F442841

General Info

Members Datasets Scaffolds Average Seq Length
433 301 866 401

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10037859|Ga0157375_100378596
Length 408
Sequence VIAMDTILVVNAGSSSVKFQVFGVDGDGRLRRQIKGQMDGIGSRPRLRAADAAGDTMADRAYPIEAVPDVPAALMLASAWLRDELRLSPLAVGHRVVHGGPDYDRPVLIDHGTIARLERFTALAPLHQPHNLAPIRSLLANFPALPQVACFDTAFHRNHDEVADHYAIPRRLHEEGIRRYGFHGLSYEYIAGVLPNVAPEIAKGRVIVAHLGSGASMCAIHGGRSVESTMGFTALDGLPMGTRTGQIDPGVVLYLMTAKGMSAAEVQEFLYRDCGLKGLSGVSNDMRELQHSSDPRAAFAVDYFVYRVALQAGMLAAALQGLDGFVFTAGIGENSVGIRARIAERLEWLGVSLDPVENARSASLISREGSQIPVYVVPTDEELMIAQHTLSLLWNRHPSSSPKRERAS

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
242 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
243 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
244 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
245 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
246 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
247 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
248 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
249 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
250 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
251 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
252 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
253 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
254 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
255 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
256 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
257 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
258 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
259 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
260 2922368715
261 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
262 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
263 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
264 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
265 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
266 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
267 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
268 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
269 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
270 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
271 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
272 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
273 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
274 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
275 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
276 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
277 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
278 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
279 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
280 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
281 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
282 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
283 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
284 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
285 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
286 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
287 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
288 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
289 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
290 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
291 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
292 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
293 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
294 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
295 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
296 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
297 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
298 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
299 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
300 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
301 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.11
Metatranscriptomes 0
Isolates 13.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 11.55
Rhizoplane 7.62
Rhizosphere 66.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10037859 3300013308 Bacteria 4626
2 JGI25153J46596_10001700 3300003215 Bacteria 13064
3 JGI25160J50197_1000954 3300003354 Bacteria 15154
