F442844

General Info

Members Datasets Scaffolds Average Seq Length
433 236 425 367

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10033410|Ga0157380_100334102
Length 422
Sequence LKLPTRGKRGDPHGSSSSRAQHGPHGRASVGDNPEHVSRQDSRDSIGAVSSPMSMALVTPAPGPTSGEAPSRSTGFGTTVFDVIAPEAVGRRRGPESAFDVCHVGVVLRALLFVHATMAIGMVFGAATFATWLSMTAAGASVALPGVLIWLLVVCALKAQLTRAPLALQWLVVIGLGAVAALGASQLILAVVPDAASAGLASLLGAGPALAGAAMAAAIFQWLRLLAQATLPAETTARLAELQSRIRPHFLFNTLNTALTLVRLDPGKAEGVLEDLAELFRVAIAESAESVSLGEEVDLAQRYLDIEQIRFGSRLHVTWELDPQAASARVPPLLLQPLVENAVRHGVEPSPEGGVIRVRTKVKLGRAVLSIANSVPKEPSRPGHGMALKNVRERLRLMHDVAAQFEMRQDEDVFRVQIVVPL

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221660 Methylibium sp. Root1272 Isolate Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
215 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
228 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 0
Rhizoplane 4.16
Rhizosphere 79.91
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003968 3300002773 Bacteria 4831
2 JGI25153J46596_10013898 3300003215 Bacteria 3378
3 JGI25153J46596_10013946 3300003215 Unclassified 3370
4 rootH1_10016312 3300003316 Bacteria 1898
5 rootL2_10178597 3300003322 Bacteria 1924
6 Ga0055526_1001909 3300003771 Bacteria 14438
7 Ga0065165_1005423 3300005262 Bacteria 7180
8 Ga0070658_10027033 3300005327 Bacteria 4607
9 Ga0070658_10078185 3300005327 Bacteria 2715
10 Ga0070676_10001611 3300005328 Bacteria 11473
11 Ga0070676_10006499 3300005328 Bacteria 6245
12 Ga0070676_10007770 3300005328 Bacteria 5760
13 Ga0070676_10024955 3300005328 Bacteria 3374
14 Ga0070683_100026824 3300005329 Bacteria 5191
15 Ga0070690_100061366 3300005330 Bacteria 2422
16 Ga0070670_100043165 3300005331 Bacteria 3876
17 Ga0070670_100301184 3300005331 Bacteria 1402
18 Ga0070670_100308750 3300005331 Bacteria 1384
19 Ga0070677_10009064 3300005333 Bacteria 3368
20 Ga0070677_10017911 3300005333 Bacteria 2543
21 Ga0070677_10020757 3300005333 Bacteria 2398
22 Ga0068869_100006643 3300005334 Bacteria 7345
23 Ga0068869_100008107 3300005334 Bacteria 6756
24 Ga0068869_100019365 3300005334 Bacteria 4648
25 Ga0068869_100158640 3300005334 Bacteria 1760
26 Ga0068869_100171399 3300005334 Bacteria 1696
27 Ga0070666_10000601 3300005335 Bacteria 21615
28 Ga0070680_100039594 3300005336 Bacteria 3813
29 Ga0068868_100006388 3300005338 Bacteria 8338
30 Ga0068868_100010447 3300005338 Bacteria 6721
31 Ga0068868_100010849 3300005338 Bacteria 6610
32 Ga0068868_100083797 3300005338 Bacteria 2560
33 Ga0068868_100162423 3300005338 Bacteria 1845
34 Ga0070660_100130246 3300005339 Bacteria 2012
35 Ga0070687_100011936 3300005343 Bacteria 3819
36 Ga0070661_100130875 3300005344 Bacteria 1884
37 Ga0070692_10020138 3300005345 Bacteria 3231
38 Ga0070668_100006370 3300005347 Bacteria 8745
39 Ga0070668_100040485 3300005347 Bacteria 3566
40 Ga0070669_100005118 3300005353 Bacteria 9479
41 Ga0070669_100088415 3300005353 Bacteria 2319
42 Ga0070675_100002437 3300005354 Bacteria 13893
43 Ga0070675_100002524 3300005354 Bacteria 13700
44 Ga0070675_100024456 3300005354 Bacteria 4837
45 Ga0070675_100041283 3300005354 Bacteria 3768
46 Ga0070675_100199485 3300005354 Bacteria 1736
47 Ga0070675_100287382 3300005354 Bacteria 1447
48 Ga0070671_100010869 3300005355 Bacteria 7306
49 Ga0070671_100012416 3300005355 Bacteria 6858
50 Ga0070671_100033458 3300005355 Bacteria 4252
51 Ga0070671_100040666 3300005355 Bacteria 3862
52 Ga0070671_100131039 3300005355 Bacteria 2112
53 Ga0070674_100012099 3300005356 Bacteria 5287
54 Ga0070674_100025061 3300005356 Bacteria 3878
55 Ga0070673_100002831 3300005364 Bacteria 10677
56 Ga0070673_100005638 3300005364 Bacteria 8036
57 Ga0070673_100020631 3300005364 Bacteria 4755
58 Ga0070673_100053157 3300005364 Bacteria 3180
59 Ga0070673_100157207 3300005364 Bacteria 1930
60 Ga0070659_100127595 3300005366 Bacteria 2064
61 Ga0070667_100002909 3300005367 Bacteria 14715
62 Ga0070667_100011298 3300005367 Bacteria 7386
63 Ga0070667_100062168 3300005367 Bacteria 3162
64 Ga0070667_100178598 3300005367 Bacteria 1877
65 Ga0070663_100001718 3300005455 Bacteria 12149
66 Ga0070663_100003146 3300005455 Bacteria 9463
67 Ga0070678_100001353 3300005456 Bacteria 13046
68 Ga0070678_100007938 3300005456 Bacteria 6322
69 Ga0070678_100225881 3300005456 Bacteria 1558
70 Ga0070662_100001682 3300005457 Bacteria 13598
71 Ga0070662_100084084 3300005457 Bacteria 2376
72 Ga0070681_10070808 3300005458 Bacteria 3452
73 Ga0068867_100000118 3300005459 Bacteria 50315
74 Ga0068867_100010409 3300005459 Bacteria 6562
75 Ga0068867_100013383 3300005459 Bacteria 5812
76 Ga0068867_100015223 3300005459 Bacteria 5454
77 Ga0068867_100018936 3300005459 Bacteria 4900
78 Ga0068867_100026546 3300005459 Bacteria 4159
79 Ga0068867_100066655 3300005459 Bacteria 2682
80 Ga0070706_100000965 3300005467 Bacteria 31374
81 Ga0070699_100123620 3300005518 Bacteria 2277
82 Ga0070679_100048911 3300005530 Bacteria 4212
83 Ga0068853_100169891 3300005539 Bacteria 1972
84 Ga0070672_100003437 3300005543 Bacteria 10261
85 Ga0070672_100003887 3300005543 Bacteria 9733
86 Ga0070672_100006503 3300005543 Bacteria 7853
87 Ga0070672_100007981 3300005543 Bacteria 7231
88 Ga0070672_100008749 3300005543 Bacteria 6949
89 Ga0070672_100030004 3300005543 Bacteria 4082
90 Ga0070672_100079552 3300005543 Bacteria 2624
91 Ga0070693_100149857 3300005547 Bacteria 1476
92 Ga0070665_100024704 3300005548 Bacteria 6054
93 Ga0070665_100078421 3300005548 Bacteria 3309
94 Ga0068855_100034936 3300005563 Bacteria 5990
95 Ga0070664_100188926 3300005564 Bacteria 1835
96 Ga0068857_100053448 3300005577 Bacteria 3583
97 Ga0068857_100056743 3300005577 Bacteria 3475
98 Ga0068854_100032217 3300005578 Bacteria 3645
99 Ga0068854_100206554 3300005578 Bacteria 1547
100 Ga0070702_100010660 3300005615 Bacteria 4539
101 Ga0068852_100013245 3300005616 Bacteria 6305
102 Ga0068852_100014306 3300005616 Bacteria 6103
103 Ga0068859_100311484 3300005617 Bacteria 1668
104 Ga0068864_100005532 3300005618 Bacteria 10357
105 Ga0068864_100021008 3300005618 Bacteria 5466
106 Ga0068864_100042789 3300005618 Bacteria 3876
107 Ga0068864_100076307 3300005618 Bacteria 2928
