metagRoot

F442880

General Info

Members	Datasets	Scaffolds	Average Seq Length
433	240	433	114

Family's Representative Sequence

Representative Sequence	3300031824\|Ga0307413_10096772\|Ga0307413_100967722
Length	124
Sequence	MAGRSAIDEAKKGSAEILILAIVEGESHHGYEIAKLIEQRSGGDLRFTLASLYATLYRLEDRGWIKGRWVEKAGQRRRCHYRITDTGRKVLVEQRADWQRFVAALGQVAGVRYLPAEALAKPGA

Samples

	Sample ID	Description	Type	Environment
1	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
2	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
3	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
7	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
8	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
11	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
14	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
15	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
16	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
20	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
21	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
22	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
23	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
24	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
25	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
26	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
27	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
31	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
32	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
33	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
40	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
41	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
42	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
43	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
44	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
45	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
46	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
47	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
48	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
49	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
53	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
54	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
55	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
56	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
57	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
58	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
59	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
60	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
61	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
62	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
63	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
64	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
65	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
66	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
67	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
68	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
70	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
71	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
72	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
73	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
74	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
75	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
78	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
80	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
81	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
85	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
86	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
92	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
99	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
141	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
145	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
146	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
147	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
148	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
149	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
150	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
151	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
152	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
153	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
154	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
155	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
156	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
157	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
158	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
159	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
160	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
161	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
162	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
163	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
164	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
165	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
167	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
168	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
169	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
170	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
171	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
172	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
173	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
174	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
175	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
176	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
177	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
178	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
179	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
180	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
181	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
182	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
183	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
184	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
185	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
186	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
187	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
188	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
189	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
190	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
191	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
192	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
193	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
194	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
195	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
196	3300049516	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought	Metagenome	Rhizosphere
197	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
198	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
201	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
202	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
204	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
205	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
206	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
207	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
208	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
209	3300049656	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought	Metagenome	Rhizosphere
210	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
211	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