4 Ga0070658_10011820 3300005327 Bacteria 7007
5 Ga0070658_10041261 3300005327 Bacteria 3723
6 Ga0070683_100000244 3300005329 Bacteria 37279
7 Ga0070683_100038701 3300005329 Bacteria 4373
8 Ga0070680_100000715 3300005336 Bacteria 23059
9 Ga0070660_100001964 3300005339 Bacteria 14177
10 Ga0070691_10060095 3300005341 Bacteria 1827
11 Ga0070709_10000274 3300005434 Bacteria 33042
12 Ga0070714_100002601 3300005435 Bacteria 13308
13 Ga0070713_100028315 3300005436 Bacteria 4424
14 Ga0070710_10000279 3300005437 Bacteria 24157
15 Ga0070711_100000568 3300005439 Bacteria 19319
16 Ga0070711_100005497 3300005439 Bacteria 7583
17 Ga0070678_100103997 3300005456 Bacteria 2207
18 Ga0070681_10031480 3300005458 Bacteria 5326
19 Ga0070706_100050349 3300005467 Bacteria 3844
20 Ga0070698_100212144 3300005471 Bacteria 1871
21 Ga0070679_100020332 3300005530 Bacteria 6470
22 Ga0070679_100107246 3300005530 Bacteria 2779
23 Ga0070684_100001779 3300005535 Bacteria 15735
24 Ga0070684_100067288 3300005535 Bacteria 3146
25 Ga0070697_100013347 3300005536 Bacteria 6444
26 Ga0070695_100173175 3300005545 Bacteria 1524
27 Ga0070665_100011784 3300005548 Bacteria 8831
28 Ga0068855_100024006 3300005563 Bacteria 7300
29 Ga0068855_100048340 3300005563 Bacteria 5021
30 Ga0068857_100005328 3300005577 Bacteria 10954
31 Ga0068859_100029372 3300005617 Bacteria 5516
32 Ga0068866_10041952 3300005718 Bacteria 2274
33 Ga0068851_10003440 3300005834 Bacteria 7047
34 Ga0068870_10037345 3300005840 Bacteria 2504
35 Ga0068860_100000223 3300005843 Bacteria 88152
36 Ga0068862_100009704 3300005844 Bacteria 7957
37 Ga0081540_1003096 3300005983 Bacteria 13322
38 Ga0081540_1006280 3300005983 Bacteria 8696
39 Ga0081540_1009914 3300005983 Bacteria 6499
40 Ga0097621_100263649 3300006237 Bacteria 1512
41 Ga0097620_100029369 3300006931 Bacteria 5516
42 Ga0099794_10020651 3300007265 Bacteria 2983
43 Ga0099795_10000287 3300007788 Bacteria 9029
44 Ga0099795_10007224 3300007788 Bacteria 3085
45 Ga0099795_10030700 3300007788 Bacteria 1847
46 Ga0105240_10003096 3300009093 Bacteria 26156
47 Ga0105240_10269329 3300009093 Bacteria 1962
48 Ga0111539_10041179 3300009094 Bacteria 5555
49 Ga0105245_10029481 3300009098 Bacteria 4849
50 Ga0105243_10162565 3300009148 Bacteria 1926
51 Ga0105243_10317470 3300009148 Bacteria 1418
52 Ga0105241_10034894 3300009174 Bacteria 3782
53 Ga0105242_10087361 3300009176 Bacteria 2618
54 Ga0105242_10149751 3300009176 Bacteria 2034
55 Ga0105248_10177054 3300009177 Bacteria 2403
56 Ga0105237_10002350 3300009545 Bacteria 23518
57 Ga0105237_10015172 3300009545 Bacteria 8028
58 Ga0105237_10331344 3300009545 Bacteria 1526
59 Ga0105238_10000408 3300009551 Bacteria 45693
60 Ga0105238_10005340 3300009551 Bacteria 12696
61 Ga0105238_10297603 3300009551 Bacteria 1597
62 Ga0105249_10211828 3300009553 Bacteria 1902
63 Ga0099796_10000343 3300010159 Bacteria 7538
64 Ga0099796_10002003 3300010159 Bacteria 4339
65 Ga0105239_10026031 3300010375 Bacteria 6441
66 Ga0105239_10039905 3300010375 Bacteria 5142
67 Ga0105239_10049244 3300010375 Bacteria 4620
68 Ga0105239_10239805 3300010375 Bacteria 2035
69 Ga0105246_10006978 3300011119 Bacteria 6908
70 Ga0105246_10141625 3300011119 Bacteria 1809
71 Ga0105246_10206284 3300011119 Bacteria 1531
72 Ga0157370_10001125 3300013104 Bacteria 33417
73 Ga0157369_10000685 3300013105 Bacteria 43830
74 Ga0157369_10029295 3300013105 Bacteria 6086
75 Ga0157369_10333207 3300013105 Bacteria 1576
76 Ga0157374_10045871 3300013296 Bacteria 4045
77 Ga0163162_10045627 3300013306 Bacteria 4390
78 Ga0163162_10114575 3300013306 Bacteria 2795
79 Ga0163162_10140413 3300013306 Bacteria 2529
80 Ga0163162_10363492 3300013306 Bacteria 1580
81 Ga0157375_10060979 3300013308 Bacteria 3743
82 Ga0163163_10139360 3300014325 Bacteria 2467
83 Ga0157380_10028059 3300014326 Bacteria 4288
84 Ga0157376_10301175 3300014969 Bacteria 1518
85 Ga0209148_1001243 3300025254 Bacteria 14218
86 Ga0209233_1016756 3300025261 Bacteria 2012
87 Ga0209455_1002061 3300025272 Bacteria 8124
88 Ga0209673_1011522 3300025273 Bacteria 3640
89 Ga0209564_1003985 3300025295 Bacteria 9373
90 Ga0209758_1003003 3300025297 Bacteria 16152
91 Ga0207426_1000596 3300025302 Bacteria 47621
92 Ga0207656_10005202 3300025321 Bacteria 4577
93 Ga0207692_10002196 3300025898 Bacteria 7463
94 Ga0207642_10076278 3300025899 Bacteria 1613
95 Ga0207699_10000285 3300025906 Bacteria 27688
96 Ga0207643_10016657 3300025908 Bacteria 4009