108 Ga0068864_100201942 3300005618 Bacteria 1827
109 Ga0068866_10044964 3300005718 Bacteria 2212
110 Ga0068861_100001984 3300005719 Bacteria 13218
111 Ga0068861_100004050 3300005719 Bacteria 9813
112 Ga0068851_10003613 3300005834 Bacteria 6896
113 Ga0068851_10019980 3300005834 Bacteria 3240
114 Ga0068870_10015312 3300005840 Bacteria 3636
115 Ga0068863_100008538 3300005841 Bacteria 10009
116 Ga0068863_100020081 3300005841 Bacteria 6391
117 Ga0068863_100368980 3300005841 Bacteria 1400
118 Ga0068858_100000366 3300005842 Bacteria 47603
119 Ga0068858_100003535 3300005842 Bacteria 15479
120 Ga0068860_100010516 3300005843 Bacteria 9149
121 Ga0068860_100012879 3300005843 Bacteria 8221
122 Ga0068860_100057768 3300005843 Bacteria 3689
123 Ga0068862_100014899 3300005844 Bacteria 6459
124 Ga0068862_100145685 3300005844 Bacteria 2105
125 Ga0075362_10005831 3300006177 Bacteria 4543
126 Ga0075367_10008921 3300006178 Bacteria 5218
127 Ga0075367_10013328 3300006178 Bacteria 4416
128 Ga0075367_10026931 3300006178 Bacteria 3265
129 Ga0075366_10003454 3300006195 Bacteria 8338
130 Ga0075366_10033486 3300006195 Bacteria 3027
131 Ga0075366_10043038 3300006195 Bacteria 2674
132 Ga0075366_10059805 3300006195 Bacteria 2263
133 Ga0097621_100039158 3300006237 Bacteria 3807
134 Ga0097621_100047833 3300006237 Bacteria 3467
135 Ga0097621_100110553 3300006237 Bacteria 2322
136 Ga0075370_10012739 3300006353 Bacteria 4452
137 Ga0075370_10031975 3300006353 Bacteria 2939
138 Ga0068871_100022996 3300006358 Bacteria 4813
139 Ga0068871_100091970 3300006358 Bacteria 2529
140 Ga0068871_100243500 3300006358 Bacteria 1564
141 Ga0075429_100001726 3300006880 Bacteria 18078
142 Ga0068865_100105504 3300006881 Bacteria 2070
143 Ga0097620_100311478 3300006931 Bacteria 1668
144 Ga0105240_10079271 3300009093 Bacteria 4042
145 Ga0105245_10100343 3300009098 Bacteria 2677
146 Ga0105243_10001408 3300009148 Bacteria 21265
147 Ga0105241_10217759 3300009174 Bacteria 1603
148 Ga0105242_10228492 3300009176 Bacteria 1666
149 Ga0105248_10002745 3300009177 Bacteria 19554
150 Ga0105248_10003694 3300009177 Bacteria 16961
151 Ga0105248_10073729 3300009177 Bacteria 3836
152 Ga0105248_10322074 3300009177 Bacteria 1741
153 Ga0105237_10001582 3300009545 Bacteria 29631
154 Ga0105237_10098029 3300009545 Bacteria 2922
155 Ga0105237_10272678 3300009545 Bacteria 1695
156 Ga0105238_10002762 3300009551 Bacteria 17514
157 Ga0105238_10016418 3300009551 Bacteria 7496
158 Ga0105249_10004419 3300009553 Bacteria 12156
159 Ga0105239_10001198 3300010375 Bacteria 35468
160 Ga0105239_10137437 3300010375 Bacteria 2721
161 Ga0157369_10065369 3300013105 Bacteria 3914
162 Ga0157374_10014987 3300013296 Bacteria 6793
163 Ga0157374_10086987 3300013296 Bacteria 2974
164 Ga0163162_10037870 3300013306 Bacteria 4813
165 Ga0163162_10065499 3300013306 Bacteria 3680
166 Ga0163162_10283684 3300013306 Bacteria 1788
167 Ga0157372_10063647 3300013307 Bacteria 4137
168 Ga0157372_10107189 3300013307 Bacteria 3197
169 Ga0157375_10007448 3300013308 Bacteria 9577
170 Ga0157375_10020991 3300013308 Bacteria 5979
171 Ga0157375_10090976 3300013308 Bacteria 3111
172 Ga0157375_10139441 3300013308 Bacteria 2551
173 Ga0157375_10197714 3300013308 Bacteria 2166
174 Ga0157375_10310855 3300013308 Bacteria 1740
175 Ga0163163_10113073 3300014325 Bacteria 2745
176 Ga0157380_10018324 3300014326 Bacteria 5195
177 Ga0157380_10033410 3300014326 Bacteria 3961
178 Ga0157377_10000343 3300014745 Bacteria 20731
179 Ga0157377_10008399 3300014745 Bacteria 5035
180 Ga0157379_10017039 3300014968 Bacteria 6396
181 Ga0157379_10025223 3300014968 Bacteria 5279
182 Ga0157379_10027564 3300014968 Bacteria 5058
183 Ga0157379_10119755 3300014968 Bacteria 2367
184 Ga0157379_10196071 3300014968 Bacteria 1825
185 Ga0157376_10052161 3300014969 Bacteria 3400
186 Ga0157376_10076841 3300014969 Bacteria 2854
187 Ga0163161_10022192 3300017792 Bacteria 4467
188 Ga0163161_10023866 3300017792 Bacteria 4316
189 Ga0163161_10144965 3300017792 Bacteria 1800
190 Ga0209129_1000043 3300025258 Bacteria 298978
191 Ga0209673_1004179 3300025273 Bacteria 7882
192 Ga0209673_1023364 3300025273 Bacteria 2108
193 Ga0209564_1000014 3300025295 Bacteria 621501
194 Ga0209758_1000307 3300025297 Bacteria 95192
195 Ga0209758_1000492 3300025297 Bacteria 64511
196 Ga0209050_1000493 3300025298 Bacteria 67885
197 Ga0207697_10012457 3300025315 Bacteria 3564
198 Ga0207656_10006768 3300025321 Bacteria 4142
199 Ga0207682_10003952 3300025893 Bacteria 6314
200 Ga0207682_10008190 3300025893 Bacteria 4145
201 Ga0207682_10016294 3300025893 Bacteria 2899
202 Ga0207682_10030894 3300025893 Bacteria 2148
203 Ga0207642_10034537 3300025899 Bacteria 2151
204 Ga0207688_10011790 3300025901 Bacteria 4755
205 Ga0207680_10114442 3300025903 Bacteria 1755
206 Ga0207645_10001578 3300025907 Bacteria 18608
207 Ga0207645_10005999 3300025907 Bacteria 8742
208 Ga0207645_10019747 3300025907 Bacteria 4414
209 Ga0207645_10022214 3300025907 Bacteria 4130
210 Ga0207643_10055608 3300025908 Bacteria 2250
211 Ga0207643_10097118 3300025908 Bacteria 1724
212 Ga0207705_10045377 3300025909 Bacteria 3158
213 Ga0207705_10061559 3300025909 Bacteria 2711
214 Ga0207684_10002804 3300025910 Bacteria 17330
215 Ga0207671_10001614 3300025914 Bacteria 25651
216 Ga0207671_10044427 3300025914 Bacteria 3286
217 Ga0207660_10092905 3300025917 Bacteria 2240
218 Ga0207662_10001240 3300025918 Bacteria 12250
219 Ga0207646_10014090 3300025922 Bacteria 7605
220 Ga0207681_10000634 3300025923 Bacteria 23457
221 Ga0207681_10009755 3300025923 Bacteria 5873
222 Ga0207650_10001855 3300025925 Bacteria 14901
223 Ga0207650_10009236 3300025925 Bacteria 6737
224 Ga0207650_10094766 3300025925 Bacteria 2288
225 Ga0207659_10002325 3300025926 Bacteria 11323
226 Ga0207659_10002524 3300025926 Bacteria 10891
227 Ga0207659_10008200 3300025926 Bacteria 6474
228 Ga0207659_10017565 3300025926 Bacteria 4674
229 Ga0207659_10018246 3300025926 Bacteria 4597
230 Ga0207659_10055118 3300025926 Bacteria 2842
231 Ga0207687_10161501 3300025927 Bacteria 1720
232 Ga0207644_10000264 3300025931 Bacteria 35311
233 Ga0207644_10003222 3300025931 Bacteria 10521
