F442839

General Info

Members Datasets Scaffolds Average Seq Length
433 239 398 200

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10336432|Ga0157372_103364322
Length 226
Sequence VASKTTSSRAWWPDLRLHPIHRKVFPVPHYLYLVRHGEQQDAEHGLPDGPLSPRGKRQAQLIADRLSGLPLTGMYQSPLIRAEETASIIAERMPAVVPEPSSLLFDCIPSGPTPDMPKAFESFFGPVTEAEIDAGRAQMEDAIHEFLTPAMGDRHDLLVTHNFVIGWFVRHVFDAPAWRWLGLNQANCGLTIIRVRSAKPPVLVVHNDLGHLPVELRTGLPELQPV

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221616 Leifsonia sp. Root227 Isolate Unclassified
4 2643221619 Agromyces sp. Root81 Isolate Unclassified
5 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
6 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
7 2643221649 Leifsonia sp. Root4 Isolate Unclassified
8 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
9 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
10 2808606372 Agromyces sp. 23-23 Isolate Unclassified
11 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
12 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
13 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
14 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
15 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
16 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
17 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
18 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
19 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
20 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
21 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
22 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
23 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
24 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
25 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
26 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
27 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
28 2928153084 Leifsonia sp. 563 Isolate Unclassified
29 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
30 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
31 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
32 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
33 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
34 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
37 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
38 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
45 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
46 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
139 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.22
Metatranscriptomes 0.69
Isolates 8.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 15.01
Nodule 0
Rhizoplane 4.16
Rhizosphere 66.28
Stem 0
Stem Tuber 0.23
Unclassified 14.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10047493 3300001989 Bacteria 1400
2 JGI24737J22298_10066996 3300001990 Bacteria 1075
3 JGI24735J21928_10011902 3300002067 Bacteria 2753
4 JGI25164J39214_1000600 3300002772 Bacteria 15761
5 JGI25165J46597_1000004 3300003214 Bacteria 667510
6 rootH1_10176061 3300003323 Bacteria 1788
7 Ga0006562J51391_1031577 3300003578 Bacteria 4000
8 Ga0006562J51391_1031578 3300003578 Bacteria 3150
9 Ga0055539_1000005 3300003752 Bacteria 609598
10 Ga0055539_1002589 3300003752 Bacteria 2712
11 Ga0055533_1000001 3300003756 Bacteria 1863437
12 Ga0055525_1001086 3300003759 Bacteria 6803
13 Ga0055527_1000001 3300003760 Bacteria 850044
14 Ga0055529_1000019 3300003763 Bacteria 332786
15 Ga0070658_10001729 3300005327 Bacteria 18416
16 Ga0070658_10052316 3300005327 Bacteria 3312
17 Ga0070658_10095590 3300005327 Bacteria 2453
18 Ga0070658_10476295 3300005327 Bacteria 1077
19 Ga0070666_10134066 3300005335 Bacteria 1722
20 Ga0070682_100232953 3300005337 Bacteria 1317
21 Ga0068868_100035112 3300005338 Bacteria 3874
22 Ga0068868_100114554 3300005338 Bacteria 2194
23 Ga0070660_100224197 3300005339 Bacteria 1528
24 Ga0070661_100067913 3300005344 Bacteria 2620
25 Ga0070659_100021518 3300005366 Bacteria 4912
26 Ga0070659_100408778 3300005366 Bacteria 1147
27 Ga0070667_100352856 3300005367 Bacteria 1332
28 Ga0070714_100225882 3300005435 Bacteria 1723
29 Ga0070663_100258406 3300005455 Bacteria 1381
30 Ga0070678_100050802 3300005456 Bacteria 3002
31 Ga0068853_100125362 3300005539 Bacteria 2294
32 Ga0070672_100088082 3300005543 Bacteria 2499
33 Ga0070672_100458744 3300005543 Bacteria 1098
34 Ga0068855_100011698 3300005563 Bacteria 10605
35 Ga0068855_100579736 3300005563 Bacteria 1212
36 Ga0068857_100005680 3300005577 Bacteria 10664
37 Ga0068857_100623576 3300005577 Bacteria 1020
38 Ga0068852_100125961 3300005616 Bacteria 2352
39 Ga0068852_100188210 3300005616 Bacteria 1946
40 Ga0068852_100346462 3300005616 Bacteria 1449
41 Ga0068859_100019120 3300005617 Bacteria 6880
42 Ga0068864_100120025 3300005618 Bacteria 2350
43 Ga0068861_100054222 3300005719 Bacteria 3053
44 Ga0068851_10000005 3300005834 Bacteria 262808
45 Ga0068858_100000175 3300005842 Bacteria 68239
46 Ga0068862_100084260 3300005844 Bacteria 2761
47 Ga0075365_10049048 3300006038 Bacteria 2781
48 Ga0075364_10026288 3300006051 Bacteria 3712
49 Ga0075369_10008347 3300006186 Bacteria 3981
50 Ga0097620_100019120 3300006931 Bacteria 6880
51 Ga0105240_10035693 3300009093 Bacteria 6405
52 Ga0105240_11022853 3300009093 Bacteria 883
53 Ga0111539_11249813 3300009094 Bacteria 862
54 Ga0105245_10072293 3300009098 Bacteria 3133
55 Ga0105245_10091756 3300009098 Bacteria 2796
56 Ga0105245_11332596 3300009098 Bacteria 767
57 Ga0105243_10080095 3300009148 Bacteria 2663
58 Ga0105241_10008755 3300009174 Bacteria 7437
59 Ga0105248_10005622 3300009177 Bacteria 13764
60 Ga0105237_10001010 3300009545 Bacteria 37871
61 Ga0105237_10064476 3300009545 Bacteria 3660
62 Ga0105237_10113413 3300009545 Bacteria 2703
63 Ga0105237_10485871 3300009545 Bacteria 1241
64 Ga0105237_11614875 3300009545 Bacteria 655
65 Ga0105238_10024726 3300009551 Bacteria 6122
66 Ga0105239_10170216 3300010375 Bacteria 2435
67 Ga0105246_10128971 3300011119 Bacteria 1886
68 Ga0105246_10228631 3300011119 Bacteria 1463
69 Ga0157370_10002575 3300013104 Bacteria 21765
70 Ga0157369_10009560 3300013105 Bacteria 11091
71 Ga0157369_10166697 3300013105 Bacteria 2323
72 Ga0157369_10266136 3300013105 Bacteria 1787