212	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
213	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
214	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
215	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
216	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
217	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
220	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
221	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
222	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
223	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
224	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
225	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
226	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
227	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
228	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
229	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
230	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
231	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
232	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
233	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
234	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
235	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
236	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
237	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
238	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
239	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
240	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.85
Nodule	0
Rhizoplane	3
Rhizosphere	87.99
Stem	0
Stem Tuber	0
Unclassified	1.15

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	ARSoilOldRDRAFT_c011720	3300000044	Bacteria	736
2	Ga0065715_10123734	3300005293	Unclassified	2166
3	Ga0065715_10439526	3300005293	Bacteria	838
4	Ga0070676_10539604	3300005328	Unclassified	833
5	Ga0070676_11098069	3300005328	Unclassified	601
6	Ga0070676_11554404	3300005328	Unclassified	510
7	Ga0070683_100001291	3300005329	Bacteria	19074
8	Ga0070690_100720624	3300005330	Bacteria	767
9	Ga0070670_100004508	3300005331	Bacteria	11673
10	Ga0070670_100018958	3300005331	Bacteria	5900
11	Ga0070670_100098644	3300005331	Bacteria	2514
12	Ga0070670_100540411	3300005331	Unclassified	1039
13	Ga0070670_100830181	3300005331	Unclassified	836
14	Ga0068869_100016854	3300005334	Bacteria	4937
15	Ga0068869_101706520	3300005334	Unclassified	562
16	Ga0070666_10084544	3300005335	Unclassified	2172
17	Ga0070666_10867642	3300005335	Unclassified	666
18	Ga0070680_101013679	3300005336	Bacteria	717
19	Ga0070680_101962899	3300005336	Unclassified	507
20	Ga0068868_100073387	3300005338	Bacteria	2732
21	Ga0070660_100702604	3300005339	Unclassified	848
22	Ga0070660_101408864	3300005339	Unclassified	592
23	Ga0070689_100044393	3300005340	Bacteria	3419
24	Ga0070689_100951015	3300005340	Unclassified	762
25	Ga0070691_10062122	3300005341	Unclassified	1798
26	Ga0070687_100021347	3300005343	Bacteria	3042
27	Ga0070661_100005089	3300005344	Bacteria	9071
28	Ga0070661_100432895	3300005344	Bacteria	1044
29	Ga0070661_101729874	3300005344	Bacteria	530
30	Ga0070692_11074266	3300005345	Bacteria	567
31	Ga0070668_100073673	3300005347	Bacteria	2662
32	Ga0070668_100368409	3300005347	Unclassified	1220
33	Ga0070669_100188437	3300005353	Bacteria	1617
34	Ga0070669_101292512	3300005353	Unclassified	632
35	Ga0070675_100005678	3300005354	Bacteria	9552
36	Ga0070675_100052850	3300005354	Bacteria	3341
37	Ga0070675_100420308	3300005354	Bacteria	1195
38	Ga0070674_100030256	3300005356	Bacteria	3575
39	Ga0070674_100076792	3300005356	Bacteria	2376
40	Ga0070674_100085304	3300005356	Bacteria	2266
41	Ga0070674_101638010	3300005356	Unclassified	581
42	Ga0070673_100164498	3300005364	Unclassified	1889
43	Ga0070673_100715944	3300005364	Bacteria	920