234 Ga0207644_10020670 3300025931 Bacteria 4480
235 Ga0207690_10004434 3300025932 Bacteria 8282
236 Ga0207706_10003415 3300025933 Bacteria 15171
237 Ga0207706_10094711 3300025933 Bacteria 2627
238 Ga0207709_10000850 3300025935 Bacteria 23364
239 Ga0207670_10031970 3300025936 Bacteria 3379
240 Ga0207670_10141362 3300025936 Bacteria 1776
241 Ga0207669_10044893 3300025937 Bacteria 2600
242 Ga0207704_10055821 3300025938 Bacteria 2416
243 Ga0207691_10005307 3300025940 Bacteria 12438
244 Ga0207691_10007010 3300025940 Bacteria 10872
245 Ga0207691_10031990 3300025940 Bacteria 4909
246 Ga0207691_10036993 3300025940 Bacteria 4521
247 Ga0207691_10045319 3300025940 Bacteria 4043
248 Ga0207691_10051561 3300025940 Bacteria 3761
249 Ga0207691_10323652 3300025940 Bacteria 1322
250 Ga0207691_10323797 3300025940 Bacteria 1321
251 Ga0207711_10001750 3300025941 Bacteria 19915
252 Ga0207711_10003373 3300025941 Bacteria 13834
253 Ga0207711_10025860 3300025941 Bacteria 4922
254 Ga0207711_10175952 3300025941 Bacteria 1944
255 Ga0207689_10003399 3300025942 Bacteria 14536
256 Ga0207689_10009456 3300025942 Bacteria 8415
257 Ga0207689_10022214 3300025942 Bacteria 5334
258 Ga0207689_10069500 3300025942 Bacteria 2894
259 Ga0207679_10034885 3300025945 Bacteria 3554
260 Ga0207679_10046298 3300025945 Bacteria 3152
261 Ga0207667_10066908 3300025949 Bacteria 3744
262 Ga0207651_10000726 3300025960 Bacteria 14099
263 Ga0207651_10016312 3300025960 Bacteria 4347
264 Ga0207651_10196866 3300025960 Bacteria 1611
265 Ga0207712_10012921 3300025961 Bacteria 5344
266 Ga0207668_10000316 3300025972 Bacteria 31416
267 Ga0207668_10008970 3300025972 Bacteria 5981
268 Ga0207668_10207683 3300025972 Bacteria 1564
269 Ga0207640_10006815 3300025981 Bacteria 6282
270 Ga0207658_10001493 3300025986 Bacteria 18184
271 Ga0207658_10003581 3300025986 Bacteria 10968
272 Ga0207658_10029135 3300025986 Bacteria 3895
273 Ga0207677_10001252 3300026023 Bacteria 13677
274 Ga0207677_10001906 3300026023 Bacteria 11016
275 Ga0207677_10027519 3300026023 Bacteria 3582
276 Ga0207677_10061989 3300026023 Bacteria 2592
277 Ga0207703_10000616 3300026035 Bacteria 36009
278 Ga0207703_10005986 3300026035 Bacteria 9744
279 Ga0207703_10017344 3300026035 Bacteria 5620
280 Ga0207678_10001164 3300026067 Bacteria 24067
281 Ga0207678_10023154 3300026067 Bacteria 5434
282 Ga0207678_10052464 3300026067 Bacteria 3518
283 Ga0207678_10194502 3300026067 Bacteria 1734
284 Ga0207708_10009445 3300026075 Bacteria 7222
285 Ga0207702_10043052 3300026078 Bacteria 3789
286 Ga0207702_10073130 3300026078 Bacteria 2955
287 Ga0207641_10004967 3300026088 Bacteria 11410
288 Ga0207641_10035633 3300026088 Bacteria 4147
289 Ga0207641_10258151 3300026088 Bacteria 1630
290 Ga0207648_10002014 3300026089 Bacteria 22175
291 Ga0207648_10011503 3300026089 Bacteria 8331
292 Ga0207648_10011543 3300026089 Bacteria 8318
293 Ga0207648_10038737 3300026089 Bacteria 4193
294 Ga0207648_10041423 3300026089 Bacteria 4044
295 Ga0207648_10176147 3300026089 Bacteria 1892
296 Ga0207648_10193910 3300026089 Bacteria 1801
297 Ga0207648_10312193 3300026089 Bacteria 1411
298 Ga0207676_10002431 3300026095 Bacteria 13264
299 Ga0207676_10237980 3300026095 Bacteria 1631
300 Ga0207674_10082149 3300026116 Bacteria 3224
301 Ga0207674_10191489 3300026116 Bacteria 1995
302 Ga0207674_10252352 3300026116 Bacteria 1711
303 Ga0207674_10271062 3300026116 Bacteria 1645
304 Ga0207675_100001106 3300026118 Bacteria 26680
305 Ga0207675_100009921 3300026118 Bacteria 8914
306 Ga0207683_10004615 3300026121 Bacteria 11873
307 Ga0207683_10022132 3300026121 Bacteria 5454
308 Ga0207683_10031584 3300026121 Bacteria 4596
309 Ga0207683_10047674 3300026121 Bacteria 3752
310 Ga0207698_10010883 3300026142 Bacteria 5873
311 Ga0268266_10108979 3300028379 Bacteria 2451
312 Ga0268265_10090730 3300028380 Bacteria 2441
313 Ga0268264_10017259 3300028381 Bacteria 5913
314 Ga0307517_10002551 3300028786 Bacteria 29003
315 Ga0307517_10098134 3300028786 Bacteria 2333
316 Ga0307515_10006463 3300028794 Bacteria 23455
317 Ga0307512_10053053 3300030522 Bacteria 3228
318 Ga0307513_10013819 3300031456 Bacteria 9897
319 Ga0307513_10107132 3300031456 Bacteria 2799
320 Ga0307513_10280678 3300031456 Bacteria 1443
321 Ga0307513_10296701 3300031456 Bacteria 1385
322 Ga0307509_10003013 3300031507 Bacteria 26337
323 Ga0307509_10006419 3300031507 Bacteria 15842
324 Ga0307408_100074907 3300031548 Bacteria 2513
325 Ga0307408_100083868 3300031548 Bacteria 2389
326 Ga0307508_10002994 3300031616 Bacteria 17413
327 Ga0307508_10038790 3300031616 Bacteria 4279
328 Ga0307514_10021350 3300031649 Bacteria 5278
329 Ga0307516_10009114 3300031730 Bacteria 11114
330 Ga0307410_10126606 3300031852 Bacteria 1871
331 Ga0307406_10008188 3300031901 Bacteria 5825
332 Ga0307407_10033602 3300031903 Bacteria 2800
333 Ga0307409_100004091 3300031995 Bacteria 8115
334 Ga0307409_100309524 3300031995 Bacteria 1473
335 Ga0307416_100011104 3300032002 Bacteria 5989
336 Ga0307416_100139269 3300032002 Bacteria 2202
337 Ga0307415_100065856 3300032126 Bacteria 2526
338 Ga0307507_10036366 3300033179 Bacteria 5034
339 Ga0307510_10001378 3300033180 Bacteria 26617
340 Ga0307510_10037621 3300033180 Bacteria 5367
341 Ga0373959_0003203 3300034820 Bacteria 2604
342 Ga0373928_0017469 3300035084 Bacteria 1477
343 Ga0373945_0018072 3300035116 Bacteria 2396
344 Ga0373943_0038902 3300035170 Bacteria 2289
345 Ga0373946_0117759 3300035171 Bacteria 1210
346 Ga0373955_0075688 3300035172 Bacteria 1892
347 Ga0373931_0003277 3300035691 Bacteria 7247
348 Ga0373937_0053732 3300036401 Bacteria 3695
349 Ga0373925_0038285 3300037068 Bacteria 3545
350 Ga0395905_0086338 3300037471 Bacteria 2940
351 Ga0436363_0646332 3300039450 Bacteria 4178
352 Ga0450907_020978 3300042146 Bacteria 1098
353 Ga0439460_0030126 3300042461 Bacteria 1541
354 Ga0451577_0210545 3300042876 Bacteria 1756
355 Ga0466972_0005034 3300044658 Bacteria 6624
356 Ga0495592_0000120 3300046454 Bacteria 69531
357 Ga0495592_0162779 3300046454 Bacteria 1534
358 Ga0495603_0108246 3300046455 Bacteria 1622
359 Ga0495629_0024318 3300046459 Bacteria 4313
360 Ga0495638_0100237 3300046460 Bacteria 1733