73 Ga0157369_10830122 3300013105 Bacteria 949
74 Ga0157369_11295075 3300013105 Bacteria 743
75 Ga0157374_10528408 3300013296 Bacteria 1186
76 Ga0163162_10563575 3300013306 Bacteria 1267
77 Ga0163162_11524103 3300013306 Bacteria 762
78 Ga0157372_10336432 3300013307 Bacteria 1758
79 Ga0157372_11101893 3300013307 Bacteria 919
80 Ga0157372_11322397 3300013307 Bacteria 832
81 Ga0157375_10439116 3300013308 Bacteria 1471
82 Ga0163163_10029559 3300014325 Bacteria 5273
83 Ga0163163_11253633 3300014325 Bacteria 804
84 Ga0157380_10002059 3300014326 Bacteria 13457
85 Ga0157380_11801308 3300014326 Bacteria 671
86 Ga0157377_10594129 3300014745 Bacteria 788
87 Ga0157379_10003650 3300014968 Bacteria 13068
88 Ga0206353_10984193 3300020082 Bacteria 2007
89 Ga0209566_100105 3300025225 Bacteria 125766
90 Ga0209674_100001 3300025226 Bacteria 4013750
91 Ga0209672_100006 3300025228 Bacteria 1004497
92 Ga0209147_100371 3300025229 Bacteria 31631
93 Ga0209563_100001 3300025230 Bacteria 4013775
94 Ga0209563_101025 3300025230 Bacteria 8134
95 Ga0207427_100010 3300025231 Bacteria 648610
96 Ga0209437_100658 3300025233 Bacteria 19538
97 Ga0209258_102537 3300025242 Bacteria 4604
98 Ga0209677_100001 3300025253 Bacteria 4013787
99 Ga0209677_100539 3300025253 Bacteria 21049
100 Ga0209148_1000015 3300025254 Bacteria 850103
101 Ga0209148_1002758 3300025254 Bacteria 5545
102 Ga0209233_1000001 3300025261 Bacteria 2992747
103 Ga0209455_1000013 3300025272 Bacteria 850103
104 Ga0209455_1007202 3300025272 Bacteria 3173
105 Ga0207656_10000001 3300025321 Bacteria 1323684
106 Ga0207656_10000003 3300025321 Bacteria 771644
107 Ga0207656_10000004 3300025321 Bacteria 632320
108 Ga0207647_10268544 3300025904 Bacteria 975
109 Ga0207647_10341159 3300025904 Bacteria 849
110 Ga0207645_10314356 3300025907 Bacteria 1044
111 Ga0207705_10000001 3300025909 Bacteria 2061880
112 Ga0207705_10061647 3300025909 Bacteria 2709
113 Ga0207705_10070350 3300025909 Bacteria 2536
114 Ga0207654_10000003 3300025911 Bacteria 1030378
115 Ga0207695_10015155 3300025913 Bacteria 9090
116 Ga0207695_10021140 3300025913 Bacteria 7433
117 Ga0207671_10000001 3300025914 Bacteria 1318881
118 Ga0207671_10072389 3300025914 Bacteria 2572
119 Ga0207657_10202629 3300025919 Bacteria 1595
120 Ga0207649_10086040 3300025920 Bacteria 2047
121 Ga0207694_10000039 3300025924 Bacteria 186164
122 Ga0207690_10076180 3300025932 Bacteria 2328
123 Ga0207690_10426113 3300025932 Bacteria 1062
124 Ga0207709_10261863 3300025935 Bacteria 1268
125 Ga0207691_10104296 3300025940 Bacteria 2527
126 Ga0207711_10003156 3300025941 Bacteria 14362
127 Ga0207667_10032513 3300025949 Bacteria 5620
128 Ga0207667_10040046 3300025949 Bacteria 4989
129 Ga0207667_10100338 3300025949 Bacteria 2986
130 Ga0207667_10513957 3300025949 Bacteria 1214
131 Ga0207668_10228609 3300025972 Bacteria 1498
132 Ga0207658_10098174 3300025986 Bacteria 2288
133 Ga0207677_10058865 3300026023 Bacteria 2648
134 Ga0207703_10000131 3300026035 Bacteria 90186
135 Ga0207639_10074755 3300026041 Bacteria 2662
136 Ga0207678_10044714 3300026067 Bacteria 3830
137 Ga0207678_10240472 3300026067 Bacteria 1550
138 Ga0207708_10334978 3300026075 Bacteria 1238
139 Ga0207702_10118395 3300026078 Bacteria 2366
140 Ga0207702_10373948 3300026078 Bacteria 1369
141 Ga0207641_10406958 3300026088 Bacteria 1307
142 Ga0207648_11166912 3300026089 Bacteria 723
143 Ga0207676_10210326 3300026095 Bacteria 1725
144 Ga0207674_10012602 3300026116 Bacteria 9450
145 Ga0207674_10611343 3300026116 Bacteria 1053
146 Ga0207675_100089835 3300026118 Bacteria 2887
147 Ga0207683_10082856 3300026121 Bacteria 2850
148 Ga0207698_10013768 3300026142 Bacteria 5351
149 Ga0207698_10185242 3300026142 Bacteria 1848
150 Ga0307515_10089742 3300028794 Bacteria 3865
151 Ga0307513_10345704 3300031456 Bacteria 1237
152 Ga0307514_10003146 3300031649 Bacteria 16203
153 Ga0307514_10033244 3300031649 Bacteria 4117
154 Ga0307518_10245684 3300031838 Bacteria 1143
155 Ga0307412_10412298 3300031911 Bacteria 1103
156 Ga0307416_101003092 3300032002 Bacteria 938
157 Ga0307416_102000484 3300032002 Bacteria 682
158 Ga0307414_10427246 3300032004 Bacteria 1157
159 Ga0307415_100997058 3300032126 Bacteria 778
160 Ga0373925_0600019 3300037068 Bacteria 907
161 Ga0395899_0002778 3300037312 Bacteria 14112
162 Ga0395899_0099065 3300037312 Bacteria 2106
163 Ga0395900_0007901 3300037418 Bacteria 10957
164 Ga0395898_0000015 3300037466 Bacteria 439819
165 Ga0395898_0449037 3300037466 Bacteria 1228
166 Ga0400483_069774 3300039062 Bacteria 1694
167 Ga0400483_130135 3300039062 Bacteria 1561
168 Ga0400483_149816 3300039062 Bacteria 1796
169 Ga0439465_0117353 3300041413 Bacteria 931
170 Ga0451853_2559915 3300041512 Bacteria 1102
171 Ga0466972_0012238 3300044658 Bacteria 4314
172 Ga0466972_0217326 3300044658 Bacteria 894
173 Ga0466965_0000002 3300044683 Bacteria 297957
174 Ga0466965_0019128 3300044683 Bacteria 3288
175 Ga0466965_0022612 3300044683 Bacteria 3031
176 Ga0466965_0299550 3300044683 Bacteria 872
177 Ga0466966_0064353 3300044684 Bacteria 2309
178 Ga0466966_0103075 3300044684 Bacteria 1763
179 Ga0466961_0123510 3300044693 Bacteria 1624
180 Ga0466963_0624546 3300044694 Bacteria 761
181 Ga0466971_0007332 3300044719 Bacteria 4800
182 Ga0466968_0052869 3300044735 Bacteria 1739
183 Ga0466970_0013910 3300044765 Bacteria 4128
184 Ga0466970_0117241 3300044765 Bacteria 1456
185 Ga0466970_0250847 3300044765 Bacteria 991
186 Ga0466957_0111784 3300044842 Bacteria 1733
187 Ga0466957_0134081 3300044842 Bacteria 1590
188 Ga0466960_0049133 3300044901 Bacteria 2029
189 Ga0466959_0101578 3300045049 Bacteria 2058
190 Ga0466959_0426812 3300045049 Bacteria 899
191 Ga0466958_0345528 3300045836 Bacteria 957
192 Ga0495590_0004949 3300046457 Bacteria 5320
193 Ga0495638_0157567 3300046460 Bacteria 1312
194 Ga0495650_0000873 3300046471 Bacteria 35836
195 Ga0495664_0144918 3300046477 Bacteria 1440
196 Ga0495618_0042507 3300046514 Bacteria 2865
197 Ga0495586_0028573 3300046535 Bacteria 2984
198 Ga0495609_0061561 3300046538 Bacteria 1658
199 Ga0495645_0080480 3300046543 Bacteria 2338
200 Ga0495656_0005159 3300046615 Bacteria 4504
201 Ga0495634_0218819 3300046642 Bacteria 1176
202 Ga0495599_0061944 3300046678 Bacteria 2337
203 Ga0495674_0065742 3300047319 Bacteria 3149
