F442855

General Info

Members Datasets Scaffolds Average Seq Length
433 256 866 253

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10008372|Ga0207697_100083725
Length 301
Sequence MFDKLFGWSKKKEEPEPRISFGRYSDNNKPNEKVTRWNDADALFKEKKYADSFSAFFEYLIRLGDDRLVLGHRLSEWCGHGPILEEDIALANISLDLIGEASLLLKLAASVEGQGRNEDTLAYFRDAIDFRNALMLELPKGDFGFTVVRQFLFSVYSLLQMDALQKSRNADLSGIAAKALKETRYHVRHSAQWVVTLGGGTDESNARAQQALNDLWRYTGELFVADDIDREVAASGDGVDPSTLEAVWREQVLPILQRAGLRVPDAGYMQGGGRGGRHTEHLGHMLSEMQILARSHPGASW

Samples

Sample ID Description Type Environment
1 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.46
Rhizosphere 95.84
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207697_10008372 3300025315 Bacteria 4528
2 MBSR1b_contig_11525244 2162886012 Bacteria 1536
3 JGI24752J21851_1011473 3300001976 Bacteria 1159
4 Ga0065715_10094976 3300005293 Bacteria 4197
5 Ga0070658_10083078 3300005327 Bacteria 2632
6 Ga0070658_10148970 3300005327 Bacteria 1958
7 Ga0070676_10049070 3300005328 Bacteria 2470
8 Ga0070683_100002016 3300005329 Bacteria 15955
9 Ga0070683_100007884 3300005329 Bacteria 9024
10 Ga0070683_100031558 3300005329 Bacteria 4819
11 Ga0070683_100044917 3300005329 Bacteria 4077
12 Ga0070683_100054480 3300005329 Bacteria 3708
13 Ga0070683_100129629 3300005329 Bacteria 2386
14 Ga0070683_100144030 3300005329 Bacteria 2258
15 Ga0070683_100384821 3300005329 Bacteria 1337
16 Ga0070683_100573064 3300005329 Bacteria 1080
17 Ga0070683_100584708 3300005329 Bacteria 1068
18 Ga0070690_100067031 3300005330 Bacteria 2325
19 Ga0070690_100253484 3300005330 Bacteria 1246
20 Ga0070690_100410377 3300005330 Bacteria 996
21 Ga0070670_100014874 3300005331 Bacteria 6674
22 Ga0068869_100008216 3300005334 Bacteria 6715
23 Ga0068869_100086820 3300005334 Bacteria 2346
24 Ga0068869_100095379 3300005334 Bacteria 2245
25 Ga0070666_10038854 3300005335 Bacteria 3169
26 Ga0070680_100022455 3300005336 Bacteria 5027
27 Ga0070680_100049855 3300005336 Bacteria 3414
28 Ga0070680_100059190 3300005336 Bacteria 3133
29 Ga0070682_100012166 3300005337 Bacteria 4927
30 Ga0068868_100036156 3300005338 Bacteria 3821
31 Ga0070687_100026770 3300005343 Bacteria 2780
32 Ga0070661_100004608 3300005344 Bacteria 9483
33 Ga0070661_100122207 3300005344 Bacteria 1951
34 Ga0070692_10061889 3300005345 Bacteria 1974
35 Ga0070668_100069283 3300005347 Bacteria 2744
36 Ga0070675_100014760 3300005354 Bacteria 6163
37 Ga0070675_100133232 3300005354 Bacteria 2119
38 Ga0070675_100260328 3300005354 Bacteria 1520
39 Ga0070671_100188857 3300005355 Bacteria 1746
40 Ga0070673_100049029 3300005364 Bacteria 3295
41 Ga0070659_100011507 3300005366 Bacteria 6545
42 Ga0070709_10023174 3300005434 Bacteria 3642
43 Ga0070709_10073590 3300005434 Bacteria 2212
44 Ga0070709_10282347 3300005434 Bacteria 1207
45 Ga0070714_100108379 3300005435 Bacteria 2456
46 Ga0070714_100136015 3300005435 Bacteria 2201
47 Ga0070713_100000223 3300005436 Bacteria 37729
48 Ga0070713_100010218 3300005436 Bacteria 6774
49 Ga0070713_100034995 3300005436 Bacteria 4041
50 Ga0070713_100038712 3300005436 Bacteria 3866
51 Ga0070701_10094470 3300005438 Bacteria 1645
52 Ga0070711_100238417 3300005439 Bacteria 1421
53 Ga0070711_100331387 3300005439 Bacteria 1218
54 Ga0070705_100002442 3300005440 Bacteria 9343
55 Ga0070694_100060464 3300005444 Bacteria 2584
56 Ga0070694_100425217 3300005444 Bacteria 1044
57 Ga0070708_100000007 3300005445 Bacteria 146443
58 Ga0070662_100009125 3300005457 Bacteria 6476
59 Ga0070662_100072180 3300005457 Bacteria 2548
60 Ga0070681_10000978 3300005458 Bacteria 24153
61 Ga0070681_10027504 3300005458 Bacteria 5717
62 Ga0070681_10027690 3300005458 Bacteria 5697
63 Ga0070685_10189256 3300005466 Bacteria 1330
64 Ga0070706_100089052 3300005467 Bacteria 2862
65 Ga0070707_100084104 3300005468 Bacteria 3075
66 Ga0070707_100207869 3300005468 Bacteria 1908
67 Ga0070698_100034646 3300005471 Bacteria 5225
68 Ga0070698_100058577 3300005471 Bacteria 3894
69 Ga0070698_100164770 3300005471 Bacteria 2160
70 Ga0070698_100189417 3300005471 Bacteria 1995
71 Ga0070698_100567005 3300005471 Bacteria 1075