361 Ga0495580_0058490 3300046472 Bacteria 2711
362 Ga0495605_0080795 3300046474 Bacteria 1521
363 Ga0495664_0137110 3300046477 Bacteria 1483
364 Ga0495606_0152686 3300046507 Bacteria 1354
365 Ga0495630_0082662 3300046517 Bacteria 2424
366 Ga0495632_0032296 3300046519 Bacteria 2698
367 Ga0495632_0067290 3300046519 Bacteria 1728
368 Ga0495640_0077554 3300046533 Bacteria 2215
369 Ga0495597_0040554 3300046542 Bacteria 2081
370 Ga0495645_0025713 3300046543 Bacteria 4274
371 Ga0495625_0029797 3300046660 Bacteria 4078
372 Ga0495658_0010955 3300046683 Bacteria 4546
373 Ga0495624_0016572 3300046690 Bacteria 4960
374 Ga0495649_0002611 3300046694 Bacteria 12572
375 Ga0495600_0223243 3300046809 Bacteria 1205
376 Ga0495687_002945 3300047443 Bacteria 12931
377 Ga0495687_023820 3300047443 Bacteria 2919
378 Ga0495686_0000404 3300047472 Bacteria 68315
379 Ga0495686_0069278 3300047472 Bacteria 2175
380 Ga0496100_0147563 3300048903 Bacteria 1674
381 Ga0496102_0023399 3300048905 Bacteria 5487
382 Ga0496104_0017569 3300048907 Bacteria 6517
383 Ga0496104_0076693 3300048907 Bacteria 3184
384 Ga0496104_0077098 3300048907 Bacteria 3176
385 Ga0496105_0005943 3300048908 Bacteria 9313
386 Ga0496105_0048432 3300048908 Bacteria 3508
387 Ga0496106_0011177 3300048909 Bacteria 6642
388 Ga0496106_0030810 3300048909 Bacteria 3998
389 Ga0496108_0024318 3300048911 Bacteria 4986
390 Ga0496109_0022535 3300048912 Bacteria 5581
391 Ga0496109_0067571 3300048912 Bacteria 3275
392 Ga0496109_0087332 3300048912 Bacteria 2881
393 Ga0496111_0066537 3300048914 Bacteria 2617
394 Ga0496112_0004102 3300048915 Bacteria 12246
395 Ga0496113_0070376 3300048916 Bacteria 2659
396 Ga0496114_0048659 3300048917 Bacteria 3526
397 Ga0496115_0026311 3300048918 Bacteria 4540
398 Ga0501198_000004 3300049649 Bacteria 175146
399 Ga0501222_000095 3300049662 Bacteria 23714
400 nmdc:mga0k408_13334_c1 3300050493 Bacteria 4505
401 nmdc:mga0k408_18654_c1 3300050493 Bacteria 3875
402 nmdc:mga0k408_2872_c1 3300050493 Bacteria 9148
403 nmdc:mga07m45_128830_c1 3300050496 Bacteria 1464
404 nmdc:mga07m45_501_c1 3300050496 Bacteria 16602
405 nmdc:mga07m45_6744_c1 3300050496 Bacteria 5827
406 nmdc:mga07m45_77985_c1 3300050496 Bacteria 1890
407 nmdc:mga09592_1763_c1 3300050508 Bacteria 17376
408 nmdc:mga0qj67_27872_c2 3300050509 Bacteria 3974
409 nmdc:mga0sz30_36706_c1 3300050516 Bacteria 2049
410 Ga0495601_0057621 3300053077 Bacteria 2461
411 Ga0495619_0068172 3300053085 Bacteria 2376
412 Ga0500578_0000006 3300053086 Bacteria 234598
413 Ga0500646_0002363 3300053090 Bacteria 4902
414 Ga0500583_0090644 3300053092 Bacteria 1488
415 Ga0500651_0047532 3300053093 Bacteria 2697
416 Ga0500650_0076017 3300053098 Bacteria 1570
417 Ga0500594_0000567 3300053118 Bacteria 7978
418 Ga0500628_002413 3300053129 Bacteria 3097
419 Ga0500642_0068654 3300053130 Bacteria 1608
420 Ga0500652_000642 3300053131 Bacteria 11936
421 Ga0500658_0009957 3300053134 Bacteria 3506
422 Ga0500559_0000138 3300053136 Bacteria 56620
423 Ga0500590_044154 3300053148 Bacteria 2283
424 Ga0500604_0026382 3300053151 Bacteria 1675
425 Ga0500622_0000221 3300053156 Bacteria 59833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0077098 Ga0496104_0077098_1069_2085 311
2 3300048912 Ga0496109_0087332 Ga0496109_0087332_545_1561 311
3 3300048915 Ga0496112_0004102 Ga0496112_0004102_963_1979 311
4 3300048916 Ga0496113_0070376 Ga0496113_0070376_1096_2112 311
5 3300025908 Ga0207643_10097118 Ga0207643_100971182 323
6 3300005334 Ga0068869_100171399 Ga0068869_1001713991 327
7 3300005335 Ga0070666_10000601 Ga0070666_1000060119 327
8 3300005338 Ga0068868_100010849 Ga0068868_1000108494 327
9 3300005354 Ga0070675_100002437 Ga0070675_1000024376 327
10 3300005355 Ga0070671_100010869 Ga0070671_1000108699 327
11 3300005364 Ga0070673_100020631 Ga0070673_1000206314 327
12 3300005456 Ga0070678_100001353 Ga0070678_10000135310 327
13 3300005459 Ga0068867_100066655 Ga0068867_1000666552 327
14 3300005617 Ga0068859_100311484 Ga0068859_1003114842 327
15 3300005618 Ga0068864_100005532 Ga0068864_10000553210 327
16 3300005718 Ga0068866_10044964 Ga0068866_100449642 327
17 3300005834 Ga0068851_10019980 Ga0068851_100199803 327
18 3300005842 Ga0068858_100003535 Ga0068858_10000353514 327
19 3300006931 Ga0097620_100311478 Ga0097620_1003114782 327
20 3300013296 Ga0157374_10086987 Ga0157374_100869873 327
21 3300017792 Ga0163161_10144965 Ga0163161_101449652 327
22 3300025321 Ga0207656_10006768 Ga0207656_100067682 327
23 3300025903 Ga0207680_10114442 Ga0207680_101144422 327
24 3300025925 Ga0207650_10094766 Ga0207650_100947662 327
25 3300025926 Ga0207659_10008200 Ga0207659_100082002 327
26 3300025931 Ga0207644_10003222 Ga0207644_100032225 327
27 3300025936 Ga0207670_10031970 Ga0207670_100319704 327
28 3300025940 Ga0207691_10323797 Ga0207691_103237971 327
29 3300025942 Ga0207689_10022214 Ga0207689_100222142 327
30 3300025960 Ga0207651_10000726 Ga0207651_100007265 327
31 3300025986 Ga0207658_10029135 Ga0207658_100291351 327
32 3300026023 Ga0207677_10001906 Ga0207677_1000190610 327
33 3300026035 Ga0207703_10017344 Ga0207703_100173446 327
34 3300026088 Ga0207641_10004967 Ga0207641_1000496710 327
35 3300026089 Ga0207648_10038737 Ga0207648_100387375 327
36 3300026095 Ga0207676_10002431 Ga0207676_1000243112 327
37 3300031548 Ga0307408_100083868 Ga0307408_1000838682 328
38 3300003316 rootH1_10016312 rootH1_100163122 329
39 3300039450 Ga0436363_0646332 Ga0436363_0646332_2286_3434 332
40 3300044658 Ga0466972_0005034 Ga0466972_0005034_4988_6001 332
41 3300005618 Ga0068864_100201942 Ga0068864_1002019422 333
42 3300009177 Ga0105248_10003694 Ga0105248_1000369417 333
43 3300025941 Ga0207711_10025860 Ga0207711_100258603 333
44 3300033180 Ga0307510_10001378 Ga0307510_100013782 333
45 3300006880 Ga0075429_100001726 Ga0075429_1000017267 334
46 3300050508 nmdc:mga09592_1763_c1 nmdc:mga09592_1763_c1_11261_12400 334
47 3300050509 nmdc:mga0qj67_27872_c2 nmdc:mga0qj67_27872_c2_2324_3463 334
48 3300026067 Ga0207678_10052464 Ga0207678_100524642 335
49 3300050496 nmdc:mga07m45_501_c1 nmdc:mga07m45_501_c1_14811_15911 338
50 3300035172 Ga0373955_0075688 Ga0373955_0075688_632_1729 340