204 Ga0495672_0054032 3300047320 Bacteria 2350
205 Ga0495626_0012549 3300048091 Bacteria 4437
206 Ga0496100_0035663 3300048903 Bacteria 3130
207 Ga0496100_0165781 3300048903 Bacteria 1587
208 Ga0496101_0459592 3300048904 Bacteria 1004
209 Ga0496102_0128917 3300048905 Bacteria 2366
210 Ga0496102_0509108 3300048905 Bacteria 1126
211 Ga0496102_0566303 3300048905 Bacteria 1059
212 Ga0496103_0153226 3300048906 Bacteria 1477
213 Ga0496104_0201905 3300048907 Bacteria 1900
214 Ga0496105_0059002 3300048908 Bacteria 3166
215 Ga0496105_0123532 3300048908 Bacteria 2134
216 Ga0496105_0140979 3300048908 Bacteria 1984
217 Ga0496105_0681135 3300048908 Bacteria 791
218 Ga0496107_0013327 3300048910 Bacteria 5745
219 Ga0496114_0085011 3300048917 Bacteria 2679
220 Ga0496114_0144652 3300048917 Bacteria 2060
221 Ga0496115_0189853 3300048918 Bacteria 1697
222 Ga0496115_0253310 3300048918 Bacteria 1449
223 Ga0496115_0331363 3300048918 Bacteria 1243
224 Ga0496116_0111666 3300048919 Bacteria 1605
225 Ga0496116_0289736 3300048919 Bacteria 787
226 Ga0496117_0015618 3300048920 Bacteria 6456
227 Ga0496117_0032362 3300048920 Bacteria 3974
228 Ga0496117_0060182 3300048920 Bacteria 2619
229 Ga0496117_0085633 3300048920 Bacteria 2050
230 Ga0496117_0086516 3300048920 Bacteria 2036
231 Ga0496117_0303927 3300048920 Bacteria 843
232 Ga0496118_0002810 3300048921 Bacteria 22808
233 Ga0496118_0023123 3300048921 Bacteria 5410
234 Ga0496118_0039258 3300048921 Bacteria 3780
235 Ga0496118_0240784 3300048921 Bacteria 1036
236 Ga0496118_0364016 3300048921 Bacteria 765
237 Ga0496119_0003638 3300048922 Bacteria 15826
238 Ga0496119_0004413 3300048922 Bacteria 14021
239 Ga0496119_0026541 3300048922 Bacteria 4013
240 Ga0496119_0059299 3300048922 Bacteria 2300
241 Ga0496119_0282686 3300048922 Bacteria 824
242 Ga0496120_0002082 3300048923 Bacteria 21468
243 Ga0496120_0071584 3300048923 Bacteria 1903
244 Ga0496121_0000076 3300048924 Bacteria 239775
245 Ga0496121_0123090 3300048924 Bacteria 1955
246 Ga0496122_0007675 3300048925 Bacteria 11893
247 Ga0496122_0139285 3300048925 Bacteria 1521
248 Ga0496123_0001428 3300048926 Bacteria 33368
249 Ga0496123_0087097 3300048926 Bacteria 1870
250 Ga0496124_0000256 3300048927 Bacteria 102144
251 Ga0496124_0010890 3300048927 Bacteria 9150
252 Ga0496124_0339930 3300048927 Bacteria 1066
253 Ga0496125_0188701 3300048928 Bacteria 1364
254 Ga0496125_0343842 3300048928 Bacteria 894
255 Ga0496126_0004114 3300048929 Bacteria 17604
256 Ga0496126_0014431 3300048929 Bacteria 7987
257 Ga0496126_0211895 3300048929 Bacteria 1631
258 Ga0501031_0006467 3300049568 Bacteria 7639
259 Ga0501031_0114527 3300049568 Bacteria 1761
260 Ga0501031_0150770 3300049568 Bacteria 1519
261 Ga0501032_0002581 3300049569 Bacteria 14170
262 Ga0501032_0010577 3300049569 Bacteria 6653
263 Ga0501032_0082096 3300049569 Bacteria 2144
264 Ga0501032_0495145 3300049569 Bacteria 781
265 Ga0501032_0553165 3300049569 Bacteria 733
266 Ga0501033_0002291 3300049570 Bacteria 16370
267 Ga0501033_0005565 3300049570 Bacteria 9965
268 Ga0501033_0054644 3300049570 Bacteria 2953
269 Ga0501033_0075189 3300049570 Bacteria 2479
270 Ga0501033_0145267 3300049570 Bacteria 1713
271 Ga0501034_0005943 3300049571 Bacteria 13222
272 Ga0501034_0007872 3300049571 Bacteria 11326
273 Ga0501034_0018283 3300049571 Bacteria 7189
274 Ga0501034_0033782 3300049571 Bacteria 5185
275 Ga0501034_0040064 3300049571 Bacteria 4744
276 Ga0501034_0048120 3300049571 Bacteria 4303
277 Ga0501034_0067567 3300049571 Bacteria 3586
278 Ga0501034_0085318 3300049571 Bacteria 3159
279 Ga0501034_0155677 3300049571 Bacteria 2259
280 Ga0501034_0280088 3300049571 Bacteria 1607
281 Ga0501034_0302930 3300049571 Bacteria 1534
282 Ga0501036_0001034 3300049572 Bacteria 21006
283 Ga0501036_0098424 3300049572 Bacteria 2473
284 Ga0501036_0107114 3300049572 Bacteria 2363
285 Ga0501036_0172115 3300049572 Bacteria 1824
286 Ga0501036_0690615 3300049572 Bacteria 844
287 Ga0501037_0002690 3300049573 Bacteria 12832
288 Ga0501037_0021997 3300049573 Bacteria 4721
289 Ga0501037_0072063 3300049573 Bacteria 2513
290 Ga0501037_0081138 3300049573 Bacteria 2352
291 Ga0501037_0083795 3300049573 Bacteria 2310
292 Ga0501037_0195631 3300049573 Bacteria 1430
293 Ga0501037_0242034 3300049573 Bacteria 1264
294 Ga0501037_0509587 3300049573 Bacteria 815
295 Ga0501038_0019473 3300049574 Bacteria 6116
296 Ga0501038_0020979 3300049574 Bacteria 5869
297 Ga0501038_0032991 3300049574 Bacteria 4562
298 Ga0501038_0033460 3300049574 Bacteria 4528
299 Ga0501038_0621677 3300049574 Bacteria 815
300 Ga0501038_0832028 3300049574 Bacteria 684
301 Ga0501039_0001549 3300049575 Bacteria 16905
302 Ga0501039_0021786 3300049575 Bacteria 4915
303 Ga0501042_0203207 3300049578 Bacteria 1428
304 Ga0501043_0007164 3300049579 Bacteria 8865
305 Ga0501043_0013606 3300049579 Bacteria 6366
306 Ga0501043_0039776 3300049579 Bacteria 3696
307 Ga0501043_0064964 3300049579 Bacteria 2865
308 Ga0501043_0146414 3300049579 Bacteria 1849
309 Ga0501043_0278872 3300049579 Bacteria 1281
310 Ga0501046_0000566 3300049580 Bacteria 36605
311 Ga0501046_0008263 3300049580 Bacteria 9087
312 Ga0501046_0012085 3300049580 Bacteria 7361
313 Ga0501046_0212976 3300049580 Bacteria 1433
314 Ga0501047_0003895 3300049581 Bacteria 14029
315 Ga0501047_0011854 3300049581 Bacteria 8245
316 Ga0501047_0016477 3300049581 Bacteria 7055
317 Ga0501047_0019557 3300049581 Bacteria 6497
318 Ga0501047_0023519 3300049581 Bacteria 5913
319 Ga0501047_0027993 3300049581 Bacteria 5431
320 Ga0501047_0224796 3300049581 Bacteria 1732
321 Ga0501048_0011058 3300049582 Bacteria 6730
322 Ga0501048_0052857 3300049582 Bacteria 2891
323 Ga0501067_0200379 3300049583 Bacteria 1112
324 Ga0501067_0234172 3300049583 Bacteria 1022
325 Ga0501069_0297265 3300049585 Bacteria 946
326 Ga0501069_0412121 3300049585 Bacteria 800
327 Ga0501070_0000150 3300049586 Bacteria 64208
328 Ga0501070_0010703 3300049586 Bacteria 7756
329 Ga0501070_0027079 3300049586 Bacteria 4809
330 Ga0501070_0029242 3300049586 Bacteria 4622
331 Ga0501070_0063285 3300049586 Bacteria 3065
332 Ga0501070_0087186 3300049586 Bacteria 2584
333 Ga0501070_0147256 3300049586 Bacteria 1943
334 Ga0501071_0000061 3300049587 Bacteria 37719
335 Ga0501071_0074295 3300049587 Bacteria 2481