44	Ga0070673_100973057	3300005364	Unclassified	789
45	Ga0070688_100070288	3300005365	Unclassified	2238
46	Ga0070667_100058651	3300005367	Bacteria	3255
47	Ga0070701_10299069	3300005438	Bacteria	989
48	Ga0070711_100536115	3300005439	Unclassified	969
49	Ga0070700_100543141	3300005441	Unclassified	902
50	Ga0070694_100104642	3300005444	Bacteria	2007
51	Ga0070694_101291099	3300005444	Unclassified	614
52	Ga0070694_101405191	3300005444	Unclassified	589
53	Ga0070663_100057657	3300005455	Unclassified	2787
54	Ga0070678_100008937	3300005456	Bacteria	6034
55	Ga0070662_100169288	3300005457	Unclassified	1715
56	Ga0070662_101149023	3300005457	Unclassified	667
57	Ga0070662_101635084	3300005457	Unclassified	556
58	Ga0070681_10427876	3300005458	Bacteria	1236
59	Ga0070681_10524972	3300005458	Bacteria	1097
60	Ga0068867_100059178	3300005459	Bacteria	2840
61	Ga0070685_10010990	3300005466	Bacteria	4723
62	Ga0070685_11367895	3300005466	Bacteria	542
63	Ga0070706_100721389	3300005467	Bacteria	924
64	Ga0070699_100109892	3300005518	Bacteria	2420
65	Ga0070699_100289800	3300005518	Bacteria	1468
66	Ga0070679_100307290	3300005530	Unclassified	1536
67	Ga0070684_100002598	3300005535	Bacteria	13334
68	Ga0070672_100051872	3300005543	Bacteria	3201
69	Ga0070686_100033017	3300005544	Bacteria	3177
70	Ga0070695_100423756	3300005545	Bacteria	1014
71	Ga0070696_100104703	3300005546	Bacteria	2032
72	Ga0070693_100011551	3300005547	Bacteria	4450
73	Ga0070665_100229772	3300005548	Unclassified	1855
74	Ga0070665_101643631	3300005548	Bacteria	650
75	Ga0070704_100039551	3300005549	Bacteria	3239
76	Ga0070704_101378500	3300005549	Unclassified	646
77	Ga0068855_100088644	3300005563	Bacteria	3574
78	Ga0070664_100001167	3300005564	Bacteria	20855
79	Ga0070664_100059400	3300005564	Unclassified	3253
80	Ga0070664_100187018	3300005564	Bacteria	1844
81	Ga0070664_101249068	3300005564	Unclassified	701
82	Ga0068857_100016084	3300005577	Bacteria	6555
83	Ga0068854_100607810	3300005578	Bacteria	934
84	Ga0068856_100464659	3300005614	Bacteria	1286
85	Ga0070702_100225309	3300005615	Unclassified	1256
86	Ga0068852_101825751	3300005616	Unclassified	630
87	Ga0068859_100033779	3300005617	Bacteria	5135
88	Ga0068859_100139935	3300005617	Bacteria	2494
89	Ga0068859_100864088	3300005617	Bacteria	990
90	Ga0068864_100663138	3300005618	Unclassified	1017
91	Ga0068864_100975343	3300005618	Bacteria	840
92	Ga0068866_10010213	3300005718	Bacteria	4016
93	Ga0068861_100073378	3300005719	Unclassified	2658
94	Ga0068863_100026718	3300005841	Bacteria	5504
95	Ga0068858_100027665	3300005842	Bacteria	5268
96	Ga0068860_100023059	3300005843	Bacteria	6020
97	Ga0068862_100201544	3300005844	Unclassified	1794
98	Ga0068862_101030565	3300005844	Bacteria	815
99	Ga0081455_10686733	3300005937	Unclassified	654
100	Ga0075365_10232608	3300006038	Bacteria	1294
101	Ga0075368_10022457	3300006042	Bacteria	2403
102	Ga0075363_100137472	3300006048	Bacteria	1374
103	Ga0075364_10006716	3300006051	Bacteria	6783
104	Ga0075364_10014480	3300006051	Bacteria	4874
105	Ga0075364_10059271	3300006051	Bacteria	2509
106	Ga0075362_10043257	3300006177	Bacteria	1994
107	Ga0075362_10648712	3300006177	Unclassified	548
108	Ga0075367_10000811	3300006178	Bacteria	12333
109	Ga0075366_10000053	3300006195	Bacteria	41498
110	Ga0075366_10477507	3300006195	Unclassified	770
111	Ga0097621_100616277	3300006237	Bacteria	993
112	Ga0075370_10010513	3300006353	Bacteria	4840
113	Ga0075370_10674752	3300006353	Bacteria	628
114	Ga0075428_100003387	3300006844	Bacteria	17432
115	Ga0075428_100010142	3300006844	Bacteria	10466
116	Ga0075428_100012136	3300006844	Bacteria	9586
117	Ga0075428_100133032	3300006844	Unclassified	2704
118	Ga0075428_100474257	3300006844	Bacteria	1339
119	Ga0075430_100034108	3300006846	Bacteria	4318
120	Ga0075430_100076753	3300006846	Unclassified	2801