51 3300036401 Ga0373937_0053732 Ga0373937_0053732_851_1948 340
52 3300042146 Ga0450907_020978 Ga0450907_020978_42_1073 340
53 3300046454 Ga0495592_0162779 Ga0495592_0162779_384_1481 340
54 3300046533 Ga0495640_0077554 Ga0495640_0077554_1042_2139 340
55 3300046683 Ga0495658_0010955 Ga0495658_0010955_1510_2607 340
56 3300005366 Ga0070659_100127595 Ga0070659_1001275952 341
57 3300005367 Ga0070667_100062168 Ga0070667_1000621682 341
58 3300005543 Ga0070672_100008749 Ga0070672_1000087492 341
59 3300005843 Ga0068860_100010516 Ga0068860_1000105162 341
60 3300025940 Ga0207691_10007010 Ga0207691_100070102 341
61 3300026035 Ga0207703_10005986 Ga0207703_100059862 341
62 3300053148 Ga0500590_044154 Ga0500590_044154_876_2027 341
63 iso_pu_bacteria 2643221660 2644340419 341
64 3300035116 Ga0373945_0018072 Ga0373945_0018072_234_1394 342
65 3300046809 Ga0495600_0223243 Ga0495600_0223243_23_1135 342
66 3300047443 Ga0495687_002945 Ga0495687_002945_2338_3489 342
67 3300014968 Ga0157379_10025223 Ga0157379_100252235 343
68 3300025940 Ga0207691_10323652 Ga0207691_103236521 343
69 3300046455 Ga0495603_0108246 Ga0495603_0108246_430_1572 343
70 3300046460 Ga0495638_0100237 Ga0495638_0100237_504_1628 343
71 3300046519 Ga0495632_0067290 Ga0495632_0067290_417_1541 343
72 3300048907 Ga0496104_0076693 Ga0496104_0076693_908_2050 343
73 3300048908 Ga0496105_0005943 Ga0496105_0005943_141_1283 343
74 3300048909 Ga0496106_0011177 Ga0496106_0011177_4624_5727 343
75 3300048911 Ga0496108_0024318 Ga0496108_0024318_2165_3307 343
76 3300048912 Ga0496109_0067571 Ga0496109_0067571_838_1980 343
77 3300053093 Ga0500651_0047532 Ga0500651_0047532_1442_2566 343
78 3300053118 Ga0500594_0000567 Ga0500594_0000567_763_1887 343
79 3300053136 Ga0500559_0000138 Ga0500559_0000138_49713_50837 343
80 3300014968 Ga0157379_10027564 Ga0157379_100275644 344
81 3300035170 Ga0373943_0038902 Ga0373943_0038902_424_1692 344
82 3300046477 Ga0495664_0137110 Ga0495664_0137110_68_1336 344
83 3300053077 Ga0495601_0057621 Ga0495601_0057621_807_2075 344
84 3300053085 Ga0495619_0068172 Ga0495619_0068172_254_1522 344
85 3300028786 Ga0307517_10002551 Ga0307517_1000255110 345
86 3300033180 Ga0307510_10037621 Ga0307510_100376214 345
87 3300009545 Ga0105237_10001582 Ga0105237_1000158214 346
88 3300009551 Ga0105238_10002762 Ga0105238_1000276214 346
89 3300010375 Ga0105239_10001198 Ga0105239_1000119820 346
90 3300025914 Ga0207671_10001614 Ga0207671_1000161412 346
91 3300030522 Ga0307512_10053053 Ga0307512_100530532 346
92 3300031507 Ga0307509_10003013 Ga0307509_1000301314 346
93 3300046454 Ga0495592_0000120 Ga0495592_0000120_20057_21190 346
94 3300005455 Ga0070663_100001718 Ga0070663_1000017188 347
95 3300026067 Ga0207678_10001164 Ga0207678_1000116421 347
96 3300006195 Ga0075366_10043038 Ga0075366_100430383 348
97 3300028786 Ga0307517_10098134 Ga0307517_100981342 348
98 3300046474 Ga0495605_0080795 Ga0495605_0080795_207_1358 348
99 3300046519 Ga0495632_0032296 Ga0495632_0032296_1059_2210 348
100 3300046542 Ga0495597_0040554 Ga0495597_0040554_396_1547 348
101 3300046694 Ga0495649_0002611 Ga0495649_0002611_8971_10122 348
102 3300047443 Ga0495687_023820 Ga0495687_023820_254_1405 348
103 3300050493 nmdc:mga0k408_18654_c1 nmdc:mga0k408_18654_c1_361_1650 348
104 3300053134 Ga0500658_0009957 Ga0500658_0009957_2114_3265 348
105 3300006195 Ga0075366_10033486 Ga0075366_100334862 349
106 3300034820 Ga0373959_0003203 Ga0373959_0003203_178_1308 349
107 3300037471 Ga0395905_0086338 Ga0395905_0086338_1020_2105 349
108 3300005459 Ga0068867_100000118 Ga0068867_10000011817 350
109 3300009148 Ga0105243_10001408 Ga0105243_100014085 350
110 3300014745 Ga0157377_10000343 Ga0157377_1000034312 350
111 3300025935 Ga0207709_10000850 Ga0207709_100008506 350
112 3300026089 Ga0207648_10002014 Ga0207648_100020149 350
113 3300046459 Ga0495629_0024318 Ga0495629_0024318_422_1642 350
114 3300025945 Ga0207679_10034885 Ga0207679_100348853 351
115 3300032002 Ga0307416_100139269 Ga0307416_1001392691 351
116 3300005327 Ga0070658_10027033 Ga0070658_100270334 352
117 3300005328 Ga0070676_10024955 Ga0070676_100249553 352
118 3300005329 Ga0070683_100026824 Ga0070683_1000268243 352
119 3300005334 Ga0068869_100006643 Ga0068869_1000066435 352
120 3300005336 Ga0070680_100039594 Ga0070680_1000395942 352
121 3300005338 Ga0068868_100006388 Ga0068868_1000063884 352
122 3300005339 Ga0070660_100130246 Ga0070660_1001302461 352
123 3300005344 Ga0070661_100130875 Ga0070661_1001308752 352
124 3300005345 Ga0070692_10020138 Ga0070692_100201383 352
125 3300005347 Ga0070668_100040485 Ga0070668_1000404852 352
126 3300005354 Ga0070675_100002524 Ga0070675_10000252410 352
127 3300005455 Ga0070663_100003146 Ga0070663_1000031465 352
128 3300005457 Ga0070662_100001682 Ga0070662_1000016829 352
129 3300005458 Ga0070681_10070808 Ga0070681_100708083 352
130 3300005530 Ga0070679_100048911 Ga0070679_1000489112 352
131 3300005543 Ga0070672_100030004 Ga0070672_1000300043 352
132 3300005547 Ga0070693_100149857 Ga0070693_1001498571 352
133 3300005563 Ga0068855_100034936 Ga0068855_1000349362 352
134 3300005615 Ga0070702_100010660 Ga0070702_1000106604 352
135 3300005616 Ga0068852_100013245 Ga0068852_1000132455 352
136 3300005616 Ga0068852_100014306 Ga0068852_1000143061 352
137 3300005719 Ga0068861_100001984 Ga0068861_1000019844 352
138 3300005834 Ga0068851_10003613 Ga0068851_100036135 352
139 3300005844 Ga0068862_100014899 Ga0068862_1000148994 352
140 3300006237 Ga0097621_100047833 Ga0097621_1000478332 352
141 3300006358 Ga0068871_100022996 Ga0068871_1000229963 352
142 3300017792 Ga0163161_10022192 Ga0163161_100221924 352
143 3300025901 Ga0207688_10011790 Ga0207688_100117904 352
144 3300025907 Ga0207645_10019747 Ga0207645_100197474 352
145 3300025909 Ga0207705_10045377 Ga0207705_100453773 352
146 3300025917 Ga0207660_10092905 Ga0207660_100929052 352
147 3300025923 Ga0207681_10009755 Ga0207681_100097552 352
148 3300025926 Ga0207659_10002325 Ga0207659_100023255 352
149 3300025927 Ga0207687_10161501 Ga0207687_101615012 352
150 3300025931 Ga0207644_10000264 Ga0207644_1000026440 352
151 3300025932 Ga0207690_10004434 Ga0207690_100044344 352
