
493 Ga0070673_100345670
494 Ga0070688_100143944
495 Ga0070667_100000254
496 Ga0070667_100017602
497 Ga0070667_100131364
498 Ga0070662_100002089
499 Ga0070662_100007119
500 Ga0070681_10075464
501 Ga0068867_100014081
502 Ga0068867_100017634
503 Ga0070685_10022806
504 Ga0070679_100003920
505 Ga0070679_100039551
506 Ga0070684_100003498
507 Ga0070684_100043118
508 Ga0068853_100025782
509 Ga0068853_100051908
510 Ga0070672_100004549
511 Ga0070672_100007506
512 Ga0070686_100022729
513 Ga0070693_100002584
514 Ga0070665_100000350
515 Ga0068855_100013922
516 Ga0068855_100014782
517 Ga0068855_100033470
518 Ga0070664_100004097
519 Ga0070664_100005960
520 Ga0070664_100017133
521 Ga0070664_100023769
522 Ga0068857_100000416
523 Ga0068857_100092720
524 Ga0068854_100042048
525 Ga0068856_100010342
526 Ga0068856_100016424
527 Ga0068856_100059468
528 Ga0068852_100003650
529 Ga0068852_100177994
530 Ga0068859_100000227
531 Ga0068859_100001471
532 Ga0068859_100080214
533 Ga0068864_100001192
534 Ga0068861_100048044
535 Ga0068851_10012344
536 Ga0068863_100003656
537 Ga0068863_100026992
538 Ga0068863_100055849
539 Ga0068858_100000199
540 Ga0068858_100003030
541 Ga0068860_100003203
542 Ga0068860_100004214
543 Ga0068860_100010759
544 Ga0068860_100023461
545 Ga0068860_100070685
546 Ga0081539_10000037
547 Ga0075366_10034768
548 Ga0097621_100000063
549 Ga0097621_100003359
550 Ga0097621_100016337
551 Ga0097621_100082976
552 Ga0068871_100000952
553 Ga0068871_100002768
554 Ga0068871_100007723
555 Ga0068871_100021180
556 Ga0075429_100059332
557 Ga0097620_100000227
558 Ga0097620_100001471
559 Ga0097620_100019949
560 Ga0097620_100080207
561 Ga0105240_10032774
562 Ga0105240_10045255
563 Ga0105240_10074365
564 Ga0111539_10043454
565 Ga0111539_10081953
566 Ga0105245_10065487
567 Ga0105247_10001601
568 Ga0105243_10014910
569 Ga0105241_10000674
570 Ga0105241_10027376
571 Ga0105242_10098670
572 Ga0105242_10153648
573 Ga0105248_10009934
574 Ga0105248_10019350
575 Ga0105237_10002860
576 Ga0105237_10005745
577 Ga0105237_10030881
578 Ga0105237_10112805
579 Ga0105237_10193627
580 Ga0105238_10032861
581 Ga0105249_10008538
582 Ga0105249_10024983
583 Ga0105249_10025237
584 Ga0105249_10042775
585 Ga0105239_10001973
586 Ga0105239_10006841
587 Ga0105239_10082566
588 Ga0105246_10027738
589 Ga0157373_10007968
590 Ga0157371_10069224
591 Ga0157370_10015864
592 Ga0157370_10044808
593 Ga0157370_10058913
594 Ga0157369_10039596
595 Ga0157369_10103758
596 Ga0157369_10133705
597 Ga0157369_10189812
598 Ga0157369_10274654
599 Ga0157374_10000084
600 Ga0157374_10013214
601 Ga0157374_10056710
602 Ga0157378_10004836
603 Ga0157378_10005892
604 Ga0157378_10008288
605 Ga0157378_10043377
606 Ga0157378_10073339
607 Ga0157378_10155737
608 Ga0163162_10000113
609 Ga0163162_10000158
610 Ga0163162_10000524
611 Ga0163162_10001702
612 Ga0163162_10001883
613 Ga0163162_10003737
614 Ga0163162_10157667
615 Ga0163162_10360571
616 Ga0157372_10002055
617 Ga0157372_10059213
618 Ga0157372_10093628
619 Ga0157372_10118046
620 Ga0157372_10147301
621 Ga0157372_10188579
622 Ga0157375_10000228
623 Ga0157375_10000565
624 Ga0163163_10000332
625 Ga0163163_10099452
626 Ga0163163_10121704
627 Ga0157377_10037121
628 Ga0157377_10096416
629 Ga0157379_10000245
630 Ga0157379_10046499
631 Ga0157379_10049824
632 Ga0157376_10000439
633 Ga0157376_10067094
634 Ga0157376_10208451
635 Ga0182005_1000450
636 Ga0163161_10002605
637 Ga0163161_10017161