121	Ga0075430_100360967	3300006846	Unclassified	1200
122	Ga0075431_100019635	3300006847	Bacteria	6894
123	Ga0075431_100022774	3300006847	Bacteria	6403
124	Ga0075431_100114172	3300006847	Unclassified	2788
125	Ga0075431_100177324	3300006847	Bacteria	2188
126	Ga0075431_100318110	3300006847	Unclassified	1570
127	Ga0075431_100470822	3300006847	Bacteria	1250
128	Ga0075431_100710988	3300006847	Bacteria	982
129	Ga0075431_100974378	3300006847	Bacteria	816
130	Ga0075433_10030444	3300006852	Bacteria	4605
131	Ga0075433_10252063	3300006852	Bacteria	1566
132	Ga0075433_10499011	3300006852	Unclassified	1071
133	Ga0075433_10856308	3300006852	Unclassified	793
134	Ga0075433_10928748	3300006852	Unclassified	759
135	Ga0075434_100018392	3300006871	Bacteria	6751
136	Ga0075434_100079447	3300006871	Bacteria	3276
137	Ga0075429_100020077	3300006880	Bacteria	5794
138	Ga0075429_100068257	3300006880	Bacteria	3094
139	Ga0075429_100069289	3300006880	Unclassified	3071
140	Ga0075429_100231436	3300006880	Unclassified	1619
141	Ga0075429_100308336	3300006880	Bacteria	1386
142	Ga0068865_100391722	3300006881	Unclassified	1136
143	Ga0075436_100957269	3300006914	Unclassified	642
144	Ga0097620_100033780	3300006931	Bacteria	5135
145	Ga0097620_100139936	3300006931	Bacteria	2494
146	Ga0097620_100864317	3300006931	Bacteria	990
147	Ga0075435_100080528	3300007076	Unclassified	2674
148	Ga0075435_100537543	3300007076	Unclassified	1012
149	Ga0075435_100574980	3300007076	Unclassified	976
150	Ga0075435_100800588	3300007076	Unclassified	821
151	Ga0105240_11112700	3300009093	Unclassified	840
152	Ga0111539_10000060	3300009094	Bacteria	113197
153	Ga0111539_10021362	3300009094	Bacteria	7969
154	Ga0111539_10138659	3300009094	Bacteria	2848
155	Ga0111539_10475842	3300009094	Bacteria	1455
156	Ga0111539_11066858	3300009094	Unclassified	939
157	Ga0111539_11229709	3300009094	Bacteria	870
158	Ga0111539_12362222	3300009094	Bacteria	617
159	Ga0111539_12484801	3300009094	Unclassified	601
160	Ga0105245_10065831	3300009098	Bacteria	3278
161	Ga0114129_10008098	3300009147	Bacteria	14978
162	Ga0114129_10013047	3300009147	Bacteria	11836
163	Ga0114129_10065625	3300009147	Bacteria	5065
164	Ga0114129_10066040	3300009147	Bacteria	5046
165	Ga0114129_10218679	3300009147	Bacteria	2571
166	Ga0114129_10243504	3300009147	Bacteria	2417
167	Ga0105243_10003419	3300009148	Bacteria	12864
168	Ga0105243_10985202	3300009148	Unclassified	844
169	Ga0105243_11469078	3300009148	Unclassified	704
170	Ga0105243_11555908	3300009148	Unclassified	686
171	Ga0105242_10047262	3300009176	Bacteria	3494
172	Ga0105248_10017600	3300009177	Bacteria	7882
173	Ga0105248_10049359	3300009177	Bacteria	4720
174	Ga0105248_11681872	3300009177	Unclassified	719
175	Ga0105248_13093092	3300009177	Bacteria	530
176	Ga0105249_10091608	3300009553	Unclassified	2844
177	Ga0105249_12334683	3300009553	Bacteria	608
178	Ga0105239_11981064	3300010375	Unclassified	676
179	Ga0105246_10587016	3300011119	Unclassified	961
180	Ga0157374_10082924	3300013296	Unclassified	3045
181	Ga0163162_12533455	3300013306	Bacteria	590
182	Ga0157372_10318607	3300013307	Unclassified	1810
183	Ga0157375_10060534	3300013308	Bacteria	3755
184	Ga0163163_10099607	3300014325	Unclassified	2928
185	Ga0163163_10725279	3300014325	Bacteria	1057
186	Ga0157380_11935362	3300014326	Bacteria	651
187	Ga0157380_12159643	3300014326	Unclassified	620
188	Ga0157377_11488952	3300014745	Unclassified	537
189	Ga0157379_10346959	3300014968	Unclassified	1358
190	Ga0213876_10637158	3300021384	Archaea	567
191	Ga0207697_10195658	3300025315	Unclassified	888
192	Ga0207680_10701032	3300025903	Bacteria	725
193	Ga0207707_10159393	3300025912	Bacteria	1973
194	Ga0207707_11275326	3300025912	Unclassified	591
195	Ga0207695_10789543	3300025913	Unclassified	829
196	Ga0207660_11688428	3300025917	Unclassified	509