336 Ga0501073_0000024 3300049589 Bacteria 128851
337 Ga0501073_0012174 3300049589 Bacteria 6281
338 Ga0501073_0555910 3300049589 Bacteria 793
339 Ga0501074_0027194 3300049590 Bacteria 4147
340 Ga0501080_0000058 3300049742 Bacteria 72664
341 Ga0501080_0115450 3300049742 Bacteria 2489
342 Ga0501080_0192156 3300049742 Bacteria 1876
343 Ga0501035_0006879 3300049822 Bacteria 10623
344 Ga0501035_0014116 3300049822 Bacteria 7368
345 Ga0501035_0016545 3300049822 Bacteria 6799
346 Ga0501035_0016692 3300049822 Bacteria 6769
347 Ga0501035_0200947 3300049822 Bacteria 1709
348 Ga0501035_0406817 3300049822 Bacteria 1131
349 Ga0501044_0004430 3300049823 Bacteria 15712
350 Ga0501044_0007046 3300049823 Bacteria 12368
351 Ga0501044_0023641 3300049823 Bacteria 6534
352 Ga0501044_0065689 3300049823 Bacteria 3699
353 Ga0501044_0405291 3300049823 Bacteria 1275
354 Ga0501044_0505569 3300049823 Bacteria 1109
355 Ga0501044_0763378 3300049823 Bacteria 848
356 Ga0501045_0008191 3300049824 Bacteria 7280
357 Ga0501045_0078204 3300049824 Bacteria 2438
358 nmdc:mga00v17_18266_c2 3300050491 Bacteria 3090
359 nmdc:mga0yw44_59859_c1 3300050492 Bacteria 2331
360 nmdc:mga0sz30_18857_c1 3300050516 Bacteria 2765
361 nmdc:mga0sz30_206626_c1 3300050516 Bacteria 872
362 Ga0495612_0079955 3300053078 Bacteria 1373
363 Ga0500635_0000039 3300053080 Bacteria 93004
364 Ga0500643_000289 3300053087 Bacteria 43129
365 Ga0500651_0001911 3300053093 Bacteria 10752
366 Ga0500556_0000062 3300053104 Bacteria 110818
367 Ga0500556_0000343 3300053104 Bacteria 34743
368 Ga0500593_014198 3300053117 Bacteria 3411
369 Ga0500655_001768 3300053133 Bacteria 4047
370 Ga0500559_0001007 3300053136 Bacteria 17337
371 Ga0500559_0001783 3300053136 Bacteria 11822
372 Ga0500559_0003843 3300053136 Bacteria 7269
373 Ga0500559_0005333 3300053136 Bacteria 5926
374 Ga0500559_0028709 3300053136 Bacteria 2378
375 Ga0500559_0307280 3300053136 Bacteria 744
376 Ga0500568_0000060 3300053139 Bacteria 107901
377 Ga0500568_0000075 3300053139 Bacteria 94413
378 Ga0500568_0000151 3300053139 Bacteria 60575
379 Ga0500568_0009738 3300053139 Bacteria 4548
380 Ga0500568_0026019 3300053139 Bacteria 2460
381 Ga0500573_0000007 3300053140 Bacteria 272970
382 Ga0500573_0005735 3300053140 Bacteria 6659
383 Ga0500573_0007483 3300053140 Bacteria 5958
384 Ga0500573_0036894 3300053140 Bacteria 2823
385 Ga0500573_0053657 3300053140 Bacteria 2316
386 Ga0500573_0056195 3300053140 Bacteria 2259
387 Ga0500573_0082714 3300053140 Bacteria 1823
388 Ga0500573_0088800 3300053140 Bacteria 1748
389 Ga0500573_0097976 3300053140 Bacteria 1652
390 Ga0500573_0172415 3300053140 Bacteria 1169
391 Ga0500577_0002335 3300053142 Bacteria 4830
392 Ga0500577_0012524 3300053142 Bacteria 2567
393 Ga0500577_0035982 3300053142 Bacteria 1770
394 Ga0500590_018419 3300053148 Bacteria 3612
395 Ga0500616_0000156 3300053153 Bacteria 114514
396 Ga0500620_000023 3300053155 Bacteria 31007
397 Ga0501084_0133688 3300054114 Bacteria 2088
398 Ga0466962_0085515 3300061719 Bacteria 1510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0299550 Ga0466965_0299550_338_856 171
2 3300005618 Ga0068864_100120025 Ga0068864_1001200253 182
3 3300014745 Ga0157377_10594129 Ga0157377_105941291 182
4 3300039062 Ga0400483_069774 Ga0400483_069774_936_1553 183
5 3300039062 Ga0400483_130135 Ga0400483_130135_530_1105 183
6 3300039062 Ga0400483_149816 Ga0400483_149816_1038_1655 183
7 iso_pu_bacteria 2734482000 2734970897 184
8 3300048926 Ga0496123_0087097 Ga0496123_0087097_55_615 186
9 3300048929 Ga0496126_0004114 Ga0496126_0004114_7822_8406 194
10 3300037312 Ga0395899_0099065 Ga0395899_0099065_516_1118 195
11 3300037418 Ga0395900_0007901 Ga0395900_0007901_3553_4155 195
12 3300037466 Ga0395898_0000015 Ga0395898_0000015_229555_230157 195
13 3300048929 Ga0496126_0014431 Ga0496126_0014431_1592_2188 196
14 iso_pu_bacteria 2585428094 2587864487 196
15 iso_pu_bacteria 2643221549 2643769351 196
16 iso_pu_bacteria 2643221616 2644096973 196
17 iso_pu_bacteria 2643221619 2644113969 196
18 iso_pu_bacteria 2643221632 2644183907 196
19 iso_pu_bacteria 2643221635 2644198533 196
20 iso_pu_bacteria 2643221649 2644280464 196
21 iso_pu_bacteria 2751185788 2753301391 196
22 iso_pu_bacteria 2808606372 2808902616 196
23 iso_pu_bacteria 2844841374 2844842852 196
24 iso_pu_bacteria 2852643534 2852645193 196
25 iso_pu_bacteria 2857733635 2857735389 196
26 iso_pu_bacteria 2857737099 2857738582 196
27 iso_pu_bacteria 2862993130 2862993314 196
28 iso_pu_bacteria 2870622029 2870623166 196
29 iso_pu_bacteria 2884763398 2884765832 196
30 iso_pu_bacteria 2904501621 2904503740 196
31 iso_pu_bacteria 2908674828 2908675380 196
32 iso_pu_bacteria 2909074476 2909077693 196
33 iso_pu_bacteria 2919039151 2919042233 196
34 iso_pu_bacteria 2919055335 2919059093 196
35 iso_pu_bacteria 2919443155 2919443218 196
36 iso_pu_bacteria 2919523602 2919524935 196
37 iso_pu_bacteria 2928153084 2928156871 196
38 iso_pu_bacteria 2928500415 2928501405 196
39 iso_pu_bacteria 2939657138 2939657575 196
40 iso_pu_bacteria 2964326757 2964327106 196
41 iso_pu_bacteria 2966921586 2966923927 196
42 iso_pu_bacteria 8004212874 8004214536 196
43 iso_pu_bacteria 2904430863 2904433391 199
44 3300001989 JGI24739J22299_10047493 JGI24739J22299_100474932 200
45 3300001990 JGI24737J22298_10066996 JGI24737J22298_100669962 200
46 3300002067 JGI24735J21928_10011902 JGI24735J21928_100119022 200
47 3300002772 JGI25164J39214_1000600 JGI25164J39214_10006002 200
48 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004310 200
49 3300003323 rootH1_10176061 rootH1_101760613 200
50 3300003578 Ga0006562J51391_1031577 Ga0006562J51391_10315772 200
51 3300003578 Ga0006562J51391_1031578 Ga0006562J51391_10315783 200
52 3300003752 Ga0055539_1000005 Ga0055539_1000005117 200
53 3300003752 Ga0055539_1002589 Ga0055539_10025891 200
54 3300003756 Ga0055533_1000001 Ga0055533_10000011186 200
55 3300003759 Ga0055525_1001086 Ga0055525_10010869 200
56 3300003760 Ga0055527_1000001 Ga0055527_1000001664 200
57 3300003763 Ga0055529_1000019 Ga0055529_1000019170 200
58 3300005327 Ga0070658_10001729 Ga0070658_1000172913 200
59 3300005327 Ga0070658_10052316 Ga0070658_100523162 200
60 3300005327 Ga0070658_10095590 Ga0070658_100955903 200
61 3300005327 Ga0070658_10476295 Ga0070658_104762952 200