97 Ga0207705_10021164 3300025909 Bacteria 4639
98 Ga0207684_10029390 3300025910 Bacteria 4681
99 Ga0207707_10000126 3300025912 Bacteria 78954
100 Ga0207707_10058791 3300025912 Bacteria 3345
101 Ga0207671_10030990 3300025914 Bacteria 3987
102 Ga0207671_10167986 3300025914 Bacteria 1702
103 Ga0207693_10038436 3300025915 Bacteria 3769
104 Ga0207663_10001369 3300025916 Bacteria 11308
105 Ga0207663_10005276 3300025916 Bacteria 6506
106 Ga0207660_10008935 3300025917 Bacteria 6484
107 Ga0207657_10000261 3300025919 Bacteria 55977
108 Ga0207652_10000994 3300025921 Bacteria 26203
109 Ga0207652_10053657 3300025921 Bacteria 3463
110 Ga0207694_10008232 3300025924 Bacteria 7882
111 Ga0207694_10012454 3300025924 Bacteria 6411
112 Ga0207687_10032821 3300025927 Bacteria 3518
113 Ga0207700_10020158 3300025928 Bacteria 4521
114 Ga0207664_10004606 3300025929 Bacteria 9346
115 Ga0207686_10079656 3300025934 Bacteria 2134
116 Ga0207670_10124811 3300025936 Bacteria 1877
117 Ga0207704_10053561 3300025938 Bacteria 2454
118 Ga0207689_10001027 3300025942 Bacteria 26845
119 Ga0207689_10008518 3300025942 Bacteria 8942
120 Ga0207661_10002724 3300025944 Bacteria 12164
121 Ga0207661_10053812 3300025944 Bacteria 3223
122 Ga0207679_10038975 3300025945 Bacteria 3391
123 Ga0207667_10005359 3300025949 Bacteria 15636
124 Ga0207712_10046408 3300025961 Bacteria 3012
125 Ga0207668_10011846 3300025972 Bacteria 5316
126 Ga0207668_10197720 3300025972 Bacteria 1599
127 Ga0207677_10042872 3300026023 Bacteria 3004
128 Ga0207678_10041283 3300026067 Bacteria 4000
129 Ga0207708_10127713 3300026075 Bacteria 1985
130 Ga0207674_10009856 3300026116 Bacteria 10874
131 Ga0207674_10112820 3300026116 Bacteria 2692
132 Ga0207675_100222706 3300026118 Bacteria 1818
133 Ga0207683_10016561 3300026121 Bacteria 6276
134 Ga0209588_1004144 3300027671 Bacteria 4065
135 Ga0209588_1006036 3300027671 Bacteria 3498
136 Ga0207428_10072284 3300027907 Bacteria 2708
137 Ga0268266_10039229 3300028379 Bacteria 4033
138 Ga0268265_10013835 3300028380 Bacteria 5492
139 Ga0268265_10018753 3300028380 Bacteria 4799
140 Ga0268264_10000119 3300028381 Bacteria 192507
141 Ga0268264_10036226 3300028381 Bacteria 4063
142 Ga0307517_10000042 3300028786 Bacteria 166943
143 Ga0307511_10077277 3300030521 Bacteria 2372
144 Ga0307513_10127371 3300031456 Bacteria 2499
145 Ga0307509_10003603 3300031507 Bacteria 23280
146 Ga0307509_10038766 3300031507 Bacteria 5196
147 Ga0307408_100025649 3300031548 Bacteria 4039
148 Ga0307508_10000020 3300031616 Bacteria 188730
149 Ga0307508_10075255 3300031616 Bacteria 2953
150 Ga0316576_10146360 3300031727 Bacteria 1780
151 Ga0307516_10000729 3300031730 Bacteria 44867
152 Ga0307516_10169497 3300031730 Bacteria 1925
153 Ga0307410_10097995 3300031852 Bacteria 2096
154 Ga0307412_10111037 3300031911 Bacteria 1958
155 Ga0307409_100159503 3300031995 Bacteria 1970
156 Ga0307416_100065481 3300032002 Bacteria 2987
157 Ga0307416_100179650 3300032002 Bacteria 1982
158 Ga0307415_100120500 3300032126 Bacteria 1966
159 Ga0307415_100188299 3300032126 Bacteria 1626
160 Ga0307510_10012646 3300033180 Bacteria 10014
161 Ga0307510_10015257 3300033180 Bacteria 9083
162 Ga0307510_10029443 3300033180 Bacteria 6250
163 Ga0373926_0003365 3300035083 Bacteria 5148
164 Ga0373934_0000416 3300035086 Bacteria 14940
165 Ga0373923_0005317 3300035111 Bacteria 4368
166 Ga0373936_0014679 3300035113 Bacteria 2997
167 Ga0373941_0022667 3300035115 Bacteria 1784
168 Ga0373953_0000591 3300035117 Bacteria 10025
169 Ga0373954_0015451 3300035118 Bacteria 3412
170 Ga0373956_0041574 3300035119 Bacteria 2041
171 Ga0373957_0003641 3300035120 Bacteria 4592
172 Ga0373957_0034917 3300035120 Bacteria 1865
173 Ga0373943_0025983 3300035170 Bacteria 2740
174 Ga0373946_0013680 3300035171 Bacteria 3053
175 Ga0373955_0018499 3300035172 Bacteria 3466
176 Ga0316574_0007473 3300035398 Bacteria 5990
177 Ga0373931_0001003 3300035691 Bacteria 11944
178 Ga0373935_0009394 3300035692 Bacteria 5850
179 Ga0373935_0012912 3300035692 Bacteria 5033
180 Ga0373935_0021698 3300035692 Bacteria 3933
181 Ga0373927_0005631 3300035695 Bacteria 8608
182 Ga0373927_0034859 3300035695 Bacteria 3273
183 Ga0373927_0041697 3300035695 Bacteria 2976
184 Ga0373927_0086399 3300035695 Bacteria 2036
185 Ga0373927_0128914 3300035695 Bacteria 1652
186 Ga0373933_0005519 3300035724 Bacteria 6889
187 Ga0373947_0004362 3300035725 Bacteria 8297