197	Ga0207662_10007229	3300025918	Bacteria	6040
198	Ga0207657_10474888	3300025919	Unclassified	980
199	Ga0207649_10041261	3300025920	Unclassified	2809
200	Ga0207649_10506368	3300025920	Bacteria	919
201	Ga0207652_11701047	3300025921	Unclassified	535
202	Ga0207650_10076534	3300025925	Bacteria	2528
203	Ga0207650_10243037	3300025925	Unclassified	1455
204	Ga0207650_10575868	3300025925	Unclassified	945
205	Ga0207650_11803740	3300025925	Unclassified	517
206	Ga0207659_10174911	3300025926	Bacteria	1696
207	Ga0207659_10400073	3300025926	Bacteria	1148
208	Ga0207659_10417887	3300025926	Bacteria	1124
209	Ga0207687_10437683	3300025927	Bacteria	1082
210	Ga0207644_10947852	3300025931	Unclassified	722
211	Ga0207690_10154186	3300025932	Unclassified	1706
212	Ga0207706_10034969	3300025933	Bacteria	4469
213	Ga0207706_10421902	3300025933	Unclassified	1156
214	Ga0207706_11421751	3300025933	Bacteria	569
215	Ga0207686_10049051	3300025934	Bacteria	2619
216	Ga0207709_10039594	3300025935	Bacteria	2816
217	Ga0207670_10919449	3300025936	Bacteria	733
218	Ga0207669_10124112	3300025937	Unclassified	1760
219	Ga0207704_10203753	3300025938	Bacteria	1450
220	Ga0207691_10008992	3300025940	Bacteria	9578
221	Ga0207691_10810894	3300025940	Bacteria	786
222	Ga0207711_10065065	3300025941	Unclassified	3151
223	Ga0207711_11379189	3300025941	Bacteria	647
224	Ga0207711_11571365	3300025941	Unclassified	601
225	Ga0207689_10026509	3300025942	Bacteria	4853
226	Ga0207689_11375590	3300025942	Unclassified	592
227	Ga0207661_10007488	3300025944	Bacteria	7766
228	Ga0207661_10009120	3300025944	Bacteria	7111
229	Ga0207679_10050875	3300025945	Unclassified	3030
230	Ga0207679_10150813	3300025945	Unclassified	1891
231	Ga0207679_11058499	3300025945	Unclassified	744
232	Ga0207679_11871015	3300025945	Unclassified	548
233	Ga0207667_10135582	3300025949	Bacteria	2535
234	Ga0207651_10749900	3300025960	Unclassified	863
235	Ga0207651_12118133	3300025960	Unclassified	505
236	Ga0207712_10266449	3300025961	Bacteria	1392
237	Ga0207668_10179894	3300025972	Bacteria	1667
238	Ga0207668_10594831	3300025972	Bacteria	963
239	Ga0207658_10435676	3300025986	Bacteria	1158
240	Ga0207677_10029945	3300026023	Unclassified	3467
241	Ga0207703_11623136	3300026035	Bacteria	622
242	Ga0207678_10006607	3300026067	Bacteria	10280
243	Ga0207678_10040652	3300026067	Bacteria	4032
244	Ga0207708_10094952	3300026075	Unclassified	2303
245	Ga0207708_10765234	3300026075	Bacteria	829
246	Ga0207648_10003039	3300026089	Bacteria	17729
247	Ga0207676_10154202	3300026095	Unclassified	1982
248	Ga0207676_11198616	3300026095	Bacteria	752
249	Ga0207676_12514683	3300026095	Unclassified	511
250	Ga0207674_10008498	3300026116	Bacteria	11854
251	Ga0207675_100005022	3300026118	Bacteria	12748
252	Ga0207675_102222398	3300026118	Unclassified	563
253	Ga0207683_10070272	3300026121	Bacteria	3093
254	Ga0209983_1021775	3300027665	Bacteria	1342
255	Ga0209813_10056380	3300027866	Unclassified	1243
256	Ga0209813_10160490	3300027866	Unclassified	811
257	Ga0207428_10000065	3300027907	Bacteria	151182
258	Ga0207428_10212250	3300027907	Bacteria	1454
259	Ga0207428_10304778	3300027907	Bacteria	1178
260	Ga0268266_11301547	3300028379	Bacteria	702
261	Ga0268266_11320340	3300028379	Bacteria	697
262	Ga0268265_10238669	3300028380	Unclassified	1602
263	Ga0268265_10370931	3300028380	Bacteria	1313
264	Ga0268264_10124317	3300028381	Unclassified	2278
265	Ga0307408_100752908	3300031548	Unclassified	880
266	Ga0316576_10865323	3300031727	Bacteria	648
267	Ga0316578_10305139	3300031728	Bacteria	951
268	Ga0307405_10024322	3300031731	Bacteria	3458
269	Ga0307413_10096772	3300031824	Unclassified	1939
270	Ga0307413_10321086	3300031824	Bacteria	1183
271	Ga0307410_10028225	3300031852	Bacteria	3557
272	Ga0307410_10296418	3300031852	Unclassified	1274
273	Ga0307410_10659153	3300031852	Bacteria	879