62 3300005335 Ga0070666_10134066 Ga0070666_101340661 200
63 3300005337 Ga0070682_100232953 Ga0070682_1002329531 200
64 3300005338 Ga0068868_100035112 Ga0068868_1000351125 200
65 3300005338 Ga0068868_100114554 Ga0068868_1001145542 200
66 3300005339 Ga0070660_100224197 Ga0070660_1002241972 200
67 3300005344 Ga0070661_100067913 Ga0070661_1000679132 200
68 3300005366 Ga0070659_100021518 Ga0070659_1000215182 200
69 3300005366 Ga0070659_100408778 Ga0070659_1004087781 200
70 3300005367 Ga0070667_100352856 Ga0070667_1003528563 200
71 3300005435 Ga0070714_100225882 Ga0070714_1002258822 200
72 3300005455 Ga0070663_100258406 Ga0070663_1002584061 200
73 3300005456 Ga0070678_100050802 Ga0070678_1000508022 200
74 3300005539 Ga0068853_100125362 Ga0068853_1001253622 200
75 3300005543 Ga0070672_100088082 Ga0070672_1000880822 200
76 3300005543 Ga0070672_100458744 Ga0070672_1004587442 200
77 3300005563 Ga0068855_100011698 Ga0068855_10001169810 200
78 3300005563 Ga0068855_100579736 Ga0068855_1005797362 200
79 3300005577 Ga0068857_100005680 Ga0068857_1000056809 200
80 3300005577 Ga0068857_100623576 Ga0068857_1006235761 200
81 3300005616 Ga0068852_100125961 Ga0068852_1001259612 200
82 3300005616 Ga0068852_100188210 Ga0068852_1001882102 200
83 3300005616 Ga0068852_100346462 Ga0068852_1003464622 200
84 3300005617 Ga0068859_100019120 Ga0068859_1000191202 200
85 3300005719 Ga0068861_100054222 Ga0068861_1000542222 200
86 3300005834 Ga0068851_10000005 Ga0068851_10000005237 200
87 3300005842 Ga0068858_100000175 Ga0068858_1000001757 200
88 3300005844 Ga0068862_100084260 Ga0068862_1000842602 200
89 3300006038 Ga0075365_10049048 Ga0075365_100490484 200
90 3300006051 Ga0075364_10026288 Ga0075364_100262883 200
91 3300006186 Ga0075369_10008347 Ga0075369_100083472 200
92 3300006931 Ga0097620_100019120 Ga0097620_10001912011 200
93 3300009093 Ga0105240_10035693 Ga0105240_100356938 200
94 3300009093 Ga0105240_11022853 Ga0105240_110228531 200
95 3300009094 Ga0111539_11249813 Ga0111539_112498131 200
96 3300009098 Ga0105245_10072293 Ga0105245_100722935 200
97 3300009098 Ga0105245_10091756 Ga0105245_100917562 200
98 3300009098 Ga0105245_11332596 Ga0105245_113325962 200
99 3300009148 Ga0105243_10080095 Ga0105243_100800955 200
100 3300009174 Ga0105241_10008755 Ga0105241_100087553 200
101 3300009177 Ga0105248_10005622 Ga0105248_100056226 200
102 3300009545 Ga0105237_10001010 Ga0105237_1000101017 200
103 3300009545 Ga0105237_10064476 Ga0105237_100644762 200
104 3300009545 Ga0105237_10113413 Ga0105237_101134132 200
105 3300009545 Ga0105237_10485871 Ga0105237_104858712 200
106 3300009545 Ga0105237_11614875 Ga0105237_116148751 200
107 3300009551 Ga0105238_10024726 Ga0105238_100247262 200
108 3300010375 Ga0105239_10170216 Ga0105239_101702164 200
109 3300011119 Ga0105246_10128971 Ga0105246_101289712 200
110 3300011119 Ga0105246_10228631 Ga0105246_102286312 200
111 3300013104 Ga0157370_10002575 Ga0157370_100025756 200
112 3300013105 Ga0157369_10009560 Ga0157369_100095604 200
113 3300013105 Ga0157369_10166697 Ga0157369_101666972 200
114 3300013105 Ga0157369_10266136 Ga0157369_102661362 200
115 3300013105 Ga0157369_10830122 Ga0157369_108301222 200
116 3300013105 Ga0157369_11295075 Ga0157369_112950751 200
117 3300013296 Ga0157374_10528408 Ga0157374_105284081 200
118 3300013306 Ga0163162_10563575 Ga0163162_105635752 200
119 3300013306 Ga0163162_11524103 Ga0163162_115241031 200
120 3300013307 Ga0157372_10336432 Ga0157372_103364322 200
121 3300013307 Ga0157372_11101893 Ga0157372_111018931 200
122 3300013307 Ga0157372_11322397 Ga0157372_113223972 200
123 3300013308 Ga0157375_10439116 Ga0157375_104391162 200
124 3300014325 Ga0163163_10029559 Ga0163163_100295593 200
125 3300014325 Ga0163163_11253633 Ga0163163_112536331 200
126 3300014326 Ga0157380_10002059 Ga0157380_100020597 200
127 3300014326 Ga0157380_11801308 Ga0157380_118013081 200
128 3300014968 Ga0157379_10003650 Ga0157379_100036504 200
129 3300020082 Ga0206353_10984193 Ga0206353_109841933 200
130 3300025225 Ga0209566_100105 Ga0209566_10010577 200
131 3300025226 Ga0209674_100001 Ga0209674_1000011186 200
132 3300025228 Ga0209672_100006 Ga0209672_100006311 200
133 3300025229 Ga0209147_100371 Ga0209147_10037126 200
134 3300025230 Ga0209563_100001 Ga0209563_1000011186 200
135 3300025230 Ga0209563_101025 Ga0209563_1010253 200
136 3300025231 Ga0207427_100010 Ga0207427_100010271 200
137 3300025233 Ga0209437_100658 Ga0209437_1006584 200
138 3300025242 Ga0209258_102537 Ga0209258_1025373 200
139 3300025253 Ga0209677_100001 Ga0209677_1000011186 200
140 3300025253 Ga0209677_100539 Ga0209677_10053915 200
141 3300025254 Ga0209148_1000015 Ga0209148_1000015155 200
142 3300025254 Ga0209148_1002758 Ga0209148_10027586 200
143 3300025261 Ga0209233_1000001 Ga0209233_10000011678 200
144 3300025272 Ga0209455_1000013 Ga0209455_1000013155 200
145 3300025272 Ga0209455_1007202 Ga0209455_10072022 200
146 3300025321 Ga0207656_10000001 Ga0207656_1000000167 200
147 3300025321 Ga0207656_10000003 Ga0207656_10000003173 200
148 3300025321 Ga0207656_10000004 Ga0207656_1000000430 200
149 3300025904 Ga0207647_10268544 Ga0207647_102685442 200
150 3300025904 Ga0207647_10341159 Ga0207647_103411592 200
151 3300025907 Ga0207645_10314356 Ga0207645_103143562 200
152 3300025909 Ga0207705_10000001 Ga0207705_100000011997 200
153 3300025909 Ga0207705_10061647 Ga0207705_100616473 200
154 3300025909 Ga0207705_10070350 Ga0207705_100703503 200
155 3300025911 Ga0207654_10000003 Ga0207654_10000003374 200
156 3300025913 Ga0207695_10015155 Ga0207695_100151556 200
157 3300025913 Ga0207695_10021140 Ga0207695_100211406 200
158 3300025914 Ga0207671_10000001 Ga0207671_1000000165 200
159 3300025914 Ga0207671_10072389 Ga0207671_100723892 200
160 3300025919 Ga0207657_10202629 Ga0207657_102026291 200
161 3300025920 Ga0207649_10086040 Ga0207649_100860402 200
162 3300025924 Ga0207694_10000039 Ga0207694_1000003953 200
163 3300025932 Ga0207690_10076180 Ga0207690_100761802 200
164 3300025932 Ga0207690_10426113 Ga0207690_104261131 200
165 3300025935 Ga0207709_10261863 Ga0207709_102618632 200
166 3300025940 Ga0207691_10104296 Ga0207691_101042962 200
167 3300025941 Ga0207711_10003156 Ga0207711_100031566 200
168 3300025949 Ga0207667_10032513 Ga0207667_100325136 200