188 Ga0373947_0011419 3300035725 Bacteria 5097
189 Ga0373937_0157498 3300036401 Bacteria 2129
190 Ga0316584_0098171 3300036712 Bacteria 2193
191 Ga0373925_0017541 3300037068 Bacteria 5190
192 Ga0373925_0025755 3300037068 Bacteria 4301
193 Ga0373925_0105755 3300037068 Bacteria 2169
194 Ga0395900_0065602 3300037418 Bacteria 3730
195 Ga0436362_1248907 3300039453 Bacteria 6385
196 Ga0451800_0242243 3300041459 Bacteria 1938
197 Ga0466967_0064649 3300045976 Bacteria 3254
198 Ga0466967_0131276 3300045976 Bacteria 2326
199 Ga0495592_0045136 3300046454 Bacteria 3289
200 Ga0495603_0008149 3300046455 Bacteria 6331
201 Ga0495603_0008261 3300046455 Bacteria 6291
202 Ga0495603_0012784 3300046455 Bacteria 5076
203 Ga0495603_0052413 3300046455 Bacteria 2423
204 Ga0495629_0003064 3300046459 Bacteria 12696
205 Ga0495629_0014461 3300046459 Bacteria 5677
206 Ga0495629_0153701 3300046459 Bacteria 1599
207 Ga0495638_0056712 3300046460 Bacteria 2430
208 Ga0495638_0063382 3300046460 Bacteria 2279
209 Ga0495641_0009688 3300046461 Bacteria 5694
210 Ga0495653_0000973 3300046463 Bacteria 21997
211 Ga0495580_0016285 3300046472 Bacteria 5583
212 Ga0495582_0011061 3300046473 Bacteria 4968
213 Ga0495582_0018118 3300046473 Bacteria 3852
214 Ga0495639_0002404 3300046475 Bacteria 8188
215 Ga0495639_0002540 3300046475 Bacteria 7962
216 Ga0495639_0101336 3300046475 Bacteria 1360
217 Ga0495662_0006309 3300046476 Bacteria 5928
218 Ga0495664_0009904 3300046477 Bacteria 5347
219 Ga0495664_0019941 3300046477 Bacteria 3862
220 Ga0495664_0082686 3300046477 Bacteria 1926
221 Ga0495585_0017150 3300046492 Bacteria 4189
222 Ga0495594_0013373 3300046499 Bacteria 4284
223 Ga0495594_0015536 3300046499 Bacteria 4000
224 Ga0495618_0013565 3300046514 Bacteria 4959
225 Ga0495618_0064125 3300046514 Bacteria 2334
226 Ga0495618_0140271 3300046514 Bacteria 1546
227 Ga0495628_0017122 3300046516 Bacteria 6038
228 Ga0495628_0122885 3300046516 Bacteria 1990
229 Ga0495628_0284775 3300046516 Bacteria 1226
230 Ga0495630_0030968 3300046517 Bacteria 3982
231 Ga0495632_0036009 3300046519 Bacteria 2520
232 Ga0495632_0143497 3300046519 Bacteria 1107
233 Ga0495648_0006026 3300046524 Bacteria 9956
234 Ga0495648_0049786 3300046524 Bacteria 2565
235 Ga0495666_0023202 3300046526 Bacteria 3069
236 Ga0495652_0182408 3300046529 Bacteria 1609
237 Ga0495665_0012227 3300046531 Bacteria 4645
238 Ga0495640_0013911 3300046533 Bacteria 6107
239 Ga0495640_0062555 3300046533 Bacteria 2524
240 Ga0495609_0034148 3300046538 Bacteria 2307
241 Ga0495609_0050036 3300046538 Bacteria 1864
242 Ga0495645_0003423 3300046543 Bacteria 10755
243 Ga0495645_0033692 3300046543 Bacteria 3737
244 Ga0495645_0072743 3300046543 Bacteria 2477
245 Ga0495622_0028937 3300046557 Bacteria 2589
246 Ga0495667_0012793 3300046559 Bacteria 5685
247 Ga0495667_0032789 3300046559 Bacteria 3478
248 Ga0495634_0019249 3300046642 Bacteria 4851
249 Ga0495634_0026774 3300046642 Bacteria 4020
250 Ga0495634_0030906 3300046642 Bacteria 3692
251 Ga0495611_0006836 3300046648 Bacteria 4846
252 Ga0495625_0045151 3300046660 Bacteria 3187
253 Ga0495625_0049905 3300046660 Bacteria 3006
254 Ga0495635_0010389 3300046663 Bacteria 6511
255 Ga0495659_0003267 3300046664 Bacteria 5198
256 Ga0495599_0014544 3300046678 Bacteria 4873
257 Ga0495599_0021809 3300046678 Bacteria 3998
258 Ga0495599_0102948 3300046678 Bacteria 1779
259 Ga0495623_0108499 3300046679 Bacteria 1685
260 Ga0495646_0055872 3300046680 Bacteria 2368
261 Ga0495658_0012048 3300046683 Bacteria 4367
262 Ga0495658_0050046 3300046683 Bacteria 2362
263 Ga0495613_0016200 3300046689 Bacteria 5553
264 Ga0495613_0106297 3300046689 Bacteria 2025
265 Ga0495613_0132395 3300046689 Bacteria 1785
266 Ga0495624_0016135 3300046690 Bacteria 5030
267 Ga0495624_0029824 3300046690 Bacteria 3556
268 Ga0495670_0014282 3300046691 Bacteria 3907
269 Ga0495670_0041786 3300046691 Bacteria 2288
270 Ga0495649_0011955 3300046694 Bacteria 5072
271 Ga0495649_0068381 3300046694 Bacteria 1906
272 Ga0495600_0060635 3300046809 Bacteria 2470
273 Ga0495581_0010404 3300047315 Bacteria 5381
274 Ga0495604_0018599 3300047317 Bacteria 5566
275 Ga0495674_0019944 3300047319 Bacteria 6214
276 Ga0495674_0027087 3300047319 Bacteria 5242
277 Ga0495674_0041516 3300047319 Bacteria 4108
278 Ga0495672_0044770 3300047320 Bacteria 2652
279 Ga0495676_0049397 3300047321 Bacteria 3383
280 Ga0495676_0092553 3300047321 Bacteria 2257
281 Ga0495680_0146179 3300047322 Bacteria 1726