638 Ga0213876_10016529
639 Ga0213876_10088856
640 Ga0209436_102616
641 Ga0209436_108599
642 Ga0209258_100293
643 Ga0209646_1000002
644 Ga0209646_1001787
645 Ga0209026_1000524
646 Ga0209148_1000278
647 Ga0209673_1000530
648 Ga0209130_1002093
649 Ga0209564_1008430
650 Ga0209758_1007117
651 Ga0209758_1013883
652 Ga0209050_1000134
653 Ga0207426_1000002
654 Ga0207426_1000051
655 Ga0207426_1000841
656 Ga0207426_1001206
657 Ga0207426_1013534
658 Ga0209257_1000001
659 Ga0209257_1001323
660 Ga0207656_10011356
661 Ga0207710_10006910
662 Ga0207680_10000939
663 Ga0207647_10000418
664 Ga0207645_10000378
665 Ga0207705_10000717
666 Ga0207705_10109398
667 Ga0207705_10132119
668 Ga0207654_10007301
669 Ga0207654_10019431
670 Ga0207707_10042937
671 Ga0207695_10035293
672 Ga0207671_10003626
673 Ga0207671_10124901
674 Ga0207660_10012932
675 Ga0207657_10006443
676 Ga0207657_10077406
677 Ga0207652_10000986
678 Ga0207694_10010268
679 Ga0207650_10023539
680 Ga0207659_10011462
681 Ga0207659_10132734
682 Ga0207687_10021107
683 Ga0207644_10018411
684 Ga0207644_10032097
685 Ga0207690_10029876
686 Ga0207706_10010506
687 Ga0207686_10108172
688 Ga0207691_10000227
689 Ga0207691_10002263
690 Ga0207691_10019151
691 Ga0207689_10002228
692 Ga0207689_10016253
693 Ga0207689_10034261
694 Ga0207661_10022254
695 Ga0207661_10037017
696 Ga0207679_10003549
697 Ga0207679_10041082
698 Ga0207679_10058462
699 Ga0207667_10000135
700 Ga0207667_10218190
701 Ga0207651_10001541
702 Ga0207712_10007643
703 Ga0207712_10046980
704 Ga0207712_10059269
705 Ga0207668_10000679
706 Ga0207640_10014080
707 Ga0207658_10000176
708 Ga0207658_10162189
709 Ga0207677_10006136
710 Ga0207677_10010354
711 Ga0207677_10022177
712 Ga0207677_10036299
713 Ga0207703_10000433
714 Ga0207703_10016940
715 Ga0207703_10085453
716 Ga0207639_10022784
717 Ga0207678_10049899
718 Ga0207678_10073566
719 Ga0207702_10009327
720 Ga0207702_10213867
721 Ga0207641_10001151
722 Ga0207641_10002208
723 Ga0207648_10003768
724 Ga0207648_10013016
725 Ga0207648_10031274
726 Ga0207648_10059714
727 Ga0207648_10080462
728 Ga0207648_10120700
729 Ga0207676_10001240
730 Ga0207676_10163688
731 Ga0207674_10002454
732 Ga0207674_10004100
733 Ga0207675_100074499
734 Ga0207683_10050506
735 Ga0207698_10007891
736 Ga0207698_10094394
737 Ga0207698_10245536
738 Ga0268266_10003258
739 Ga0268264_10003175
740 Ga0268264_10003379
741 Ga0268264_10007560
742 Ga0268264_10046986
743 Ga0307515_10000002
744 Ga0265327_10000168
745 Ga0265327_10000531
746 Ga0307509_10044077
747 Ga0307509_10148777
748 Ga0307408_100002354
749 Ga0307508_10000923
750 Ga0307413_10060616
751 Ga0307416_100392119
752 Ga0307415_100063855
753 Ga0373955_0025758
754 Ga0395900_0140899
755 Ga0395900_0318255
756 Ga0395900_0323165
757 Ga0395905_0002545
758 Ga0395905_0078545
759 Ga0395905_0177048
760 Ga0395901_0195567
761 Ga0436365_0343949
762 Ga0436365_0646455
763 Ga0451791_0654002
764 Ga0439431_0000931
765 Ga0439457_000560
766 Ga0439457_005859
767 Ga0439462_0016339
768 Ga0439462_0021891
769 Ga0451577_0082284
770 Ga0466972_0000003
771 Ga0466972_0000013
772 Ga0466966_0000045
773 Ga0453684_0227410
774 Ga0466970_0000561
775 Ga0466957_0000070
776 Ga0466957_0021182
777 Ga0466959_0000023
778 Ga0466959_0024780
779 Ga0495638_0047392
780 Ga0495580_0009622
781 Ga0495648_0004547
782 Ga0495633_0000090
783 Ga0495633_0037814
784 Ga0495668_0003561
785 Ga0495686_0000616
786 Ga0496101_0219762
787 Ga0496108_0213864
788 Ga0496109_0038819