169 3300025949 Ga0207667_10040046 Ga0207667_100400465 200
170 3300025949 Ga0207667_10100338 Ga0207667_101003382 200
171 3300025949 Ga0207667_10513957 Ga0207667_105139572 200
172 3300025972 Ga0207668_10228609 Ga0207668_102286091 200
173 3300025986 Ga0207658_10098174 Ga0207658_100981742 200
174 3300026023 Ga0207677_10058865 Ga0207677_100588652 200
175 3300026035 Ga0207703_10000131 Ga0207703_1000013164 200
176 3300026041 Ga0207639_10074755 Ga0207639_100747552 200
177 3300026067 Ga0207678_10044714 Ga0207678_100447144 200
178 3300026067 Ga0207678_10240472 Ga0207678_102404723 200
179 3300026075 Ga0207708_10334978 Ga0207708_103349782 200
180 3300026078 Ga0207702_10118395 Ga0207702_101183952 200
181 3300026078 Ga0207702_10373948 Ga0207702_103739482 200
182 3300026088 Ga0207641_10406958 Ga0207641_104069582 200
183 3300026089 Ga0207648_11166912 Ga0207648_111669121 200
184 3300026095 Ga0207676_10210326 Ga0207676_102103264 200
185 3300026116 Ga0207674_10012602 Ga0207674_100126026 200
186 3300026116 Ga0207674_10611343 Ga0207674_106113432 200
187 3300026118 Ga0207675_100089835 Ga0207675_1000898352 200
188 3300026121 Ga0207683_10082856 Ga0207683_100828562 200
189 3300026142 Ga0207698_10013768 Ga0207698_100137686 200
190 3300026142 Ga0207698_10185242 Ga0207698_101852422 200
191 3300028794 Ga0307515_10089742 Ga0307515_100897422 200
192 3300031456 Ga0307513_10345704 Ga0307513_103457042 200
193 3300031649 Ga0307514_10003146 Ga0307514_1000314618 200
194 3300031649 Ga0307514_10033244 Ga0307514_100332442 200
195 3300031838 Ga0307518_10245684 Ga0307518_102456841 200
196 3300031911 Ga0307412_10412298 Ga0307412_104122982 200
197 3300032002 Ga0307416_101003092 Ga0307416_1010030922 200
198 3300032002 Ga0307416_102000484 Ga0307416_1020004841 200
199 3300032004 Ga0307414_10427246 Ga0307414_104272462 200
200 3300032126 Ga0307415_100997058 Ga0307415_1009970581 200
201 3300037068 Ga0373925_0600019 Ga0373925_0600019_179_796 200
202 3300037312 Ga0395899_0002778 Ga0395899_0002778_11771_12373 200
203 3300037466 Ga0395898_0449037 Ga0395898_0449037_85_687 200
204 3300041413 Ga0439465_0117353 Ga0439465_0117353_264_866 200
205 3300041512 Ga0451853_2559915 Ga0451853_2559915_166_768 200
206 3300044658 Ga0466972_0012238 Ga0466972_0012238_1172_1774 200
207 3300044658 Ga0466972_0217326 Ga0466972_0217326_119_721 200
208 3300044683 Ga0466965_0000002 Ga0466965_0000002_77371_77973 200
209 3300044683 Ga0466965_0019128 Ga0466965_0019128_2168_2770 200
210 3300044683 Ga0466965_0022612 Ga0466965_0022612_1036_1638 200
211 3300044684 Ga0466966_0064353 Ga0466966_0064353_229_831 200
212 3300044684 Ga0466966_0103075 Ga0466966_0103075_1126_1728 200
213 3300044693 Ga0466961_0123510 Ga0466961_0123510_1001_1603 200
214 3300044694 Ga0466963_0624546 Ga0466963_0624546_56_658 200
215 3300044719 Ga0466971_0007332 Ga0466971_0007332_2206_2808 200
216 3300044735 Ga0466968_0052869 Ga0466968_0052869_516_1118 200
217 3300044765 Ga0466970_0013910 Ga0466970_0013910_2825_3427 200
218 3300044765 Ga0466970_0117241 Ga0466970_0117241_68_670 200
219 3300044765 Ga0466970_0250847 Ga0466970_0250847_63_674 200
220 3300044842 Ga0466957_0111784 Ga0466957_0111784_349_951 200
221 3300044842 Ga0466957_0134081 Ga0466957_0134081_916_1518 200
222 3300044901 Ga0466960_0049133 Ga0466960_0049133_59_661 200
223 3300045049 Ga0466959_0101578 Ga0466959_0101578_229_831 200
224 3300045049 Ga0466959_0426812 Ga0466959_0426812_284_886 200
225 3300045836 Ga0466958_0345528 Ga0466958_0345528_305_907 200
226 3300046457 Ga0495590_0004949 Ga0495590_0004949_3565_4167 200
227 3300046460 Ga0495638_0157567 Ga0495638_0157567_312_914 200
228 3300046471 Ga0495650_0000873 Ga0495650_0000873_20197_20799 200
229 3300046477 Ga0495664_0144918 Ga0495664_0144918_688_1305 200
230 3300046514 Ga0495618_0042507 Ga0495618_0042507_383_1000 200
231 3300046535 Ga0495586_0028573 Ga0495586_0028573_274_891 200
232 3300046538 Ga0495609_0061561 Ga0495609_0061561_565_1167 200
233 3300046543 Ga0495645_0080480 Ga0495645_0080480_963_1580 200
234 3300046615 Ga0495656_0005159 Ga0495656_0005159_2958_3560 200
235 3300046642 Ga0495634_0218819 Ga0495634_0218819_498_1115 200
236 3300046678 Ga0495599_0061944 Ga0495599_0061944_675_1292 200
237 3300047319 Ga0495674_0065742 Ga0495674_0065742_1107_1724 200
238 3300047320 Ga0495672_0054032 Ga0495672_0054032_1451_2053 200
239 3300048091 Ga0495626_0012549 Ga0495626_0012549_2339_2941 200
240 3300048903 Ga0496100_0035663 Ga0496100_0035663_248_850 200
241 3300048903 Ga0496100_0165781 Ga0496100_0165781_854_1456 200
242 3300048904 Ga0496101_0459592 Ga0496101_0459592_271_873 200
243 3300048905 Ga0496102_0128917 Ga0496102_0128917_958_1560 200
244 3300048905 Ga0496102_0509108 Ga0496102_0509108_431_1033 200
245 3300048905 Ga0496102_0566303 Ga0496102_0566303_24_626 200
246 3300048906 Ga0496103_0153226 Ga0496103_0153226_294_896 200
247 3300048907 Ga0496104_0201905 Ga0496104_0201905_313_915 200
248 3300048908 Ga0496105_0059002 Ga0496105_0059002_1548_2150 200
249 3300048908 Ga0496105_0123532 Ga0496105_0123532_551_1153 200
250 3300048908 Ga0496105_0140979 Ga0496105_0140979_149_751 200
251 3300048908 Ga0496105_0681135 Ga0496105_0681135_134_736 200
252 3300048910 Ga0496107_0013327 Ga0496107_0013327_1158_1760 200
253 3300048917 Ga0496114_0085011 Ga0496114_0085011_2006_2608 200
254 3300048917 Ga0496114_0144652 Ga0496114_0144652_142_744 200
255 3300048918 Ga0496115_0189853 Ga0496115_0189853_574_1176 200
256 3300048918 Ga0496115_0253310 Ga0496115_0253310_550_1152 200
257 3300048918 Ga0496115_0331363 Ga0496115_0331363_398_1000 200
258 3300048919 Ga0496116_0111666 Ga0496116_0111666_652_1254 200
259 3300048919 Ga0496116_0289736 Ga0496116_0289736_12_614 200
260 3300048920 Ga0496117_0015618 Ga0496117_0015618_1787_2389 200
261 3300048920 Ga0496117_0032362 Ga0496117_0032362_2835_3437 200
262 3300048920 Ga0496117_0060182 Ga0496117_0060182_672_1274 200
263 3300048920 Ga0496117_0085633 Ga0496117_0085633_455_1057 200
264 3300048920 Ga0496117_0086516 Ga0496117_0086516_746_1348 200
265 3300048920 Ga0496117_0303927 Ga0496117_0303927_186_788 200
266 3300048921 Ga0496118_0002810 Ga0496118_0002810_20671_21273 200
267 3300048921 Ga0496118_0023123 Ga0496118_0023123_3131_3733 200
268 3300048921 Ga0496118_0039258 Ga0496118_0039258_63_665 200