274	Ga0307410_11561241	3300031852	Unclassified	582
275	Ga0307406_10702431	3300031901	Bacteria	844
276	Ga0307407_10023468	3300031903	Bacteria	3220
277	Ga0307407_10087515	3300031903	Unclassified	1901
278	Ga0307407_10715336	3300031903	Bacteria	755
279	Ga0307407_10835354	3300031903	Unclassified	703
280	Ga0307412_11152922	3300031911	Bacteria	692
281	Ga0307409_100047681	3300031995	Bacteria	3254
282	Ga0307409_100438072	3300031995	Bacteria	1258
283	Ga0307409_100446606	3300031995	Bacteria	1247
284	Ga0307409_100768246	3300031995	Bacteria	969
285	Ga0307416_100011134	3300032002	Bacteria	5982
286	Ga0307416_100225356	3300032002	Bacteria	1802
287	Ga0307416_100671932	3300032002	Bacteria	1122
288	Ga0307416_100826005	3300032002	Bacteria	1024
289	Ga0307416_103432219	3300032002	Bacteria	530
290	Ga0307414_10817125	3300032004	Bacteria	851
291	Ga0307411_10005992	3300032005	Bacteria	6040
292	Ga0307411_10070299	3300032005	Bacteria	2368
293	Ga0307411_10511952	3300032005	Unclassified	1017
294	Ga0307411_10781673	3300032005	Unclassified	839
295	Ga0307411_11018370	3300032005	Bacteria	742
296	Ga0307411_11426754	3300032005	Bacteria	634
297	Ga0307411_11772617	3300032005	Unclassified	573
298	Ga0307415_100310695	3300032126	Bacteria	1310
299	Ga0307415_100437061	3300032126	Bacteria	1127
300	Ga0373926_0114433	3300035083	Unclassified	1015
301	Ga0373932_0290690	3300035112	Unclassified	607
302	Ga0373936_0274526	3300035113	Viruses	757
303	Ga0373945_0507514	3300035116	Unclassified	538
304	Ga0373946_0432543	3300035171	Bacteria	668
305	Ga0373947_0079114	3300035725	Unclassified	2031
306	Ga0316584_0866866	3300036712	Bacteria	610
307	Ga0373925_0588530	3300037068	Unclassified	916
308	Ga0436365_0566076	3300039437	Bacteria	3145
309	Ga0439439_0149555	3300041406	Unclassified	662
310	Ga0451835_0651754	3300041492	Bacteria	640
311	Ga0451853_0387463	3300041512	Unclassified	530
312	Ga0451853_3811894	3300041512	Unclassified	934
313	Ga0439462_0035385	3300042015	Bacteria	1328
314	Ga0439462_0064633	3300042015	Unclassified	991
315	Ga0450923_010362	3300042125	Bacteria	1652
316	Ga0450904_030992	3300042139	Unclassified	559
317	Ga0439434_0217673	3300042435	Unclassified	647
318	Ga0439434_0374179	3300042435	Unclassified	500
319	Ga0439435_0003253	3300042436	Unclassified	3357
320	Ga0439435_0012690	3300042436	Bacteria	2047
321	Ga0439435_0030219	3300042436	Bacteria	1468
322	Ga0439444_0160131	3300042437	Bacteria	549
323	Ga0451577_1510276	3300042876	Unclassified	594
324	Ga0466967_0690985	3300045976	Bacteria	1010
325	Ga0495653_0009110	3300046463	Bacteria	8117
326	Ga0495632_0349303	3300046519	Unclassified	650
327	Ga0495621_0502663	3300046539	Unclassified	523
328	Ga0495656_0325810	3300046615	Bacteria	792
329	Ga0495658_0413860	3300046683	Bacteria	860
330	Ga0495669_0125557	3300046684	Bacteria	1205
331	Ga0496100_1022955	3300048903	Bacteria	650
332	Ga0496101_0454320	3300048904	Unclassified	1011
333	Ga0496103_0574087	3300048906	Bacteria	719
334	Ga0496104_0232715	3300048907	Unclassified	1754
335	Ga0496107_0759599	3300048910	Bacteria	711
336	Ga0496108_0005393	3300048911	Bacteria	10337
337	Ga0496109_0000593	3300048912	Bacteria	30294
338	Ga0496109_1822009	3300048912	Unclassified	541
339	Ga0496110_0103288	3300048913	Unclassified	2556
340	Ga0496111_0007585	3300048914	Bacteria	7124
341	Ga0496112_0011781	3300048915	Bacteria	8005
342	Ga0496113_0490926	3300048916	Unclassified	986
343	Ga0496113_0800426	3300048916	Bacteria	749
344	Ga0501292_101544	3300049515	Bacteria	570
345	Ga0501293_027048	3300049516	Unclassified	595
346	Ga0501299_044356	3300049522	Bacteria	902
347	Ga0501034_0026059	3300049571	Bacteria	5955
348	Ga0501036_0254453	3300049572	Bacteria	1471
349	Ga0501039_0095624	3300049575	Bacteria	2316
350	Ga0501039_0695269	3300049575	Unclassified	795
351	Ga0501040_0164564	3300049576	Bacteria	1569