282 Ga0495677_0044688 3300047445 Bacteria 1624
283 Ga0495684_0009496 3300047471 Bacteria 7504
284 Ga0495684_0021641 3300047471 Bacteria 4951
285 Ga0495686_0010030 3300047472 Bacteria 6766
286 Ga0495686_0085427 3300047472 Bacteria 1922
287 Ga0495593_0001099 3300047673 Bacteria 15770
288 Ga0495593_0007286 3300047673 Bacteria 6478
289 Ga0495602_0095520 3300048088 Bacteria 2453
290 Ga0496100_0007394 3300048903 Bacteria 6059
291 Ga0496101_0002285 3300048904 Bacteria 11704
292 Ga0496102_0001763 3300048905 Bacteria 18847
293 Ga0496104_0004092 3300048907 Bacteria 12653
294 Ga0496104_0066854 3300048907 Bacteria 3413
295 Ga0496104_0143224 3300048907 Bacteria 2296
296 Ga0496105_0023368 3300048908 Bacteria 5012
297 Ga0496105_0062799 3300048908 Bacteria 3065
298 Ga0496105_0100370 3300048908 Bacteria 2390
299 Ga0496105_0308619 3300048908 Bacteria 1271
300 Ga0496106_0027973 3300048909 Bacteria 4197
301 Ga0496106_0084034 3300048909 Bacteria 2449
302 Ga0496107_0014937 3300048910 Bacteria 5438
303 Ga0496107_0189550 3300048910 Bacteria 1527
304 Ga0496108_0013291 3300048911 Bacteria 6711
305 Ga0496108_0181579 3300048911 Bacteria 1822
306 Ga0496109_0019384 3300048912 Bacteria 5998
307 Ga0496109_0240178 3300048912 Bacteria 1705
308 Ga0496110_0025516 3300048913 Bacteria 5051
309 Ga0496110_0090605 3300048913 Bacteria 2734
310 Ga0496111_0034658 3300048914 Bacteria 3605
311 Ga0496111_0090773 3300048914 Bacteria 2238
312 Ga0496112_0011009 3300048915 Bacteria 8242
313 Ga0496112_0021320 3300048915 Bacteria 6160
314 Ga0496112_0026287 3300048915 Bacteria 5598
315 Ga0496113_0010227 3300048916 Bacteria 6194
316 Ga0496113_0036634 3300048916 Bacteria 3595
317 Ga0496113_0077055 3300048916 Bacteria 2548
318 Ga0496114_0025664 3300048917 Bacteria 4818
319 Ga0496114_0128586 3300048917 Bacteria 2186
320 Ga0496115_0000894 3300048918 Bacteria 21630
321 Ga0496115_0201976 3300048918 Bacteria 1642
322 Ga0496116_0022088 3300048919 Bacteria 4783
323 Ga0496118_0068886 3300048921 Bacteria 2567
324 Ga0496119_0034283 3300048922 Bacteria 3348
325 Ga0496119_0069738 3300048922 Bacteria 2065
326 Ga0496119_0072486 3300048922 Bacteria 2012
327 Ga0496121_0000285 3300048924 Bacteria 104880
328 Ga0496121_0016671 3300048924 Bacteria 7563
329 Ga0496121_0021499 3300048924 Bacteria 6316
330 Ga0496121_0034825 3300048924 Bacteria 4524
331 Ga0496124_0012217 3300048927 Bacteria 8495
332 Ga0496125_0024489 3300048928 Bacteria 5550
333 Ga0496125_0052164 3300048928 Bacteria 3365
334 Ga0496126_0014434 3300048929 Bacteria 7986
335 Ga0496126_0030150 3300048929 Bacteria 5143
336 Ga0496126_0146366 3300048929 Bacteria 2029
337 Ga0496126_0163635 3300048929 Bacteria 1900
338 Ga0496126_0193002 3300048929 Bacteria 1724
339 Ga0495682_0004061 3300049460 Bacteria 6366
340 Ga0501031_0091674 3300049568 Bacteria 1982
341 Ga0501032_0014271 3300049569 Bacteria 5628
342 Ga0501033_0003682 3300049570 Bacteria 12469
343 Ga0501037_0000773 3300049573 Bacteria 24066
344 Ga0501038_0005830 3300049574 Bacteria 11394
345 Ga0501039_0005692 3300049575 Bacteria 9440
346 Ga0501043_0008414 3300049579 Bacteria 8125
347 Ga0501046_0019536 3300049580 Bacteria 5618
348 Ga0501068_0099841 3300049584 Bacteria 1798
349 Ga0501035_0001412 3300049822 Bacteria 24616
350 Ga0501044_0063642 3300049823 Bacteria 3768
351 nmdc:mga0yw44_25594_c1 3300050492 Bacteria 3358
352 nmdc:mga0yw44_51591_c1 3300050492 Bacteria 2491
353 nmdc:mga08y16_37480_c1 3300050511 Bacteria 5091
354 Ga0495601_0041929 3300053077 Bacteria 2870
355 Ga0495601_0148511 3300053077 Bacteria 1530
356 Ga0495612_0008508 3300053078 Bacteria 4161
357 Ga0495612_0018128 3300053078 Bacteria 2818
358 Ga0495595_0050459 3300053084 Bacteria 1927
359 Ga0500647_0021574 3300053091 Bacteria 3006
360 Ga0500641_0029665 3300053096 Bacteria 2144
361 Ga0500595_001341 3300053119 Bacteria 13308
362 Ga0500595_001691 3300053119 Bacteria 11581
363 Ga0500595_010863 3300053119 Bacteria 3594
364 Ga0500642_0013509 3300053130 Bacteria 3005
365 Ga0500561_0006830 3300053137 Bacteria 2196
366 Ga0500561_0011604 3300053137 Bacteria 1858
367 Ga0500577_0046928 3300053142 Bacteria 1603
368 Ga0500622_0008020 3300053156 Bacteria 5943
369 Ga0500634_0038226 3300053161 Bacteria 2610
370 Ga0500636_0072049 3300053177 Bacteria 2003
371 Ga0500645_008652 3300053730 Bacteria 3457
372 Ga0501084_0327081 3300054114 Bacteria 1295
373 2513643679 2513237094 Bacteria 8789602
374 2513671920 2513237098 Bacteria 9902361