152 3300025933 Ga0207706_10003415 Ga0207706_1000341510 352
153 3300025941 Ga0207711_10001750 Ga0207711_100017503 352
154 3300025941 Ga0207711_10003373 Ga0207711_1000337312 352
155 3300025942 Ga0207689_10003399 Ga0207689_1000339910 352
156 3300025945 Ga0207679_10046298 Ga0207679_100462982 352
157 3300025949 Ga0207667_10066908 Ga0207667_100669082 352
158 3300025972 Ga0207668_10008970 Ga0207668_100089704 352
159 3300026023 Ga0207677_10001252 Ga0207677_100012529 352
160 3300026067 Ga0207678_10023154 Ga0207678_100231542 352
161 3300026078 Ga0207702_10043052 Ga0207702_100430523 352
162 3300026078 Ga0207702_10073130 Ga0207702_100731302 352
163 3300026088 Ga0207641_10258151 Ga0207641_102581512 352
164 3300026089 Ga0207648_10193910 Ga0207648_101939101 352
165 3300026116 Ga0207674_10271062 Ga0207674_102710622 352
166 3300026118 Ga0207675_100009921 Ga0207675_1000099214 352
167 3300026142 Ga0207698_10010883 Ga0207698_100108831 352
168 3300031456 Ga0307513_10280678 Ga0307513_102806781 352
169 3300031616 Ga0307508_10002994 Ga0307508_1000299411 352
170 3300005467 Ga0070706_100000965 Ga0070706_10000096514 353
171 3300005518 Ga0070699_100123620 Ga0070699_1001236202 353
172 3300005578 Ga0068854_100206554 Ga0068854_1002065542 353
173 3300006178 Ga0075367_10026931 Ga0075367_100269313 353
174 3300009174 Ga0105241_10217759 Ga0105241_102177592 353
175 3300025910 Ga0207684_10002804 Ga0207684_1000280410 353
176 3300025922 Ga0207646_10014090 Ga0207646_100140904 353
177 3300026089 Ga0207648_10176147 Ga0207648_101761472 353
178 3300035171 Ga0373946_0117759 Ga0373946_0117759_12_1124 353
179 3300046507 Ga0495606_0152686 Ga0495606_0152686_55_1167 353
180 3300050493 nmdc:mga0k408_2872_c1 nmdc:mga0k408_2872_c1_5725_6876 353
181 3300050496 nmdc:mga07m45_6744_c1 nmdc:mga07m45_6744_c1_4219_5376 353
182 3300005328 Ga0070676_10001611 Ga0070676_100016115 355
183 3300005331 Ga0070670_100043165 Ga0070670_1000431653 355
184 3300005334 Ga0068869_100008107 Ga0068869_1000081073 355
185 3300005338 Ga0068868_100010447 Ga0068868_1000104473 355
186 3300005354 Ga0070675_100287382 Ga0070675_1002873821 355
187 3300005355 Ga0070671_100033458 Ga0070671_1000334583 355
188 3300005364 Ga0070673_100002831 Ga0070673_10000283110 355
189 3300005459 Ga0068867_100010409 Ga0068867_1000104092 355
190 3300005543 Ga0070672_100006503 Ga0070672_1000065036 355
191 3300005548 Ga0070665_100024704 Ga0070665_1000247042 355
192 3300005577 Ga0068857_100053448 Ga0068857_1000534482 355
193 3300005840 Ga0068870_10015312 Ga0068870_100153122 355
194 3300009177 Ga0105248_10002745 Ga0105248_1000274513 355
195 3300009545 Ga0105237_10272678 Ga0105237_102726782 355
196 3300009551 Ga0105238_10016418 Ga0105238_100164183 355
197 3300010375 Ga0105239_10137437 Ga0105239_101374372 355
198 3300013105 Ga0157369_10065369 Ga0157369_100653693 355
199 3300013296 Ga0157374_10014987 Ga0157374_100149874 355
200 3300013306 Ga0163162_10065499 Ga0163162_100654993 355
201 3300013307 Ga0157372_10063647 Ga0157372_100636474 355
202 3300013307 Ga0157372_10107189 Ga0157372_101071893 355
203 3300013308 Ga0157375_10139441 Ga0157375_101394412 355
204 3300013308 Ga0157375_10197714 Ga0157375_101977142 355
205 3300014745 Ga0157377_10008399 Ga0157377_100083992 355
206 3300014968 Ga0157379_10017039 Ga0157379_100170394 355
207 3300014968 Ga0157379_10196071 Ga0157379_101960712 355
208 3300014969 Ga0157376_10052161 Ga0157376_100521611 355
209 3300025907 Ga0207645_10005999 Ga0207645_100059998 355
210 3300025908 Ga0207643_10055608 Ga0207643_100556082 355
211 3300025940 Ga0207691_10031990 Ga0207691_100319903 355
212 3300025942 Ga0207689_10009456 Ga0207689_100094563 355
213 3300025960 Ga0207651_10016312 Ga0207651_100163123 355
214 3300026023 Ga0207677_10027519 Ga0207677_100275193 355
215 3300026089 Ga0207648_10011543 Ga0207648_100115438 355
216 3300026116 Ga0207674_10191489 Ga0207674_101914892 355
217 3300028379 Ga0268266_10108979 Ga0268266_101089792 355
218 3300031995 Ga0307409_100004091 Ga0307409_1000040912 355
219 3300032002 Ga0307416_100011104 Ga0307416_1000111042 355
220 3300032126 Ga0307415_100065856 Ga0307415_1000658562 355
221 3300035084 Ga0373928_0017469 Ga0373928_0017469_76_1176 355
222 3300035691 Ga0373931_0003277 Ga0373931_0003277_2510_3610 355
223 3300046472 Ga0495580_0058490 Ga0495580_0058490_1020_2117 355
224 3300048905 Ga0496102_0023399 Ga0496102_0023399_1027_2127 355
225 3300048907 Ga0496104_0017569 Ga0496104_0017569_3690_4790 355
226 3300048908 Ga0496105_0048432 Ga0496105_0048432_1309_2409 355
227 3300048909 Ga0496106_0030810 Ga0496106_0030810_903_2003 355
228 3300048912 Ga0496109_0022535 Ga0496109_0022535_610_1710 355
229 3300048914 Ga0496111_0066537 Ga0496111_0066537_757_1857 355
230 3300048917 Ga0496114_0048659 Ga0496114_0048659_1010_2110 355
231 3300048918 Ga0496115_0026311 Ga0496115_0026311_2693_3793 355
232 3300005327 Ga0070658_10078185 Ga0070658_100781851 356
233 3300005333 Ga0070677_10009064 Ga0070677_100090643 356
234 3300005354 Ga0070675_100024456 Ga0070675_1000244562 356
235 3300005456 Ga0070678_100007938 Ga0070678_1000079385 356
236 3300005543 Ga0070672_100003887 Ga0070672_1000038875 356
237 3300005618 Ga0068864_100042789 Ga0068864_1000427892 356
238 3300006178 Ga0075367_10013328 Ga0075367_100133283 356
239 3300006237 Ga0097621_100039158 Ga0097621_1000391582 356
240 3300006358 Ga0068871_100243500 Ga0068871_1002435002 356
241 3300009177 Ga0105248_10322074 Ga0105248_103220742 356
242 3300013308 Ga0157375_10020991 Ga0157375_100209914 356
243 3300025893 Ga0207682_10003952 Ga0207682_100039524 356
244 3300025909 Ga0207705_10061559 Ga0207705_100615592 356
245 3300025925 Ga0207650_10009236 Ga0207650_100092365 356
246 3300025926 Ga0207659_10002524 Ga0207659_100025248 356
247 3300025940 Ga0207691_10005307 Ga0207691_1000530711 356
248 3300025960 Ga0207651_10196866 Ga0207651_101968661 356
249 3300026095 Ga0207676_10237980 Ga0207676_102379802 356
250 3300026121 Ga0207683_10004615 Ga0207683_100046153 356
251 3300031852 Ga0307410_10126606 Ga0307410_101266062 356
252 3300042876 Ga0451577_0210545 Ga0451577_0210545_61_1206 356
253 3300047472 Ga0495686_0000404 Ga0495686_0000404_53453_54622 356