72 Ga0070699_100000024 3300005518 Bacteria 161189
73 Ga0070699_100077816 3300005518 Bacteria 2888
74 Ga0070699_100137468 3300005518 Bacteria 2156
75 Ga0070679_100005712 3300005530 Bacteria 11534
76 Ga0070679_100007387 3300005530 Bacteria 10270
77 Ga0070679_100025597 3300005530 Bacteria 5793
78 Ga0070679_100133562 3300005530 Bacteria 2463
79 Ga0070679_100282586 3300005530 Bacteria 1612
80 Ga0070679_100485221 3300005530 Bacteria 1180
81 Ga0070684_100011325 3300005535 Bacteria 7101
82 Ga0070684_100054145 3300005535 Bacteria 3495
83 Ga0070684_100094069 3300005535 Bacteria 2669
84 Ga0070684_100124591 3300005535 Bacteria 2320
85 Ga0070684_100129922 3300005535 Bacteria 2272
86 Ga0070684_100146634 3300005535 Bacteria 2136
87 Ga0070684_100193773 3300005535 Bacteria 1850
88 Ga0070684_100556110 3300005535 Bacteria 1065
89 Ga0068853_100292729 3300005539 Bacteria 1503
90 Ga0068853_100715568 3300005539 Bacteria 956
91 Ga0070686_100143901 3300005544 Bacteria 1663
92 Ga0070696_100000366 3300005546 Bacteria 27619
93 Ga0070696_100010341 3300005546 Bacteria 6251
94 Ga0070693_100006198 3300005547 Bacteria 5798
95 Ga0070693_100008346 3300005547 Bacteria 5102
96 Ga0070704_100000546 3300005549 Bacteria 18015
97 Ga0070704_100011501 3300005549 Bacteria 5427
98 Ga0068855_100072626 3300005563 Bacteria 3999
99 Ga0068855_100107945 3300005563 Bacteria 3198
100 Ga0068855_100137335 3300005563 Bacteria 2788
101 Ga0070664_100016569 3300005564 Bacteria 6044
102 Ga0068857_100022867 3300005577 Bacteria 5499
103 Ga0068856_100054986 3300005614 Bacteria 3928
104 Ga0068856_100067511 3300005614 Bacteria 3534
105 Ga0068852_100033592 3300005616 Bacteria 4261
106 Ga0068852_100512529 3300005616 Bacteria 1196
107 Ga0068859_100011471 3300005617 Bacteria 8910
108 Ga0068859_100012064 3300005617 Bacteria 8682
109 Ga0068859_100035842 3300005617 Bacteria 4979
110 Ga0068859_100215199 3300005617 Bacteria 2009
111 Ga0068859_100251000 3300005617 Bacteria 1860
112 Ga0068859_100597556 3300005617 Bacteria 1197
113 Ga0068864_100020285 3300005618 Bacteria 5560
114 Ga0068861_100376899 3300005719 Bacteria 1252
115 Ga0068863_100016544 3300005841 Bacteria 7077
116 Ga0068858_100589253 3300005842 Bacteria 1078
117 Ga0068860_100024706 3300005843 Bacteria 5803
118 Ga0081539_10000290 3300005985 Bacteria 113852
119 Ga0070717_10017368 3300006028 Bacteria 5599
120 Ga0070717_10092280 3300006028 Bacteria 2558
121 Ga0070716_100130385 3300006173 Bacteria 1588
122 Ga0070716_100429362 3300006173 Bacteria 958
123 Ga0070712_100157089 3300006175 Bacteria 1752
124 Ga0097621_100026170 3300006237 Bacteria 4574
125 Ga0068871_100024103 3300006358 Bacteria 4716
126 Ga0075428_100033832 3300006844 Bacteria 5639
127 Ga0075428_100104380 3300006844 Bacteria 3091
128 Ga0075431_100017051 3300006847 Bacteria 7377
129 Ga0075431_100024684 3300006847 Bacteria 6164
130 Ga0075433_10119938 3300006852 Bacteria 2335
131 Ga0075433_10223162 3300006852 Unclassified 1674
132 Ga0075434_100021100 3300006871 Bacteria 6330
133 Ga0075429_100002822 3300006880 Bacteria 14690
134 Ga0075429_100471453 3300006880 Bacteria 1100
135 Ga0068865_100034114 3300006881 Bacteria 3413
136 Ga0097620_100011471 3300006931 Bacteria 8910
137 Ga0097620_100012064 3300006931 Bacteria 8682
138 Ga0097620_100035840 3300006931 Bacteria 4979
139 Ga0097620_100215196 3300006931 Bacteria 2009
140 Ga0097620_100250984 3300006931 Bacteria 1860
141 Ga0097620_100597518 3300006931 Bacteria 1197
142 Ga0105240_10118852 3300009093 Bacteria 3185
143 Ga0111539_10194907 3300009094 Bacteria 2363
144 Ga0105245_10011794 3300009098 Bacteria 7603
145 Ga0105245_10740663 3300009098 Bacteria 1018
146 Ga0114129_10002529 3300009147 Bacteria 25398
147 Ga0114129_10005319 3300009147 Bacteria 18170
148 Ga0114129_10018253 3300009147 Bacteria 9990
149 Ga0105241_10151771 3300009174 Bacteria 1896
150 Ga0105241_10336244 3300009174 Bacteria 1307
151 Ga0105242_10004361 3300009176 Bacteria 11010
152 Ga0105242_10123309 3300009176 Bacteria 2227
153 Ga0105248_10006255 3300009177 Bacteria 13055
154 Ga0105248_10018959 3300009177 Bacteria 7607
155 Ga0105248_10160471 3300009177 Bacteria 2536