375 2524437213 2524023205 Bacteria 8918781
376 2524463767 2524023210 Bacteria 9029266
377 2524541691 2524023228 Bacteria 10118060
378 2528850068 2528768022 Bacteria 10457665
379 2723846680 2721755755 Bacteria 8322773
380 2745076432 2744054633 Bacteria 8678936
381 2824665989 2824661429 Bacteria 9877870
382 2876763948 2876761206 Bacteria 10111113
383 2876816564 2876808645 Bacteria 8824342
384 2879103919 2879099564 Bacteria 10442239
385 2879115000 2879110137 Bacteria 8907982
386 2885387245 2885383462 Bacteria 9473874
387 2889040886 2889033259 Bacteria 9099371
388 2903771202 2903768456 Bacteria 9749579
389 2904694347 2904690495 Bacteria 9412302
390 2906643065 2906635258 Bacteria 8601019
391 2906661955 2906660503 Bacteria 8595048
392 2922373901
393 2929617608 2929615660 Bacteria 9193770
394 2929627313 2929624759 Bacteria 9339455
395 2932787345 2932784394 Bacteria 9704911
396 2932815200 2932809354 Bacteria 9135765
397 2932820602 2932818245 Bacteria 9955613
398 2932831653 2932828146 Bacteria 9745859
399 2933579564 2933577622 Bacteria 9116884
400 2935622295 2935616580 Bacteria 9032984
401 2935642934 2935638405 Bacteria 10015038
402 2935668035 2935665750 Bacteria 9571747
403 2935678893 2935675223 Bacteria 9928132
404 2935688784 2935684952 Bacteria 9590419
405 2935696137 2935694250 Bacteria 9291695
406 2935706904 2935703347 Bacteria 10242284
407 2935715803 2935713505 Bacteria 9608509
408 2935725633 2935722832 Bacteria 9608746
409 2935738088 2935732158 Bacteria 9706831
410 2935747463 2935741537 Bacteria 9707219
411 2935753962 2935750917 Bacteria 9590372
412 2935762967 2935760218 Bacteria 9817913
413 2935808554 2935801545 Bacteria 9301974
414 2935812750 2935810662 Bacteria 9401221
415 2935830401 2935827899 Bacteria 10038562
416 2935840432 2935837841 Bacteria 9454360
417 2935860637 2935855204 Bacteria 9035059
418 2935865330 2935864058 Bacteria 9784707
419 2935877926 2935873716 Bacteria 9632195
420 2935996122 2935992306 Bacteria 9802711
421 2936006256 2936002035 Bacteria 9362176
422 2936041338 2936037263 Bacteria 9446081
423 2940560662 2940556831 Bacteria 9590747
424 2941541437 2941538514 Bacteria 9402094
425 3005712856 3005710791 Bacteria 7622528
426 8006985580 8006984368 Bacteria 9651211
427 8016587374 8016583857 Bacteria 10421953
428 8017062690 8017057580 Bacteria 10023680
429 8019582095 8019576017 Bacteria 10049540
430 8019589781 8019586578 Bacteria 10212056
431 8019617065 8019608314 Bacteria 10042931
432 8055746777 8055742211 Bacteria 9226248
433 8056973180 8056967851 Bacteria 9038162
434 Ga0157375_10037859
435 JGI25153J46596_10001700
436 JGI25160J50197_1000954
437 Ga0070658_10011820
438 Ga0070658_10041261
439 Ga0070683_100000244
440 Ga0070683_100038701
441 Ga0070680_100000715
442 Ga0070660_100001964
443 Ga0070691_10060095
444 Ga0070709_10000274
445 Ga0070714_100002601
446 Ga0070713_100028315
447 Ga0070710_10000279
448 Ga0070711_100000568
449 Ga0070711_100005497
450 Ga0070678_100103997
451 Ga0070681_10031480
452 Ga0070706_100050349
453 Ga0070698_100212144
454 Ga0070679_100020332
455 Ga0070679_100107246
456 Ga0070684_100001779
457 Ga0070684_100067288
458 Ga0070697_100013347
459 Ga0070695_100173175
460 Ga0070665_100011784
461 Ga0068855_100024006
462 Ga0068855_100048340
463 Ga0068857_100005328
464 Ga0068859_100029372
465 Ga0068866_10041952
466 Ga0068851_10003440
467 Ga0068870_10037345
468 Ga0068860_100000223
469 Ga0068862_100009704
470 Ga0081540_1003096
471 Ga0081540_1006280
472 Ga0081540_1009914
473 Ga0097621_100263649
474 Ga0097620_100029369
475 Ga0099794_10020651
476 Ga0099795_10000287
477 Ga0099795_10007224
478 Ga0099795_10030700
479 Ga0105240_10003096
480 Ga0105240_10269329
481 Ga0111539_10041179
482 Ga0105245_10029481
483 Ga0105243_10162565
484 Ga0105243_10317470
485 Ga0105241_10034894
486 Ga0105242_10087361
487 Ga0105242_10149751
488 Ga0105248_10177054
489 Ga0105237_10002350
490 Ga0105237_10015172
491 Ga0105237_10331344
492 Ga0105238_10000408
493 Ga0105238_10005340
494 Ga0105238_10297603
495 Ga0105249_10211828
496 Ga0099796_10000343
497 Ga0099796_10002003
498 Ga0105239_10026031
499 Ga0105239_10039905
500 Ga0105239_10049244
501 Ga0105239_10239805
502 Ga0105246_10006978
503 Ga0105246_10141625
504 Ga0105246_10206284
505 Ga0157370_10001125
506 Ga0157369_10000685
507 Ga0157369_10029295
508 Ga0157369_10333207
509 Ga0157374_10045871
510 Ga0163162_10045627
511 Ga0163162_10114575
512 Ga0163162_10140413
513 Ga0163162_10363492
514 Ga0157375_10060979