269 3300048921 Ga0496118_0240784 Ga0496118_0240784_311_913 200
270 3300048921 Ga0496118_0364016 Ga0496118_0364016_40_642 200
271 3300048922 Ga0496119_0003638 Ga0496119_0003638_9949_10551 200
272 3300048922 Ga0496119_0004413 Ga0496119_0004413_8254_8856 200
273 3300048922 Ga0496119_0026541 Ga0496119_0026541_227_829 200
274 3300048922 Ga0496119_0059299 Ga0496119_0059299_1508_2110 200
275 3300048922 Ga0496119_0282686 Ga0496119_0282686_208_810 200
276 3300048923 Ga0496120_0002082 Ga0496120_0002082_7518_8120 200
277 3300048923 Ga0496120_0071584 Ga0496120_0071584_1265_1867 200
278 3300048924 Ga0496121_0000076 Ga0496121_0000076_140630_141232 200
279 3300048924 Ga0496121_0123090 Ga0496121_0123090_692_1294 200
280 3300048925 Ga0496122_0007675 Ga0496122_0007675_10630_11232 200
281 3300048925 Ga0496122_0139285 Ga0496122_0139285_832_1434 200
282 3300048926 Ga0496123_0001428 Ga0496123_0001428_12673_13275 200
283 3300048927 Ga0496124_0000256 Ga0496124_0000256_5662_6264 200
284 3300048927 Ga0496124_0010890 Ga0496124_0010890_1642_2244 200
285 3300048927 Ga0496124_0339930 Ga0496124_0339930_21_623 200
286 3300048928 Ga0496125_0188701 Ga0496125_0188701_327_929 200
287 3300048928 Ga0496125_0343842 Ga0496125_0343842_68_670 200
288 3300048929 Ga0496126_0211895 Ga0496126_0211895_722_1324 200
289 3300049568 Ga0501031_0006467 Ga0501031_0006467_1067_1669 200
290 3300049568 Ga0501031_0114527 Ga0501031_0114527_514_1116 200
291 3300049568 Ga0501031_0150770 Ga0501031_0150770_826_1428 200
292 3300049569 Ga0501032_0002581 Ga0501032_0002581_1951_2553 200
293 3300049569 Ga0501032_0010577 Ga0501032_0010577_745_1347 200
294 3300049569 Ga0501032_0082096 Ga0501032_0082096_1519_2121 200
295 3300049569 Ga0501032_0495145 Ga0501032_0495145_99_701 200
296 3300049569 Ga0501032_0553165 Ga0501032_0553165_21_623 200
297 3300049570 Ga0501033_0002291 Ga0501033_0002291_1103_1705 200
298 3300049570 Ga0501033_0005565 Ga0501033_0005565_2279_2881 200
299 3300049570 Ga0501033_0054644 Ga0501033_0054644_1983_2585 200
300 3300049570 Ga0501033_0075189 Ga0501033_0075189_1618_2220 200
301 3300049570 Ga0501033_0145267 Ga0501033_0145267_929_1531 200
302 3300049571 Ga0501034_0005943 Ga0501034_0005943_1858_2460 200
303 3300049571 Ga0501034_0007872 Ga0501034_0007872_8955_9557 200
304 3300049571 Ga0501034_0018283 Ga0501034_0018283_1713_2315 200
305 3300049571 Ga0501034_0033782 Ga0501034_0033782_3257_3859 200
306 3300049571 Ga0501034_0040064 Ga0501034_0040064_480_1082 200
307 3300049571 Ga0501034_0048120 Ga0501034_0048120_2891_3493 200
308 3300049571 Ga0501034_0067567 Ga0501034_0067567_2653_3255 200
309 3300049571 Ga0501034_0085318 Ga0501034_0085318_1910_2512 200
310 3300049571 Ga0501034_0155677 Ga0501034_0155677_965_1567 200
311 3300049571 Ga0501034_0280088 Ga0501034_0280088_985_1587 200
312 3300049571 Ga0501034_0302930 Ga0501034_0302930_824_1426 200
313 3300049572 Ga0501036_0001034 Ga0501036_0001034_14289_14891 200
314 3300049572 Ga0501036_0098424 Ga0501036_0098424_1560_2162 200
315 3300049572 Ga0501036_0107114 Ga0501036_0107114_233_835 200
316 3300049572 Ga0501036_0172115 Ga0501036_0172115_678_1280 200
317 3300049572 Ga0501036_0690615 Ga0501036_0690615_209_811 200
318 3300049573 Ga0501037_0002690 Ga0501037_0002690_11104_11706 200
319 3300049573 Ga0501037_0021997 Ga0501037_0021997_3963_4565 200
320 3300049573 Ga0501037_0072063 Ga0501037_0072063_49_651 200
321 3300049573 Ga0501037_0081138 Ga0501037_0081138_99_701 200
322 3300049573 Ga0501037_0083795 Ga0501037_0083795_983_1585 200
323 3300049573 Ga0501037_0195631 Ga0501037_0195631_354_956 200
324 3300049573 Ga0501037_0242034 Ga0501037_0242034_225_827 200
325 3300049573 Ga0501037_0509587 Ga0501037_0509587_109_711 200
326 3300049574 Ga0501038_0019473 Ga0501038_0019473_5200_5802 200
327 3300049574 Ga0501038_0020979 Ga0501038_0020979_1823_2425 200
328 3300049574 Ga0501038_0032991 Ga0501038_0032991_2357_2959 200
329 3300049574 Ga0501038_0033460 Ga0501038_0033460_673_1275 200
330 3300049574 Ga0501038_0621677 Ga0501038_0621677_109_711 200
331 3300049574 Ga0501038_0832028 Ga0501038_0832028_50_652 200
332 3300049575 Ga0501039_0001549 Ga0501039_0001549_6936_7538 200
333 3300049575 Ga0501039_0021786 Ga0501039_0021786_1436_2038 200
334 3300049578 Ga0501042_0203207 Ga0501042_0203207_676_1278 200
335 3300049579 Ga0501043_0007164 Ga0501043_0007164_1058_1660 200
336 3300049579 Ga0501043_0013606 Ga0501043_0013606_1973_2575 200
337 3300049579 Ga0501043_0039776 Ga0501043_0039776_48_650 200
338 3300049579 Ga0501043_0064964 Ga0501043_0064964_2069_2671 200
339 3300049579 Ga0501043_0146414 Ga0501043_0146414_72_674 200
340 3300049579 Ga0501043_0278872 Ga0501043_0278872_447_1049 200
341 3300049580 Ga0501046_0000566 Ga0501046_0000566_29951_30553 200
342 3300049580 Ga0501046_0008263 Ga0501046_0008263_2581_3183 200
343 3300049580 Ga0501046_0012085 Ga0501046_0012085_4454_5056 200
344 3300049580 Ga0501046_0212976 Ga0501046_0212976_437_1039 200
345 3300049581 Ga0501047_0003895 Ga0501047_0003895_11603_12205 200
346 3300049581 Ga0501047_0011854 Ga0501047_0011854_7179_7781 200
347 3300049581 Ga0501047_0016477 Ga0501047_0016477_4875_5477 200
348 3300049581 Ga0501047_0019557 Ga0501047_0019557_3387_3989 200
349 3300049581 Ga0501047_0023519 Ga0501047_0023519_3006_3608 200
350 3300049581 Ga0501047_0027993 Ga0501047_0027993_2476_3078 200
351 3300049581 Ga0501047_0224796 Ga0501047_0224796_170_772 200
352 3300049582 Ga0501048_0011058 Ga0501048_0011058_4639_5241 200
353 3300049582 Ga0501048_0052857 Ga0501048_0052857_1757_2359 200
354 3300049583 Ga0501067_0200379 Ga0501067_0200379_494_1096 200
355 3300049583 Ga0501067_0234172 Ga0501067_0234172_346_948 200
356 3300049585 Ga0501069_0297265 Ga0501069_0297265_262_864 200
357 3300049585 Ga0501069_0412121 Ga0501069_0412121_101_703 200
358 3300049586 Ga0501070_0000150 Ga0501070_0000150_41520_42122 200
359 3300049586 Ga0501070_0010703 Ga0501070_0010703_3397_3999 200
360 3300049586 Ga0501070_0027079 Ga0501070_0027079_2196_2798 200
361 3300049586 Ga0501070_0029242 Ga0501070_0029242_1975_2577 200
362 3300049586 Ga0501070_0063285 Ga0501070_0063285_2334_2936 200
363 3300049586 Ga0501070_0087186 Ga0501070_0087186_194_802 200
364 3300049586 Ga0501070_0147256 Ga0501070_0147256_617_1219 200
365 3300049587 Ga0501071_0000061 Ga0501071_0000061_2941_3543 200