156 Ga0105237_10138392 3300009545 Bacteria 2429
157 Ga0105238_10021569 3300009551 Bacteria 6560
158 Ga0105249_10431489 3300009553 Bacteria 1353
159 Ga0105249_10468096 3300009553 Bacteria 1301
160 Ga0105239_10008939 3300010375 Bacteria 11334
161 Ga0105246_10004459 3300011119 Bacteria 8522
162 Ga0157373_10052000 3300013100 Bacteria 2916
163 Ga0157371_10048328 3300013102 Bacteria 3024
164 Ga0157370_10002257 3300013104 Bacteria 23417
165 Ga0157370_10035353 3300013104 Bacteria 4857
166 Ga0157370_10590245 3300013104 Bacteria 1017
167 Ga0157369_10095473 3300013105 Bacteria 3172
168 Ga0157369_10181359 3300013105 Bacteria 2215
169 Ga0157369_10411850 3300013105 Bacteria 1402
170 Ga0157369_10488490 3300013105 Bacteria 1274
171 Ga0157374_10065113 3300013296 Bacteria 3422
172 Ga0157378_10519897 3300013297 Bacteria 1191
173 Ga0163162_10059814 3300013306 Bacteria 3843
174 Ga0163162_10152003 3300013306 Bacteria 2433
175 Ga0163162_10224517 3300013306 Bacteria 2008
176 Ga0163162_10577020 3300013306 Bacteria 1252
177 Ga0157372_10002903 3300013307 Bacteria 18534
178 Ga0157372_10007361 3300013307 Bacteria 11712
179 Ga0157372_10041041 3300013307 Bacteria 5115
180 Ga0157372_10043513 3300013307 Bacteria 4972
181 Ga0157372_10168705 3300013307 Bacteria 2532
182 Ga0157372_10214074 3300013307 Bacteria 2233
183 Ga0157375_10027197 3300013308 Bacteria 5344
184 Ga0157375_10216992 3300013308 Bacteria 2071
185 Ga0163163_10158670 3300014325 Bacteria 2307
186 Ga0157380_10421715 3300014326 Bacteria 1273
187 Ga0157377_10014284 3300014745 Bacteria 4038
188 Ga0157376_10149935 3300014969 Bacteria 2102
189 Ga0157376_10424653 3300014969 Bacteria 1291
190 Ga0206352_11185906 3300020078 Bacteria 1316
191 Ga0207682_10130836 3300025893 Bacteria 1120
192 Ga0207699_10001315 3300025906 Bacteria 11811
193 Ga0207699_10037803 3300025906 Bacteria 2762
194 Ga0207699_10120239 3300025906 Bacteria 1697
195 Ga0207705_10064956 3300025909 Bacteria 2638
196 Ga0207654_10102761 3300025911 Bacteria 1763
197 Ga0207707_10037085 3300025912 Bacteria 4259
198 Ga0207707_10226105 3300025912 Bacteria 1628
199 Ga0207695_10066375 3300025913 Bacteria 3706
200 Ga0207693_10059649 3300025915 Bacteria 2989
201 Ga0207663_10243841 3300025916 Bacteria 1319
202 Ga0207660_10031074 3300025917 Bacteria 3674
203 Ga0207660_10126431 3300025917 Bacteria 1941
204 Ga0207662_10044367 3300025918 Bacteria 2625
205 Ga0207649_10004047 3300025920 Bacteria 7979
206 Ga0207652_10008351 3300025921 Bacteria 8328
207 Ga0207652_10016297 3300025921 Bacteria 6065
208 Ga0207652_10037839 3300025921 Bacteria 4085
209 Ga0207652_10263572 3300025921 Bacteria 1554
210 Ga0207652_10328923 3300025921 Bacteria 1380
211 Ga0207694_10026192 3300025924 Bacteria 4434
212 Ga0207650_10031285 3300025925 Bacteria 3842
213 Ga0207650_10113460 3300025925 Bacteria 2101
214 Ga0207650_10457596 3300025925 Bacteria 1063
215 Ga0207659_10101099 3300025926 Bacteria 2173
216 Ga0207659_10131929 3300025926 Bacteria 1929
217 Ga0207659_10178656 3300025926 Bacteria 1680
218 Ga0207687_10110193 3300025927 Bacteria 2041
219 Ga0207700_10000633 3300025928 Bacteria 20583
220 Ga0207700_10018297 3300025928 Bacteria 4704
221 Ga0207700_10035334 3300025928 Bacteria 3599
222 Ga0207700_10265529 3300025928 Bacteria 1471
223 Ga0207664_10020800 3300025929 Bacteria 4869
224 Ga0207664_10060722 3300025929 Bacteria 3014
225 Ga0207664_10135735 3300025929 Bacteria 2076
226 Ga0207644_10029711 3300025931 Bacteria 3795
227 Ga0207690_10050733 3300025932 Bacteria 2771
228 Ga0207706_10005722 3300025933 Bacteria 11578
229 Ga0207706_10019828 3300025933 Bacteria 6044
230 Ga0207686_10061905 3300025934 Bacteria 2374
231 Ga0207670_10326941 3300025936 Bacteria 1208
232 Ga0207704_10213004 3300025938 Bacteria 1423
233 Ga0207665_10085041 3300025939 Bacteria 2183
234 Ga0207665_10557119 3300025939 Bacteria 891
235 Ga0207691_10084368 3300025940 Bacteria 2852
236 Ga0207711_10220999 3300025941 Bacteria 1732
237 Ga0207711_10307906 3300025941 Bacteria 1462
238 Ga0207689_10002072 3300025942 Bacteria 18927
239 Ga0207689_10008190 3300025942 Bacteria 9107
240 Ga0207661_10004811 3300025944 Bacteria 9454