515 Ga0163163_10139360
516 Ga0157380_10028059
517 Ga0157376_10301175
518 Ga0209148_1001243
519 Ga0209233_1016756
520 Ga0209455_1002061
521 Ga0209673_1011522
522 Ga0209564_1003985
523 Ga0209758_1003003
524 Ga0207426_1000596
525 Ga0207656_10005202
526 Ga0207692_10002196
527 Ga0207642_10076278
528 Ga0207699_10000285
529 Ga0207643_10016657
530 Ga0207705_10021164
531 Ga0207684_10029390
532 Ga0207707_10000126
533 Ga0207707_10058791
534 Ga0207671_10030990
535 Ga0207671_10167986
536 Ga0207693_10038436
537 Ga0207663_10001369
538 Ga0207663_10005276
539 Ga0207660_10008935
540 Ga0207657_10000261
541 Ga0207652_10000994
542 Ga0207652_10053657
543 Ga0207694_10008232
544 Ga0207694_10012454
545 Ga0207687_10032821
546 Ga0207700_10020158
547 Ga0207664_10004606
548 Ga0207686_10079656
549 Ga0207670_10124811
550 Ga0207704_10053561
551 Ga0207689_10001027
552 Ga0207689_10008518
553 Ga0207661_10002724
554 Ga0207661_10053812
555 Ga0207679_10038975
556 Ga0207667_10005359
557 Ga0207712_10046408
558 Ga0207668_10011846
559 Ga0207668_10197720
560 Ga0207677_10042872
561 Ga0207678_10041283
562 Ga0207708_10127713
563 Ga0207674_10009856
564 Ga0207674_10112820
565 Ga0207675_100222706
566 Ga0207683_10016561
567 Ga0209588_1004144
568 Ga0209588_1006036
569 Ga0207428_10072284
570 Ga0268266_10039229
571 Ga0268265_10013835
572 Ga0268265_10018753
573 Ga0268264_10000119
574 Ga0268264_10036226
575 Ga0307517_10000042
576 Ga0307511_10077277
577 Ga0307513_10127371
578 Ga0307509_10003603
579 Ga0307509_10038766
580 Ga0307408_100025649
581 Ga0307508_10000020
582 Ga0307508_10075255
583 Ga0316576_10146360
584 Ga0307516_10000729
585 Ga0307516_10169497
586 Ga0307410_10097995
587 Ga0307412_10111037
588 Ga0307409_100159503
589 Ga0307416_100065481
590 Ga0307416_100179650
591 Ga0307415_100120500
592 Ga0307415_100188299
593 Ga0307510_10012646
594 Ga0307510_10015257
595 Ga0307510_10029443
596 Ga0373926_0003365
597 Ga0373934_0000416
598 Ga0373923_0005317
599 Ga0373936_0014679
600 Ga0373941_0022667
601 Ga0373953_0000591
602 Ga0373954_0015451
603 Ga0373956_0041574
604 Ga0373957_0003641
605 Ga0373957_0034917
606 Ga0373943_0025983
607 Ga0373946_0013680
608 Ga0373955_0018499
609 Ga0316574_0007473
610 Ga0373931_0001003
611 Ga0373935_0009394
612 Ga0373935_0012912
613 Ga0373935_0021698
614 Ga0373927_0005631
615 Ga0373927_0034859
616 Ga0373927_0041697
617 Ga0373927_0086399
618 Ga0373927_0128914
619 Ga0373933_0005519
620 Ga0373947_0004362
621 Ga0373947_0011419
622 Ga0373937_0157498
623 Ga0316584_0098171
624 Ga0373925_0017541
625 Ga0373925_0025755
626 Ga0373925_0105755
627 Ga0395900_0065602
628 Ga0436362_1248907
629 Ga0451800_0242243
630 Ga0466967_0064649
631 Ga0466967_0131276
632 Ga0495592_0045136
633 Ga0495603_0008149
634 Ga0495603_0008261
635 Ga0495603_0012784
636 Ga0495603_0052413
637 Ga0495629_0003064
638 Ga0495629_0014461
639 Ga0495629_0153701
640 Ga0495638_0056712
641 Ga0495638_0063382
642 Ga0495641_0009688
643 Ga0495653_0000973
644 Ga0495580_0016285
645 Ga0495582_0011061
646 Ga0495582_0018118
647 Ga0495639_0002404
648 Ga0495639_0002540
649 Ga0495639_0101336
650 Ga0495662_0006309
651 Ga0495664_0009904
652 Ga0495664_0019941
653 Ga0495664_0082686
654 Ga0495585_0017150
655 Ga0495594_0013373
656 Ga0495594_0015536
657 Ga0495618_0013565
658 Ga0495618_0064125
659 Ga0495618_0140271
660 Ga0495628_0017122
661 Ga0495628_0122885
662 Ga0495628_0284775
663 Ga0495630_0030968
664 Ga0495632_0036009
665 Ga0495632_0143497
666 Ga0495648_0006026
667 Ga0495648_0049786
668 Ga0495666_0023202
669 Ga0495652_0182408
670 Ga0495665_0012227
671 Ga0495640_0013911
672 Ga0495640_0062555
673 Ga0495609_0034148
674 Ga0495609_0050036
675 Ga0495645_0003423
676 Ga0495645_0033692
677 Ga0495645_0072743
678 Ga0495622_0028937
679 Ga0495667_0012793
680 Ga0495667_0032789
681 Ga0495634_0019249
682 Ga0495634_0026774
683 Ga0495634_0030906
684 Ga0495611_0006836
685 Ga0495625_0045151
686 Ga0495625_0049905
687 Ga0495635_0010389
688 Ga0495659_0003267
689 Ga0495599_0014544
690 Ga0495599_0021809
691 Ga0495599_0102948
692 Ga0495623_0108499
693 Ga0495646_0055872
694 Ga0495658_0012048
695 Ga0495658_0050046
696 Ga0495613_0016200
697 Ga0495613_0106297
698 Ga0495613_0132395
699 Ga0495624_0016135
700 Ga0495624_0029824
701 Ga0495670_0014282
702 Ga0495670_0041786
703 Ga0495649_0011955
704 Ga0495649_0068381
705 Ga0495600_0060635
706 Ga0495581_0010404
707 Ga0495604_0018599
708 Ga0495674_0019944
709 Ga0495674_0027087
710 Ga0495674_0041516