366 3300049587 Ga0501071_0074295 Ga0501071_0074295_1849_2451 200
367 3300049589 Ga0501073_0000024 Ga0501073_0000024_62992_63600 200
368 3300049589 Ga0501073_0012174 Ga0501073_0012174_1488_2090 200
369 3300049589 Ga0501073_0555910 Ga0501073_0555910_171_773 200
370 3300049590 Ga0501074_0027194 Ga0501074_0027194_716_1318 200
371 3300049742 Ga0501080_0000058 Ga0501080_0000058_48250_48852 200
372 3300049742 Ga0501080_0115450 Ga0501080_0115450_447_1049 200
373 3300049742 Ga0501080_0192156 Ga0501080_0192156_252_860 200
374 3300049822 Ga0501035_0006879 Ga0501035_0006879_6418_7020 200
375 3300049822 Ga0501035_0014116 Ga0501035_0014116_4476_5078 200
376 3300049822 Ga0501035_0016545 Ga0501035_0016545_3071_3673 200
377 3300049822 Ga0501035_0016692 Ga0501035_0016692_1827_2429 200
378 3300049822 Ga0501035_0200947 Ga0501035_0200947_664_1266 200
379 3300049822 Ga0501035_0406817 Ga0501035_0406817_361_963 200
380 3300049823 Ga0501044_0004430 Ga0501044_0004430_10975_11577 200
381 3300049823 Ga0501044_0007046 Ga0501044_0007046_10910_11512 200
382 3300049823 Ga0501044_0023641 Ga0501044_0023641_1058_1660 200
383 3300049823 Ga0501044_0065689 Ga0501044_0065689_2788_3390 200
384 3300049823 Ga0501044_0405291 Ga0501044_0405291_565_1167 200
385 3300049823 Ga0501044_0505569 Ga0501044_0505569_130_732 200
386 3300049823 Ga0501044_0763378 Ga0501044_0763378_108_710 200
387 3300049824 Ga0501045_0008191 Ga0501045_0008191_3735_4337 200
388 3300049824 Ga0501045_0078204 Ga0501045_0078204_1045_1647 200
389 3300050491 nmdc:mga00v17_18266_c2 nmdc:mga00v17_18266_c2_1947_2555 200
390 3300050492 nmdc:mga0yw44_59859_c1 nmdc:mga0yw44_59859_c1_33_641 200
391 3300050516 nmdc:mga0sz30_18857_c1 nmdc:mga0sz30_18857_c1_1408_2016 200
392 3300050516 nmdc:mga0sz30_206626_c1 nmdc:mga0sz30_206626_c1_52_657 200
393 3300053078 Ga0495612_0079955 Ga0495612_0079955_428_1045 200
394 3300053080 Ga0500635_0000039 Ga0500635_0000039_49614_50216 200
395 3300053087 Ga0500643_000289 Ga0500643_000289_7608_8210 200
396 3300053093 Ga0500651_0001911 Ga0500651_0001911_5343_5945 200
397 3300053104 Ga0500556_0000062 Ga0500556_0000062_55857_56459 200
398 3300053104 Ga0500556_0000343 Ga0500556_0000343_30315_30923 200
399 3300053117 Ga0500593_014198 Ga0500593_014198_2727_3335 200
400 3300053133 Ga0500655_001768 Ga0500655_001768_2903_3511 200
401 3300053136 Ga0500559_0001007 Ga0500559_0001007_11953_12561 200
402 3300053136 Ga0500559_0001783 Ga0500559_0001783_6016_6621 200
403 3300053136 Ga0500559_0003843 Ga0500559_0003843_1711_2313 200
404 3300053136 Ga0500559_0005333 Ga0500559_0005333_2885_3487 200
405 3300053136 Ga0500559_0028709 Ga0500559_0028709_1090_1692 200
406 3300053136 Ga0500559_0307280 Ga0500559_0307280_27_629 200
407 3300053139 Ga0500568_0000060 Ga0500568_0000060_55933_56535 200
408 3300053139 Ga0500568_0000075 Ga0500568_0000075_26224_26829 200
409 3300053139 Ga0500568_0000151 Ga0500568_0000151_58404_59006 200
410 3300053139 Ga0500568_0009738 Ga0500568_0009738_3387_3989 200
411 3300053139 Ga0500568_0026019 Ga0500568_0026019_974_1576 200
412 3300053140 Ga0500573_0000007 Ga0500573_0000007_196353_196955 200
413 3300053140 Ga0500573_0005735 Ga0500573_0005735_2923_3525 200
414 3300053140 Ga0500573_0007483 Ga0500573_0007483_290_892 200
415 3300053140 Ga0500573_0036894 Ga0500573_0036894_120_722 200
416 3300053140 Ga0500573_0053657 Ga0500573_0053657_796_1398 200
417 3300053140 Ga0500573_0056195 Ga0500573_0056195_1292_1894 200
418 3300053140 Ga0500573_0082714 Ga0500573_0082714_249_851 200
419 3300053140 Ga0500573_0088800 Ga0500573_0088800_534_1136 200
420 3300053140 Ga0500573_0097976 Ga0500573_0097976_974_1576 200
421 3300053140 Ga0500573_0172415 Ga0500573_0172415_171_773 200
422 3300053142 Ga0500577_0002335 Ga0500577_0002335_1582_2184 200
423 3300053142 Ga0500577_0012524 Ga0500577_0012524_318_920 200
424 3300053142 Ga0500577_0035982 Ga0500577_0035982_805_1407 200
425 3300053148 Ga0500590_018419 Ga0500590_018419_824_1426 200
426 3300053153 Ga0500616_0000156 Ga0500616_0000156_22626_23228 200
427 3300053155 Ga0500620_000023 Ga0500620_000023_30308_30913 200
428 3300054114 Ga0501084_0133688 Ga0501084_0133688_1395_1997 200
429 3300061719 Ga0466962_0085515 Ga0466962_0085515_238_840 200
430 iso_pu_bacteria 2919042368 2919045017 200
431 iso_pu_bacteria 2928104781 2928106697 200
432 iso_pu_bacteria 2966924647 2966927613 200
433 iso_pu_bacteria 2984551494 2984553576 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

31

103

0.93

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

114

208

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0t-assembly2.cif.gz_A-2 crystal structure of human phosphoglycerate mutase family member 5 (pgam5) in complex with phosphate 0.8872 2 190
5muf-assembly1.cif.gz_A crystal structure of human phosphoglycerate mutase family member 5 (pgam5) in its enzymatically active dodecameric form induced by the presence of the n-terminal wdpnwd motif 0.8855 2 192
5muf-assembly1.cif.gz_C crystal structure of human phosphoglycerate mutase family member 5 (pgam5) in its enzymatically active dodecameric form induced by the presence of the n-terminal wdpnwd motif 0.8851 2 192
6cnl-assembly1.cif.gz_I crystal structure of h105a pgam5 dodecamer 0.8843 2 192
6cnl-assembly1.cif.gz_C crystal structure of h105a pgam5 dodecamer 0.883 2 192
ID Description Score Start End Superfamily
af_Q8I1V2_102_284_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8914 3 183 3.40.50.1240
6cnlL00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8791 2 192 3.40.50.1240
af_Q8I1V2_102_284_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8775 3 183 3.40.50.1240
6cnlL00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8661 2 192 3.40.50.1240
af_Q9W173_71_270_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8304 2 192 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A1R4FWI1-F1-model_v4 Putative phosphoglycerate mutase 0.9619 43 194
AF-A0A4R2JT05-F1-model_v4 Putative phosphoglycerate mutase 0.9555 2 192
AF-A0A429AK48-F1-model_v4 deleted 0.9491 2 192
AF-A0A0P9EZW1-F1-model_v4 Phosphoglycerate mutase 0.949 1 192 GO:0004722
GO:0090141
AF-A0A126Z5X1-F1-model_v4 Histidine phosphatase 0.9438 1 200

Feature Viewer

pLDDT pTM Quality
93.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map