254 iso_pu_bacteria 2643221654 2644301639 356
255 3300005334 Ga0068869_100019365 Ga0068869_1000193654 357
256 3300005367 Ga0070667_100178598 Ga0070667_1001785982 357
257 3300005456 Ga0070678_100225881 Ga0070678_1002258812 357
258 3300005577 Ga0068857_100056743 Ga0068857_1000567433 357
259 3300006195 Ga0075366_10003454 Ga0075366_100034546 357
260 3300009093 Ga0105240_10079271 Ga0105240_100792712 357
261 3300009176 Ga0105242_10228492 Ga0105242_102284922 357
262 3300009177 Ga0105248_10073729 Ga0105248_100737292 357
263 3300009545 Ga0105237_10098029 Ga0105237_100980292 357
264 3300013306 Ga0163162_10283684 Ga0163162_102836842 357
265 3300013308 Ga0157375_10090976 Ga0157375_100909763 357
266 3300025914 Ga0207671_10044427 Ga0207671_100444272 357
267 3300025942 Ga0207689_10069500 Ga0207689_100695002 357
268 3300026116 Ga0207674_10082149 Ga0207674_100821493 357
269 3300031456 Ga0307513_10296701 Ga0307513_102967011 357
270 3300037068 Ga0373925_0038285 Ga0373925_0038285_1352_2521 357
271 3300046660 Ga0495625_0029797 Ga0495625_0029797_1788_2939 357
272 3300050493 nmdc:mga0k408_13334_c1 nmdc:mga0k408_13334_c1_766_2013 357
273 3300050496 nmdc:mga07m45_128830_c1 nmdc:mga07m45_128830_c1_153_1301 357
274 3300050516 nmdc:mga0sz30_36706_c1 nmdc:mga0sz30_36706_c1_108_1355 357
275 3300005328 Ga0070676_10007770 Ga0070676_100077704 358
276 3300005330 Ga0070690_100061366 Ga0070690_1000613662 358
277 3300005331 Ga0070670_100301184 Ga0070670_1003011841 358
278 3300005331 Ga0070670_100308750 Ga0070670_1003087501 358
279 3300005333 Ga0070677_10020757 Ga0070677_100207572 358
280 3300005334 Ga0068869_100158640 Ga0068869_1001586402 358
281 3300005338 Ga0068868_100162423 Ga0068868_1001624232 358
282 3300005343 Ga0070687_100011936 Ga0070687_1000119363 358
283 3300005347 Ga0070668_100006370 Ga0070668_1000063706 358
284 3300005353 Ga0070669_100005118 Ga0070669_1000051182 358
285 3300005354 Ga0070675_100041283 Ga0070675_1000412831 358
286 3300005354 Ga0070675_100199485 Ga0070675_1001994851 358
287 3300005364 Ga0070673_100157207 Ga0070673_1001572072 358
288 3300005367 Ga0070667_100011298 Ga0070667_1000112984 358
289 3300005457 Ga0070662_100084084 Ga0070662_1000840842 358
290 3300005459 Ga0068867_100013383 Ga0068867_1000133834 358
291 3300005539 Ga0068853_100169891 Ga0068853_1001698911 358
292 3300005543 Ga0070672_100007981 Ga0070672_1000079811 358
293 3300005543 Ga0070672_100079552 Ga0070672_1000795522 358
294 3300005564 Ga0070664_100188926 Ga0070664_1001889262 358
295 3300005618 Ga0068864_100076307 Ga0068864_1000763073 358
296 3300005719 Ga0068861_100004050 Ga0068861_1000040504 358
297 3300005841 Ga0068863_100008538 Ga0068863_1000085387 358
298 3300005841 Ga0068863_100368980 Ga0068863_1003689802 358
299 3300005842 Ga0068858_100000366 Ga0068858_10000036645 358
300 3300005843 Ga0068860_100012879 Ga0068860_1000128792 358
301 3300005844 Ga0068862_100145685 Ga0068862_1001456852 358
302 3300006177 Ga0075362_10005831 Ga0075362_100058312 358
303 3300009098 Ga0105245_10100343 Ga0105245_101003433 358
304 3300009553 Ga0105249_10004419 Ga0105249_100044194 358
305 3300013306 Ga0163162_10037870 Ga0163162_100378702 358
306 3300014325 Ga0163163_10113073 Ga0163163_101130732 358
307 3300017792 Ga0163161_10023866 Ga0163161_100238662 358
308 3300025893 Ga0207682_10030894 Ga0207682_100308942 358
309 3300025899 Ga0207642_10034537 Ga0207642_100345372 358
310 3300025907 Ga0207645_10001578 Ga0207645_1000157814 358
311 3300025918 Ga0207662_10001240 Ga0207662_100012404 358
312 3300025923 Ga0207681_10000634 Ga0207681_1000063415 358
313 3300025925 Ga0207650_10001855 Ga0207650_100018552 358
314 3300025926 Ga0207659_10017565 Ga0207659_100175652 358
315 3300025926 Ga0207659_10018246 Ga0207659_100182464 358
316 3300025933 Ga0207706_10094711 Ga0207706_100947112 358
317 3300025936 Ga0207670_10141362 Ga0207670_101413622 358
318 3300025940 Ga0207691_10051561 Ga0207691_100515614 358
319 3300025941 Ga0207711_10175952 Ga0207711_101759521 358
320 3300025961 Ga0207712_10012921 Ga0207712_100129214 358
321 3300025972 Ga0207668_10000316 Ga0207668_100003164 358
322 3300025972 Ga0207668_10207683 Ga0207668_102076832 358
323 3300025986 Ga0207658_10003581 Ga0207658_100035814 358
324 3300026035 Ga0207703_10000616 Ga0207703_100006166 358
325 3300026067 Ga0207678_10194502 Ga0207678_101945022 358
326 3300026075 Ga0207708_10009445 Ga0207708_100094453 358
327 3300026088 Ga0207641_10035633 Ga0207641_100356332 358
328 3300026089 Ga0207648_10041423 Ga0207648_100414232 358
329 3300026089 Ga0207648_10312193 Ga0207648_103121932 358
330 3300026118 Ga0207675_100001106 Ga0207675_1000011066 358
331 3300026121 Ga0207683_10047674 Ga0207683_100476744 358
332 3300028380 Ga0268265_10090730 Ga0268265_100907302 358
333 3300028381 Ga0268264_10017259 Ga0268264_100172593 358
334 3300031548 Ga0307408_100074907 Ga0307408_1000749073 358
335 3300031901 Ga0307406_10008188 Ga0307406_100081884 358
336 3300031903 Ga0307407_10033602 Ga0307407_100336022 358
337 3300031995 Ga0307409_100309524 Ga0307409_1003095241 358
338 3300003322 rootL2_10178597 rootL2_101785972 359
339 3300005367 Ga0070667_100002909 Ga0070667_10000290912 359
340 3300006178 Ga0075367_10008921 Ga0075367_100089214 359
341 3300006353 Ga0075370_10012739 Ga0075370_100127392 359
342 3300006353 Ga0075370_10031975 Ga0075370_100319753 359
343 3300006881 Ga0068865_100105504 Ga0068865_1001055042 359
344 3300014968 Ga0157379_10119755 Ga0157379_101197552 359
345 3300025938 Ga0207704_10055821 Ga0207704_100558212 359
346 3300025986 Ga0207658_10001493 Ga0207658_1000149310 359
347 3300031649 Ga0307514_10021350 Ga0307514_100213504 359
348 3300049649 Ga0501198_000004 Ga0501198_000004_14235_15371 359
349 3300049662 Ga0501222_000095 Ga0501222_000095_14249_15385 359
350 3300050496 nmdc:mga07m45_77985_c1 nmdc:mga07m45_77985_c1_27_1274 359
351 3300013308 Ga0157375_10007448 Ga0157375_100074487 360
352 3300014326 Ga0157380_10033410 Ga0157380_100334102 360
353 3300026116 Ga0207674_10252352 Ga0207674_102523521 360
354 3300005364 Ga0070673_100053157 Ga0070673_1000531572 361
355 3300025893 Ga0207682_10016294 Ga0207682_100162942 361
356 3300025926 Ga0207659_10055118 Ga0207659_100551182 361