711 Ga0495672_0044770
712 Ga0495676_0049397
713 Ga0495676_0092553
714 Ga0495680_0146179
715 Ga0495677_0044688
716 Ga0495684_0009496
717 Ga0495684_0021641
718 Ga0495686_0010030
719 Ga0495686_0085427
720 Ga0495593_0001099
721 Ga0495593_0007286
722 Ga0495602_0095520
723 Ga0496100_0007394
724 Ga0496101_0002285
725 Ga0496102_0001763
726 Ga0496104_0004092
727 Ga0496104_0066854
728 Ga0496104_0143224
729 Ga0496105_0023368
730 Ga0496105_0062799
731 Ga0496105_0100370
732 Ga0496105_0308619
733 Ga0496106_0027973
734 Ga0496106_0084034
735 Ga0496107_0014937
736 Ga0496107_0189550
737 Ga0496108_0013291
738 Ga0496108_0181579
739 Ga0496109_0019384
740 Ga0496109_0240178
741 Ga0496110_0025516
742 Ga0496110_0090605
743 Ga0496111_0034658
744 Ga0496111_0090773
745 Ga0496112_0011009
746 Ga0496112_0021320
747 Ga0496112_0026287
748 Ga0496113_0010227
749 Ga0496113_0036634
750 Ga0496113_0077055
751 Ga0496114_0025664
752 Ga0496114_0128586
753 Ga0496115_0000894
754 Ga0496115_0201976
755 Ga0496116_0022088
756 Ga0496118_0068886
757 Ga0496119_0034283
758 Ga0496119_0069738
759 Ga0496119_0072486
760 Ga0496121_0000285
761 Ga0496121_0016671
762 Ga0496121_0021499
763 Ga0496121_0034825
764 Ga0496124_0012217
765 Ga0496125_0024489
766 Ga0496125_0052164
767 Ga0496126_0014434
768 Ga0496126_0030150
769 Ga0496126_0146366
770 Ga0496126_0163635
771 Ga0496126_0193002
772 Ga0495682_0004061
773 Ga0501031_0091674
774 Ga0501032_0014271
775 Ga0501033_0003682
776 Ga0501037_0000773
777 Ga0501038_0005830
778 Ga0501039_0005692
779 Ga0501043_0008414
780 Ga0501046_0019536
781 Ga0501068_0099841
782 Ga0501035_0001412
783 Ga0501044_0063642
784 nmdc:mga0yw44_25594_c1
785 nmdc:mga0yw44_51591_c1
786 nmdc:mga08y16_37480_c1
787 Ga0495601_0041929
788 Ga0495601_0148511
789 Ga0495612_0008508
790 Ga0495612_0018128
791 Ga0495595_0050459
792 Ga0500647_0021574
793 Ga0500641_0029665
794 Ga0500595_001341
795 Ga0500595_001691
796 Ga0500595_010863
797 Ga0500642_0013509
798 Ga0500561_0006830
799 Ga0500561_0011604
800 Ga0500577_0046928
801 Ga0500622_0008020
802 Ga0500634_0038226
803 Ga0500636_0072049
804 Ga0500645_008652
805 Ga0501084_0327081
806 2513643679
807 2513671920
808 2524437213
809 2524463767
810 2524541691
811 2528850068
812 2723846680
813 2745076432
814 2824665989
815 2876763948
816 2876816564
817 2879103919
818 2879115000
819 2885387245
820 2889040886
821 2903771202
822 2904694347
823 2906643065
824 2906661955
825 2922373901
826 2929617608
827 2929627313
828 2932787345
829 2932815200
830 2932820602
831 2932831653
832 2933579564
833 2935622295
834 2935642934
835 2935668035
836 2935678893
837 2935688784
838 2935696137
839 2935706904
840 2935715803
841 2935725633
842 2935738088
843 2935747463
844 2935753962
845 2935762967
846 2935808554
847 2935812750
848 2935830401
849 2935840432
850 2935860637
851 2935865330
852 2935877926
853 2935996122
854 2936006256
855 2936041338
856 2940560662
857 2941541437
858 3005712856
859 8006985580
860 8016587374
861 8017062690
862 8019582095
863 8019589781
864 8019617065
865 8055746777
866 8056973180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00871

Acetate_kinase

Acetokinase family

6

387

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.8705 1 384
6ioy-assembly2.cif.gz_C crystal structure of porphyromonas gingivalis acetate kinase 0.8653 1 388
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.8579 1 384
4iz9-assembly1.cif.gz_A-2 crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese 0.8538 2 389
4ijn-assembly1.cif.gz_B crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate 0.8485 3 384
ID Description Score Start End Superfamily
4dq8B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8772 1 192 3.30.420.40
2iirA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8744 2 193 3.30.420.40
3khyB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8623 2 193 3.30.420.40
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.862 201 389 3.30.420.40
4dq8B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8583 1 192 3.30.420.40
ID Description Score Start End GO Terms
AF-C4YWP3-F1-model_v4 Acetate kinase (EC 2.7.2.1) 0.9581 279 388 GO:0006083
GO:0008776
AF-A0A257MZU7-F1-model_v4 Acetate kinase 0.9568 2 144 GO:0005524
GO:0006083
GO:0008776
GO:0047761
AF-A0A2D8B7I3-F1-model_v4 deleted 0.9521 2 186
AF-A0A356HIE3-F1-model_v4 deleted 0.9514 2 193
AF-A0A3N5EPQ3-F1-model_v4 Acetate kinase 0.9494 274 390 GO:0005829
GO:0006083
GO:0008776

Map