241 Ga0207661_10005194 3300025944 Bacteria 9153
242 Ga0207661_10074049 3300025944 Bacteria 2791
243 Ga0207661_10111261 3300025944 Bacteria 2317
244 Ga0207661_10128162 3300025944 Bacteria 2170
245 Ga0207661_10217787 3300025944 Bacteria 1686
246 Ga0207679_10003073 3300025945 Bacteria 10336
247 Ga0207667_10098163 3300025949 Bacteria 3023
248 Ga0207667_10178852 3300025949 Bacteria 2179
249 Ga0207667_10308578 3300025949 Bacteria 1616
250 Ga0207651_10021159 3300025960 Bacteria 3946
251 Ga0207712_10087816 3300025961 Bacteria 2281
252 Ga0207712_10315354 3300025961 Bacteria 1288
253 Ga0207677_10088770 3300026023 Bacteria 2242
254 Ga0207703_10646822 3300026035 Bacteria 1003
255 Ga0207639_10252210 3300026041 Bacteria 1539
256 Ga0207639_10354144 3300026041 Bacteria 1312
257 Ga0207702_10044326 3300026078 Bacteria 3738
258 Ga0207702_10174180 3300026078 Bacteria 1976
259 Ga0207641_10017493 3300026088 Bacteria 5869
260 Ga0207641_10101119 3300026088 Bacteria 2540
261 Ga0207648_10098118 3300026089 Bacteria 2565
262 Ga0207676_10015349 3300026095 Bacteria 5521
263 Ga0207674_10001365 3300026116 Bacteria 31614
264 Ga0207674_10102115 3300026116 Bacteria 2848
265 Ga0207674_10686390 3300026116 Bacteria 989
266 Ga0207675_100245823 3300026118 Bacteria 1730
267 Ga0207683_10055172 3300026121 Bacteria 3485
268 Ga0207698_10096031 3300026142 Bacteria 2442
269 Ga0207698_10455521 3300026142 Bacteria 1236
270 Ga0210000_1019352 3300027462 Bacteria 1037
271 Ga0209995_1003730 3300027471 Bacteria 2430
272 Ga0209995_1009997 3300027471 Bacteria 1536
273 Ga0268266_10076947 3300028379 Bacteria 2901
274 Ga0268265_10056253 3300028380 Bacteria 2992
275 Ga0268265_10104789 3300028380 Bacteria 2293
276 Ga0268264_10009948 3300028381 Bacteria 7874
277 Ga0268264_10522391 3300028381 Bacteria 1161
278 Ga0265338_10086652 3300028800 Bacteria 2605
279 Ga0265332_10017263 3300031238 Bacteria 3184
280 Ga0265327_10033939 3300031251 Bacteria 2837
281 Ga0316576_10368767 3300031727 Bacteria 1067
282 Ga0307405_10053691 3300031731 Bacteria 2511
283 Ga0307413_10081931 3300031824 Bacteria 2071
284 Ga0307413_10121918 3300031824 Bacteria 1768
285 Ga0307413_10186023 3300031824 Bacteria 1486
286 Ga0307413_10285561 3300031824 Bacteria 1243
287 Ga0307410_10153310 3300031852 Bacteria 1718
288 Ga0307406_10061282 3300031901 Bacteria 2429
289 Ga0307407_10034797 3300031903 Bacteria 2762
290 Ga0307407_10046212 3300031903 Bacteria 2464
291 Ga0307407_10132414 3300031903 Bacteria 1597
292 Ga0307412_10012283 3300031911 Bacteria 4987
293 Ga0307412_10048180 3300031911 Bacteria 2801
294 Ga0307409_100177420 3300031995 Bacteria 1882
295 Ga0307416_100005833 3300032002 Bacteria 7636
296 Ga0307414_10357480 3300032004 Bacteria 1255
297 Ga0373926_0002415 3300035083 Bacteria 5921
298 Ga0373934_0077927 3300035086 Bacteria 1329
299 Ga0373944_0061311 3300035089 Bacteria 1207
300 Ga0373923_0052388 3300035111 Bacteria 1714
301 Ga0373945_0006262 3300035116 Bacteria 3833
302 Ga0373945_0011217 3300035116 Bacteria 2961
303 Ga0373953_0003399 3300035117 Bacteria 4951
304 Ga0373954_0012335 3300035118 Bacteria 3798
305 Ga0373954_0215618 3300035118 Bacteria 944
306 Ga0373955_0001896 3300035172 Bacteria 9019
307 Ga0373931_0003254 3300035691 Bacteria 7264
308 Ga0373935_0007600 3300035692 Bacteria 6491
309 Ga0373927_0076975 3300035695 Bacteria 2160
310 Ga0373927_0133595 3300035695 Bacteria 1621
311 Ga0373947_0000123 3300035725 Bacteria 39071
312 Ga0373937_0028977 3300036401 Bacteria 5014
313 Ga0373937_0363057 3300036401 Bacteria 1372
314 Ga0373937_0817583 3300036401 Bacteria 880
315 Ga0373925_0001983 3300037068 Bacteria 16951
316 Ga0373925_0098036 3300037068 Bacteria 2249
317 Ga0436365_1220956 3300039437 Bacteria 2468
318 Ga0436365_1778386 3300039437 Bacteria 944
319 Ga0451577_0036930 3300042876 Bacteria 4398
320 Ga0453683_0122418 3300044673 Bacteria 1638
321 Ga0466963_0099635 3300044694 Bacteria 1988
322 Ga0453684_0000617 3300044712 Bacteria 130120
323 Ga0453684_0065064 3300044712 Bacteria 4652
324 Ga0466959_0050360 3300045049 Bacteria 3058
325 Ga0451576_0027705 3300045051 Bacteria 6083
326 Ga0451576_0056758 3300045051 Bacteria 4094