789 Ga0496115_0140460
790 Ga0496121_0000020
791 Ga0496124_0055008
792 Ga0496126_0006540
793 Ga0501298_000128
794 Ga0501031_0117082
795 Ga0501033_0049182
796 Ga0501034_0023947
797 Ga0501034_0080598
798 Ga0501034_0129119
799 Ga0501034_0263734
800 Ga0501036_0012338
801 Ga0501038_0041100
802 Ga0501039_0055924
803 Ga0501043_0042858
804 Ga0501043_0059618
805 Ga0501047_0027022
806 Ga0501047_0120128
807 Ga0501071_0093775
808 Ga0501073_0012434
809 Ga0501207_005035
810 Ga0501223_000493
811 Ga0501224_007905
812 Ga0501242_005289
813 Ga0501259_000401
814 Ga0501261_003057
815 Ga0501219_000027
816 Ga0501221_006106
817 Ga0501221_007938
818 Ga0501225_0000367
819 Ga0501225_0000846
820 Ga0501083_0029262
821 Ga0501280_004160
822 Ga0501044_0003348
823 Ga0501044_0028532
824 Ga0501044_0061379
825 Ga0501044_0076052
826 Ga0501044_0187031
827 Ga0501284_00021
828 nmdc:mga0k408_4623_c1
829 nmdc:mga0k408_73383_c1
830 nmdc:mga0k408_92227_c1
831 nmdc:mga09592_161786_c1
832 Ga0500578_0001147
833 Ga0500644_0000119
834 Ga0500644_0005525
835 Ga0500646_0000342
836 Ga0500646_0003291
837 Ga0500646_0011677
838 Ga0500583_0000108
839 Ga0500641_0044664
840 Ga0500562_000138
841 Ga0500577_0002302
842 Ga0500622_0000929
843 Ga0500622_0002384
844 Ga0500622_0002452
845 Ga0500636_0001575
846 Ga0500645_005922
847 Ga0501084_0107020
848 Ga0500661_004058
849 Ga0501082_0044963
850 Ga0466962_0096826
851 2738726364
852 2819573742
853 2819590759
854 2819680761
855 2821137076
856 2883072702
857 2884795508
858 2896087864
859 2896112413
860 2904468182
861 2929157782
862 2929178917
863 2929241356
864 2929923370
865 2945981322
866 2946019277
867 8003152240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

35

444

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tm4-assembly1.cif.gz_A crystal structure of apo 3-phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae 0.9431 1 412
3nvs-assembly1.cif.gz_A 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1-carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate 0.934 1 412
2qfu-assembly1.cif.gz_A e.coli epsp synthase pro101leu liganded with s3p and glyphosate 0.927 1 412
1q36-assembly1.cif.gz_A epsp synthase (asp313ala) liganded with tetrahedral reaction intermediate 0.927 1 412
2qft-assembly1.cif.gz_A e.coli epsp synthase pro101ser liganded with s3p and glyphosate 0.9269 1 412
ID Description Score Start End Superfamily
af_Q4CN54_125_192_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 1.012 60 72 3.30.1360.40
1g6sA01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9418 231 412 3.65.10.10
af_Q57925_221_429_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.94 219 419 3.65.10.10
af_Q57925_21_220_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9291 19 209 3.65.10.10
af_P9WPY5_236_421_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.926 228 407 1.20.200.10
ID Description Score Start End GO Terms
AF-A0A836SVB6-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) 0.9742 11 415 GO:0003866
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A7V4LWF8-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9711 237 412 GO:0003866
GO:0009423
AF-A0A1V5C1B1-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) 0.9685 126 412 GO:0003866
GO:0009423
AF-A0A4Q5Y5S5-F1-model_v4 deleted 0.9665 4 286
AF-A0A836SVB6-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) 0.9648 11 415 GO:0003866
GO:0005737
GO:0008652
GO:0009073
GO:0009423

Map