357 3300025940 Ga0207691_10045319 Ga0207691_100453192 361
358 3300031456 Ga0307513_10013819 Ga0307513_100138193 361
359 3300042461 Ga0439460_0030126 Ga0439460_0030126_118_1263 361
360 3300047472 Ga0495686_0069278 Ga0495686_0069278_616_1719 361
361 3300005355 Ga0070671_100040666 Ga0070671_1000406663 362
362 3300005618 Ga0068864_100021008 Ga0068864_1000210084 362
363 3300005841 Ga0068863_100020081 Ga0068863_1000200814 362
364 3300005843 Ga0068860_100057768 Ga0068860_1000577682 362
365 3300013308 Ga0157375_10310855 Ga0157375_103108552 362
366 3300003215 JGI25153J46596_10013946 JGI25153J46596_100139462 365
367 3300025297 Ga0209758_1000307 Ga0209758_100030768 365
368 3300028794 Ga0307515_10006463 Ga0307515_100064633 365
369 3300031456 Ga0307513_10107132 Ga0307513_101071322 365
370 3300031507 Ga0307509_10006419 Ga0307509_100064197 365
371 3300031616 Ga0307508_10038790 Ga0307508_100387903 365
372 3300033179 Ga0307507_10036366 Ga0307507_100363664 365
373 3300046517 Ga0495630_0082662 Ga0495630_0082662_962_2101 365
374 3300046690 Ga0495624_0016572 Ga0495624_0016572_379_1518 365
375 3300048903 Ga0496100_0147563 Ga0496100_0147563_447_1583 365
376 3300046543 Ga0495645_0025713 Ga0495645_0025713_414_1652 367
377 3300026121 Ga0207683_10031584 Ga0207683_100315844 369
378 3300005328 Ga0070676_10006499 Ga0070676_100064995 370
379 3300005333 Ga0070677_10017911 Ga0070677_100179113 370
380 3300005338 Ga0068868_100083797 Ga0068868_1000837972 370
381 3300005353 Ga0070669_100088415 Ga0070669_1000884152 370
382 3300005355 Ga0070671_100012416 Ga0070671_1000124165 370
383 3300005355 Ga0070671_100131039 Ga0070671_1001310391 370
384 3300005356 Ga0070674_100012099 Ga0070674_1000120993 370
385 3300005356 Ga0070674_100025061 Ga0070674_1000250611 370
386 3300005364 Ga0070673_100005638 Ga0070673_1000056384 370
387 3300005459 Ga0068867_100015223 Ga0068867_1000152232 370
388 3300005459 Ga0068867_100018936 Ga0068867_1000189364 370
389 3300005459 Ga0068867_100026546 Ga0068867_1000265465 370
390 3300005543 Ga0070672_100003437 Ga0070672_1000034377 370
391 3300005548 Ga0070665_100078421 Ga0070665_1000784212 370
392 3300005578 Ga0068854_100032217 Ga0068854_1000322172 370
393 3300006237 Ga0097621_100110553 Ga0097621_1001105532 370
394 3300006358 Ga0068871_100091970 Ga0068871_1000919702 370
395 3300014326 Ga0157380_10018324 Ga0157380_100183243 370
396 3300014969 Ga0157376_10076841 Ga0157376_100768412 370
397 3300025315 Ga0207697_10012457 Ga0207697_100124572 370
398 3300025893 Ga0207682_10008190 Ga0207682_100081902 370
399 3300025907 Ga0207645_10022214 Ga0207645_100222142 370
400 3300025931 Ga0207644_10020670 Ga0207644_100206703 370
401 3300025937 Ga0207669_10044893 Ga0207669_100448933 370
402 3300025940 Ga0207691_10036993 Ga0207691_100369933 370
403 3300025981 Ga0207640_10006815 Ga0207640_100068156 370
404 3300026023 Ga0207677_10061989 Ga0207677_100619892 370
405 3300026089 Ga0207648_10011503 Ga0207648_100115034 370
406 3300026121 Ga0207683_10022132 Ga0207683_100221322 370
407 iso_pu_bacteria 2585428058 2587737165 370
408 3300031730 Ga0307516_10009114 Ga0307516_100091142 371
409 3300006195 Ga0075366_10059805 Ga0075366_100598052 372
410 3300053090 Ga0500646_0002363 Ga0500646_0002363_2488_3621 372
411 3300053092 Ga0500583_0090644 Ga0500583_0090644_222_1355 372
412 3300053098 Ga0500650_0076017 Ga0500650_0076017_372_1505 372
413 3300053129 Ga0500628_002413 Ga0500628_002413_376_1509 372
414 3300053130 Ga0500642_0068654 Ga0500642_0068654_345_1478 372
415 3300053131 Ga0500652_000642 Ga0500652_000642_9741_10874 372
416 3300053156 Ga0500622_0000221 Ga0500622_0000221_18603_19736 372
417 iso_pu_bacteria 2643221592 2643971650 372
418 iso_pu_bacteria 2643221625 2644142728 372
419 iso_pu_bacteria 2643221648 2644272711 372
420 iso_pu_bacteria 2585428057 2587730794 373
421 iso_pu_bacteria 2588253510 2588294636 373
422 3300005262 Ga0065165_1005423 Ga0065165_10054236 374
423 3300025273 Ga0209673_1004179 Ga0209673_10041797 374
424 3300025298 Ga0209050_1000493 Ga0209050_100049311 374
425 3300053086 Ga0500578_0000006 Ga0500578_0000006_12764_13903 374
426 3300002773 JGI25152J39213_1003968 JGI25152J39213_10039682 375
427 3300003215 JGI25153J46596_10013898 JGI25153J46596_100138983 375
428 3300003771 Ga0055526_1001909 Ga0055526_100190910 375
429 3300025258 Ga0209129_1000043 Ga0209129_1000043269 375
430 3300025273 Ga0209673_1023364 Ga0209673_10233642 375
431 3300025295 Ga0209564_1000014 Ga0209564_1000014376 375
432 3300025297 Ga0209758_1000492 Ga0209758_100049253 375
433 3300053151 Ga0500604_0026382 Ga0500604_0026382_221_1363 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

237

315

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a0z-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.7399 243 374
3a0w-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.7364 243 374
3a0y-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) 0.7358 245 374
3a0w-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.722 243 374
3a0z-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.7183 243 374
ID Description Score Start End Superfamily
af_Q2G1E0_342_515_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7961 219 375 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7794 244 375 3.30.565.10
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.76 97 183 1.10.1760.20
af_P0AFB5_191_349_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7596 243 375 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7593 244 375 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A350JJX8-F1-model_v4 Signal transduction histidine kinase internal region domain-containing protein 0.9349 243 334 GO:0000155
GO:0016020
AF-A0A1I2QZS1-F1-model_v4 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 0.9056 218 328 GO:0000155
GO:0016020
AF-A0A395YH45-F1-model_v4 Uncharacterized protein 0.8507 166 326 GO:0000155
GO:0016020
AF-A0A4Q5SAN6-F1-model_v4 Sensor histidine kinase 0.8427 179 374 GO:0000155
GO:0016020
AF-A0A4Q3PDM4-F1-model_v4 deleted 0.8388 15 277

Feature Viewer

pLDDT pTM Quality
75.58 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map