327 Ga0466958_0080965 3300045836 Bacteria 1998
328 Ga0466967_0349824 3300045976 Bacteria 1430
329 Ga0495592_0005002 3300046454 Bacteria 9760
330 Ga0495603_0021183 3300046455 Bacteria 3936
331 Ga0495629_0007989 3300046459 Bacteria 7784
332 Ga0495629_0018684 3300046459 Bacteria 4955
333 Ga0495629_0104005 3300046459 Bacteria 1981
334 Ga0495641_0033426 3300046461 Bacteria 2441
335 Ga0495651_0003057 3300046462 Bacteria 12913
336 Ga0495653_0008227 3300046463 Bacteria 8546
337 Ga0495580_0000872 3300046472 Bacteria 26075
338 Ga0495580_0055088 3300046472 Bacteria 2803
339 Ga0495582_0004569 3300046473 Bacteria 7772
340 Ga0495582_0083763 3300046473 Bacteria 1772
341 Ga0495639_0000117 3300046475 Bacteria 40157
342 Ga0495594_0004546 3300046499 Bacteria 7137
343 Ga0495594_0012340 3300046499 Bacteria 4451
344 Ga0495594_0141394 3300046499 Bacteria 1365
345 Ga0495628_0005595 3300046516 Bacteria 11000
346 Ga0495630_0001819 3300046517 Bacteria 14876
347 Ga0495630_0041452 3300046517 Bacteria 3438
348 Ga0495666_0026398 3300046526 Bacteria 2863
349 Ga0495652_0134860 3300046529 Bacteria 1949
350 Ga0495652_0194468 3300046529 Bacteria 1545
351 Ga0495665_0000362 3300046531 Bacteria 22903
352 Ga0495665_0137461 3300046531 Bacteria 1278
353 Ga0495640_0085801 3300046533 Bacteria 2086
354 Ga0495586_0036288 3300046535 Bacteria 2646
355 Ga0495586_0186417 3300046535 Bacteria 1175
356 Ga0495587_0003085 3300046536 Bacteria 11130
357 Ga0495645_0002661 3300046543 Bacteria 12139
358 Ga0495645_0004316 3300046543 Bacteria 9715
359 Ga0495667_0007606 3300046559 Bacteria 7355
360 Ga0495634_0100785 3300046642 Bacteria 1866
361 Ga0495635_0016076 3300046663 Bacteria 5226
362 Ga0495635_0211790 3300046663 Bacteria 1312
363 Ga0495657_0161754 3300046675 Bacteria 1385
364 Ga0495599_0003366 3300046678 Bacteria 9344
365 Ga0495599_0020060 3300046678 Bacteria 4164
366 Ga0495658_0000095 3300046683 Bacteria 46039
367 Ga0495658_0083995 3300046683 Unclassified 1874
368 Ga0495613_0022404 3300046689 Bacteria 4708
369 Ga0495600_0016094 3300046809 Bacteria 4741
370 Ga0495600_0042968 3300046809 Bacteria 2946
371 Ga0495600_0096991 3300046809 Bacteria 1922
372 Ga0495581_0000662 3300047315 Bacteria 18083
373 Ga0495581_0042835 3300047315 Bacteria 2619
374 Ga0495604_0004690 3300047317 Bacteria 10841
375 Ga0495674_0090226 3300047319 Bacteria 2619
376 Ga0495680_0025804 3300047322 Bacteria 4858
377 Ga0495675_0005691 3300047444 Bacteria 7616
378 Ga0495675_0044344 3300047444 Bacteria 2833
379 Ga0495677_0054342 3300047445 Unclassified 1477
380 Ga0495684_0007844 3300047471 Bacteria 8261
381 Ga0495684_0341160 3300047471 Bacteria 1066
382 Ga0495593_0000896 3300047673 Bacteria 17308
383 Ga0495602_0072044 3300048088 Bacteria 2948
384 Ga0495614_0000104 3300048089 Bacteria 28897
385 Ga0496101_0072742 3300048904 Bacteria 2524
386 Ga0496102_0002168 3300048905 Bacteria 16849
387 Ga0496103_0010140 3300048906 Bacteria 5571
388 Ga0496104_0018711 3300048907 Bacteria 6322
389 Ga0496105_0106207 3300048908 Bacteria 2318
390 Ga0496106_0030552 3300048909 Bacteria 4015
391 Ga0496108_0140132 3300048911 Bacteria 2083
392 Ga0496109_0005313 3300048912 Bacteria 10765
393 Ga0496110_0029093 3300048913 Bacteria 4750
394 Ga0496111_0004841 3300048914 Bacteria 8541
395 Ga0496112_0005923 3300048915 Bacteria 10661
396 Ga0496112_0035687 3300048915 Bacteria 4846
397 Ga0496113_0001879 3300048916 Bacteria 11973
398 Ga0496115_0010495 3300048918 Bacteria 6923
399 Ga0496115_0131245 3300048918 Bacteria 2065
400 Ga0496119_0246071 3300048922 Unclassified 903
401 Ga0501031_0000459 3300049568 Bacteria 23626
402 Ga0501033_0000005 3300049570 Bacteria 379089
403 Ga0501034_0000259 3300049571 Bacteria 95584
404 Ga0501034_0237906 3300049571 Bacteria 1768
405 Ga0501036_0007883 3300049572 Bacteria 8711
406 Ga0501037_0132183 3300049573 Bacteria 1789
407 Ga0501038_0007600 3300049574 Bacteria 9995
408 Ga0501039_0002829 3300049575 Bacteria 12972
409 Ga0501043_0008234 3300049579 Bacteria 8216
410 Ga0501047_0163276 3300049581 Bacteria 2099
411 Ga0501047_0212237 3300049581 Bacteria 1794
412 Ga0501070_0187825 3300049586 Bacteria 1699
413 Ga0501235_002543 3300049669 Bacteria 3925
414 Ga0501225_0000715 3300049705 Bacteria 10435
415 Ga0501080_0779468 3300049742 Bacteria 840
416 Ga0501035_0010943 3300049822 Bacteria 8402
417 Ga0501044_0030786 3300049823 Bacteria 5652
418 Ga0501044_0546151 3300049823 Bacteria 1056
419 Ga0501045_0000307 3300049824 Bacteria 28643
420 nmdc:mga05p37_113417_c1 3300050507 Bacteria 3333
421 nmdc:mga05p37_32338_c1 3300050507 Bacteria 4450
422 nmdc:mga05p37_641669_c1 3300050507 Bacteria 1191
423 nmdc:mga09592_1400_c1 3300050508 Bacteria 19294
424 nmdc:mga09592_325960_c1 3300050508 Bacteria 1330
425 nmdc:mga08y16_158556_c1 3300050511 Bacteria 2351
426 nmdc:mga0n895_215246_c1 3300050512 Bacteria 1951
427 nmdc:mga0rr50_382474_c1 3300050513 Bacteria 1187
428 nmdc:mga0a205_102838_c1 3300050515 Bacteria 2755
429 nmdc:mga0a205_71927_c1 3300050515 Bacteria 3340
430 Ga0495601_0281812 3300053077 Bacteria 1083
431 Ga0495612_0000807 3300053078 Bacteria 12764
432 Ga0495595_0170529 3300053084 Bacteria 1077
433 Ga0495619_0003992 3300053085 Bacteria 9457
434 Ga0207697_10008372
435 MBSR1b_contig_11525244
436 JGI24752J21851_1011473
437 Ga0065715_10094976
438 Ga0070658_10083078
439 Ga0070658_10148970
440 Ga0070676_10049070
441 Ga0070683_100002016
442 Ga0070683_100007884
443 Ga0070683_100031558
444 Ga0070683_100044917
445 Ga0070683_100054480
446 Ga0070683_100129629
447 Ga0070683_100144030
448 Ga0070683_100384821
449 Ga0070683_100573064
450 Ga0070683_100584708
451 Ga0070690_100067031
452 Ga0070690_100253484
453 Ga0070690_100410377
454 Ga0070670_100014874
455 Ga0068869_100008216
456 Ga0068869_100086820
457 Ga0068869_100095379
458 Ga0070666_10038854
459 Ga0070680_100022455
460 Ga0070680_100049855
461 Ga0070680_100059190
462 Ga0070682_100012166
463 Ga0068868_100036156
464 Ga0070687_100026770
465 Ga0070661_100004608
466 Ga0070661_100122207
467 Ga0070692_10061889
468 Ga0070668_100069283
469 Ga0070675_100014760
470 Ga0070675_100133232
471 Ga0070675_100260328
472 Ga0070671_100188857
473 Ga0070673_100049029
474 Ga0070659_100011507
475 Ga0070709_10023174
476 Ga0070709_10073590
477 Ga0070709_10282347
478 Ga0070714_100108379
479 Ga0070714_100136015
480 Ga0070713_100000223
481 Ga0070713_100010218
482 Ga0070713_100034995
483 Ga0070713_100038712
484 Ga0070701_10094470
485 Ga0070711_100238417
486 Ga0070711_100331387
487 Ga0070705_100002442
488 Ga0070694_100060464
489 Ga0070694_100425217
490 Ga0070708_100000007
491 Ga0070662_100009125
492 Ga0070662_100072180
493 Ga0070681_10000978
494 Ga0070681_10027504
495 Ga0070681_10027690
496 Ga0070685_10189256
497 Ga0070706_100089052
498 Ga0070707_100084104
499 Ga0070707_100207869
500 Ga0070698_100034646
501 Ga0070698_100058577
502 Ga0070698_100164770
503 Ga0070698_100189417
504 Ga0070698_100567005
505 Ga0070699_100000024
506 Ga0070699_100077816
507 Ga0070699_100137468
508 Ga0070679_100005712
509 Ga0070679_100007387
510 Ga0070679_100025597
511 Ga0070679_100133562
512 Ga0070679_100282586
513 Ga0070679_100485221
514 Ga0070684_100011325
515 Ga0070684_100054145
516 Ga0070684_100094069
517 Ga0070684_100124591
518 Ga0070684_100129922
519 Ga0070684_100146634
520 Ga0070684_100193773
521 Ga0070684_100556110
522 Ga0068853_100292729
523 Ga0068853_100715568
524 Ga0070686_100143901
525 Ga0070696_100000366
526 Ga0070696_100010341
527 Ga0070693_100006198
528 Ga0070693_100008346
529 Ga0070704_100000546
530 Ga0070704_100011501
531 Ga0068855_100072626
532 Ga0068855_100107945
533 Ga0068855_100137335
534 Ga0070664_100016569
535 Ga0068857_100022867
536 Ga0068856_100054986
537 Ga0068856_100067511
538 Ga0068852_100033592
539 Ga0068852_100512529
540 Ga0068859_100011471
541 Ga0068859_100012064
542 Ga0068859_100035842
543 Ga0068859_100215199
544 Ga0068859_100251000
545 Ga0068859_100597556
546 Ga0068864_100020285
547 Ga0068861_100376899
548 Ga0068863_100016544
549 Ga0068858_100589253
550 Ga0068860_100024706
551 Ga0081539_10000290
552 Ga0070717_10017368
553 Ga0070717_10092280
554 Ga0070716_100130385
555 Ga0070716_100429362
556 Ga0070712_100157089
557 Ga0097621_100026170
558 Ga0068871_100024103
559 Ga0075428_100033832
560 Ga0075428_100104380
561 Ga0075431_100017051
562 Ga0075431_100024684
563 Ga0075433_10119938
564 Ga0075433_10223162
565 Ga0075434_100021100
566 Ga0075429_100002822
567 Ga0075429_100471453
568 Ga0068865_100034114
569 Ga0097620_100011471
570 Ga0097620_100012064
571 Ga0097620_100035840
572 Ga0097620_100215196
573 Ga0097620_100250984
574 Ga0097620_100597518
575 Ga0105240_10118852
576 Ga0111539_10194907
577 Ga0105245_10011794
578 Ga0105245_10740663
579 Ga0114129_10002529
580 Ga0114129_10005319
581 Ga0114129_10018253
582 Ga0105241_10151771
583 Ga0105241_10336244
584 Ga0105242_10004361
585 Ga0105242_10123309
586 Ga0105248_10006255
587 Ga0105248_10018959
588 Ga0105248_10160471
589 Ga0105237_10138392
590 Ga0105238_10021569
591 Ga0105249_10431489
592 Ga0105249_10468096
593 Ga0105239_10008939
594 Ga0105246_10004459
595 Ga0157373_10052000
596 Ga0157371_10048328
597 Ga0157370_10002257
598 Ga0157370_10035353
599 Ga0157370_10590245
600 Ga0157369_10095473
601 Ga0157369_10181359
602 Ga0157369_10411850
603 Ga0157369_10488490
604 Ga0157374_10065113
605 Ga0157378_10519897
606 Ga0163162_10059814
607 Ga0163162_10152003
608 Ga0163162_10224517
609 Ga0163162_10577020
610 Ga0157372_10002903
611 Ga0157372_10007361
612 Ga0157372_10041041
613 Ga0157372_10043513
614 Ga0157372_10168705
615 Ga0157372_10214074
616 Ga0157375_10027197
617 Ga0157375_10216992
618 Ga0163163_10158670
619 Ga0157380_10421715
620 Ga0157377_10014284
621 Ga0157376_10149935
622 Ga0157376_10424653
623 Ga0206352_11185906
624 Ga0207682_10130836
625 Ga0207699_10001315
626 Ga0207699_10037803
627 Ga0207699_10120239
628 Ga0207705_10064956
629 Ga0207654_10102761
630 Ga0207707_10037085
631 Ga0207707_10226105
632 Ga0207695_10066375
633 Ga0207693_10059649
634 Ga0207663_10243841
635 Ga0207660_10031074
636 Ga0207660_10126431
637 Ga0207662_10044367
638 Ga0207649_10004047
639 Ga0207652_10008351
640 Ga0207652_10016297
641 Ga0207652_10037839
642 Ga0207652_10263572
643 Ga0207652_10328923
644 Ga0207694_10026192
645 Ga0207650_10031285
646 Ga0207650_10113460
647 Ga0207650_10457596
648 Ga0207659_10101099
649 Ga0207659_10131929
650 Ga0207659_10178656
651 Ga0207687_10110193
652 Ga0207700_10000633
653 Ga0207700_10018297
654 Ga0207700_10035334
655 Ga0207700_10265529
656 Ga0207664_10020800
657 Ga0207664_10060722
658 Ga0207664_10135735
659 Ga0207644_10029711
660 Ga0207690_10050733
661 Ga0207706_10005722
662 Ga0207706_10019828
663 Ga0207686_10061905
664 Ga0207670_10326941
665 Ga0207704_10213004
666 Ga0207665_10085041
667 Ga0207665_10557119
668 Ga0207691_10084368
669 Ga0207711_10220999
670 Ga0207711_10307906
671 Ga0207689_10002072
672 Ga0207689_10008190
673 Ga0207661_10004811
674 Ga0207661_10005194
675 Ga0207661_10074049
676 Ga0207661_10111261
677 Ga0207661_10128162
678 Ga0207661_10217787
679 Ga0207679_10003073
680 Ga0207667_10098163
681 Ga0207667_10178852
682 Ga0207667_10308578
683 Ga0207651_10021159
684 Ga0207712_10087816
685 Ga0207712_10315354
686 Ga0207677_10088770
687 Ga0207703_10646822
688 Ga0207639_10252210
689 Ga0207639_10354144
690 Ga0207702_10044326
691 Ga0207702_10174180
692 Ga0207641_10017493
693 Ga0207641_10101119
694 Ga0207648_10098118
695 Ga0207676_10015349
696 Ga0207674_10001365
697 Ga0207674_10102115
698 Ga0207674_10686390
699 Ga0207675_100245823
700 Ga0207683_10055172
701 Ga0207698_10096031
702 Ga0207698_10455521
703 Ga0210000_1019352
704 Ga0209995_1003730
705 Ga0209995_1009997
706 Ga0268266_10076947
707 Ga0268265_10056253
708 Ga0268265_10104789
709 Ga0268264_10009948
710 Ga0268264_10522391
711 Ga0265338_10086652
712 Ga0265332_10017263
713 Ga0265327_10033939
714 Ga0316576_10368767
715 Ga0307405_10053691
716 Ga0307413_10081931
717 Ga0307413_10121918
718 Ga0307413_10186023
719 Ga0307413_10285561
720 Ga0307410_10153310
721 Ga0307406_10061282
722 Ga0307407_10034797
723 Ga0307407_10046212
724 Ga0307407_10132414
725 Ga0307412_10012283
726 Ga0307412_10048180
727 Ga0307409_100177420
728 Ga0307416_100005833
729 Ga0307414_10357480
730 Ga0373926_0002415
731 Ga0373934_0077927
732 Ga0373944_0061311
733 Ga0373923_0052388
734 Ga0373945_0006262
735 Ga0373945_0011217
736 Ga0373953_0003399
737 Ga0373954_0012335
738 Ga0373954_0215618
739 Ga0373955_0001896
740 Ga0373931_0003254
741 Ga0373935_0007600
742 Ga0373927_0076975
743 Ga0373927_0133595
744 Ga0373947_0000123
745 Ga0373937_0028977
746 Ga0373937_0363057
747 Ga0373937_0817583
748 Ga0373925_0001983
749 Ga0373925_0098036
750 Ga0436365_1220956
751 Ga0436365_1778386
752 Ga0451577_0036930
753 Ga0453683_0122418
754 Ga0466963_0099635
755 Ga0453684_0000617
756 Ga0453684_0065064
757 Ga0466959_0050360
758 Ga0451576_0027705
759 Ga0451576_0056758
760 Ga0466958_0080965
761 Ga0466967_0349824
762 Ga0495592_0005002
763 Ga0495603_0021183
764 Ga0495629_0007989
765 Ga0495629_0018684
766 Ga0495629_0104005
767 Ga0495641_0033426
768 Ga0495651_0003057
769 Ga0495653_0008227
770 Ga0495580_0000872
771 Ga0495580_0055088
772 Ga0495582_0004569
773 Ga0495582_0083763
774 Ga0495639_0000117
775 Ga0495594_0004546
776 Ga0495594_0012340
777 Ga0495594_0141394
778 Ga0495628_0005595
779 Ga0495630_0001819
780 Ga0495630_0041452
781 Ga0495666_0026398
782 Ga0495652_0134860
783 Ga0495652_0194468
784 Ga0495665_0000362
785 Ga0495665_0137461
786 Ga0495640_0085801
787 Ga0495586_0036288
788 Ga0495586_0186417
789 Ga0495587_0003085
790 Ga0495645_0002661
791 Ga0495645_0004316
792 Ga0495667_0007606
793 Ga0495634_0100785
794 Ga0495635_0016076
795 Ga0495635_0211790
796 Ga0495657_0161754
797 Ga0495599_0003366
798 Ga0495599_0020060
799 Ga0495658_0000095
800 Ga0495658_0083995
801 Ga0495613_0022404
802 Ga0495600_0016094
803 Ga0495600_0042968
804 Ga0495600_0096991
805 Ga0495581_0000662
806 Ga0495581_0042835
807 Ga0495604_0004690
808 Ga0495674_0090226
809 Ga0495680_0025804
810 Ga0495675_0005691
811 Ga0495675_0044344
812 Ga0495677_0054342
813 Ga0495684_0007844
814 Ga0495684_0341160
815 Ga0495593_0000896
816 Ga0495602_0072044
817 Ga0495614_0000104
818 Ga0496101_0072742
819 Ga0496102_0002168
820 Ga0496103_0010140
821 Ga0496104_0018711
822 Ga0496105_0106207
823 Ga0496106_0030552
824 Ga0496108_0140132
825 Ga0496109_0005313
826 Ga0496110_0029093
827 Ga0496111_0004841
828 Ga0496112_0005923
829 Ga0496112_0035687
830 Ga0496113_0001879
831 Ga0496115_0010495
832 Ga0496115_0131245
833 Ga0496119_0246071
834 Ga0501031_0000459
835 Ga0501033_0000005
836 Ga0501034_0000259
837 Ga0501034_0237906
838 Ga0501036_0007883
839 Ga0501037_0132183
840 Ga0501038_0007600
841 Ga0501039_0002829
842 Ga0501043_0008234
843 Ga0501047_0163276
844 Ga0501047_0212237
845 Ga0501070_0187825
846 Ga0501235_002543
847 Ga0501225_0000715
848 Ga0501080_0779468
849 Ga0501035_0010943
850 Ga0501044_0030786
851 Ga0501044_0546151
852 Ga0501045_0000307
853 nmdc:mga05p37_113417_c1
854 nmdc:mga05p37_32338_c1
855 nmdc:mga05p37_641669_c1
856 nmdc:mga09592_1400_c1
857 nmdc:mga09592_325960_c1
858 nmdc:mga08y16_158556_c1
859 nmdc:mga0n895_215246_c1
860 nmdc:mga0rr50_382474_c1
861 nmdc:mga0a205_102838_c1
862 nmdc:mga0a205_71927_c1
863 Ga0495601_0281812
864 Ga0495612_0000807
865 Ga0495595_0170529
866 Ga0495619_0003992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

42

301

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9864 6 238
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.974 6 238
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9733 3 249
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.9713 1 249
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.9675 1 249
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9708 1 249 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.967 1 249 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8358 4 243 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.805 4 243 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.778 4 209 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A699WU94-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9974 39 159 GO:0005829
GO:0010124
AF-A0A3D0ZKV3-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.993 102 199 GO:0005829
GO:0010124
AF-A0A6N8PLU7-F1-model_v4 deleted 0.9917 90 215
AF-A0A4Q2LMM2-F1-model_v4 deleted 0.9909 50 138
AF-A0A377CVP2-F1-model_v4 Multicomponent oxygenase/reductase subunit for phenylacetic acid degradation 0.9892 61 174 GO:0005829
GO:0010124

Map