352	Ga0501046_0315421	3300049580	Bacteria	1140
353	Ga0501048_0105225	3300049582	Bacteria	1992
354	Ga0501071_1561679	3300049587	Bacteria	509
355	Ga0501072_0167809	3300049588	Bacteria	1751
356	Ga0501074_1133350	3300049590	Bacteria	549
357	Ga0501075_0076052	3300049591	Unclassified	2539
358	Ga0501075_0319824	3300049591	Bacteria	1182
359	Ga0501076_0176372	3300049592	Bacteria	1742
360	Ga0501209_213999	3300049656	Bacteria	596
361	Ga0501216_141223	3300049660	Bacteria	566
362	Ga0501221_043108	3300049704	Unclassified	991
363	Ga0501079_0364903	3300049741	Unclassified	1132
364	Ga0501080_0314345	3300049742	Bacteria	1419
365	Ga0501080_0684250	3300049742	Bacteria	906
366	Ga0501081_0145470	3300049743	Bacteria	1701
367	Ga0501083_0551292	3300049744	Bacteria	750
368	Ga0501273_019502	3300049770	Bacteria	910
369	Ga0501035_0330249	3300049822	Bacteria	1280
370	Ga0501045_0141749	3300049824	Bacteria	1787
371	nmdc:mga03683_101998_c1	3300050489	Bacteria	1262
372	nmdc:mga03683_15921_c1	3300050489	Bacteria	2816
373	nmdc:mga03n38_124379_c1	3300050490	Bacteria	1271
374	nmdc:mga00v17_1048689_c1	3300050491	Unclassified	512
375	nmdc:mga00v17_180356_c1	3300050491	Unclassified	1363
376	nmdc:mga00v17_223648_c1	3300050491	Bacteria	1219
377	nmdc:mga00v17_3512_c1	3300050491	Bacteria	8101
378	nmdc:mga00v17_435612_c1	3300050491	Bacteria	851
379	nmdc:mga0yw44_353360_c1	3300050492	Bacteria	990
380	nmdc:mga0yw44_685590_c1	3300050492	Bacteria	696
381	nmdc:mga0yw44_78076_c1	3300050492	Unclassified	2070
382	nmdc:mga0k408_1852_c1	3300050493	Bacteria	11361
383	nmdc:mga0k408_546533_c1	3300050493	Unclassified	685
384	nmdc:mga06z11_2186_c1	3300050494	Bacteria	7426
385	nmdc:mga04h51_1219_c1	3300050495	Bacteria	5943
386	nmdc:mga04h51_185353_c1	3300050495	Unclassified	812
387	nmdc:mga07m45_151314_c1	3300050496	Bacteria	1346
388	nmdc:mga07m45_89422_c1	3300050496	Unclassified	1763
389	nmdc:mga05p37_170029_c1	3300050507	Bacteria	2658
390	nmdc:mga05p37_184914_c1	3300050507	Bacteria	2534
391	nmdc:mga05p37_19664_c1	3300050507	Bacteria	8170
392	nmdc:mga05p37_282761_c1	3300050507	Bacteria	1978
393	nmdc:mga05p37_29618_c1	3300050507	Bacteria	6680
394	nmdc:mga05p37_681315_c1	3300050507	Bacteria	1146
395	nmdc:mga09592_107815_c1	3300050508	Unclassified	2389
396	nmdc:mga09592_137686_c1	3300050508	Bacteria	2103
397	nmdc:mga09592_157109_c1	3300050508	Unclassified	1963
398	nmdc:mga09592_35917_c1	3300050508	Bacteria	4150
399	nmdc:mga09592_64366_c1	3300050508	Bacteria	3104
400	nmdc:mga0qj67_112580_c1	3300050509	Bacteria	2197
401	nmdc:mga0qj67_219704_c1	3300050509	Unclassified	1543
402	nmdc:mga0qj67_772780_c1	3300050509	Bacteria	761
403	nmdc:mga06r32_1185228_c1	3300050510	Unclassified	710
404	nmdc:mga06r32_271520_c1	3300050510	Bacteria	1683
405	nmdc:mga06r32_477983_c1	3300050510	Bacteria	1224
406	nmdc:mga06r32_5855_c1	3300050510	Bacteria	11063
407	nmdc:mga06r32_616947_c1	3300050510	Unclassified	1055
408	nmdc:mga06r32_67632_c1	3300050510	Bacteria	3450
409	nmdc:mga06r32_723274_c1	3300050510	Bacteria	960
410	nmdc:mga06r32_923277_c1	3300050510	Unclassified	828
411	nmdc:mga08y16_181_c1	3300050511	Bacteria	55651
412	nmdc:mga08y16_28256_c1	3300050511	Bacteria	5911
413	nmdc:mga08y16_45607_c1	3300050511	Bacteria	4593
414	nmdc:mga08y16_911874_c1	3300050511	Bacteria	864
415	nmdc:mga0n895_1124938_c1	3300050512	Unclassified	762
416	nmdc:mga0n895_464581_c1	3300050512	Unclassified	1277
417	nmdc:mga0n895_55653_c1	3300050512	Unclassified	3893
418	nmdc:mga0n895_940023_c1	3300050512	Unclassified	848
419	nmdc:mga0rr50_1645256_c1	3300050513	Unclassified	541
420	nmdc:mga0rr50_21868_c1	3300050513	Bacteria	4377
421	nmdc:mga0rr50_68062_c1	3300050513	Unclassified	977
422	nmdc:mga0a205_1062335_c1	3300050515	Unclassified	657
423	nmdc:mga0a205_30216_c1	3300050515	Bacteria	5187
424	nmdc:mga0a205_372566_c1	3300050515	Bacteria	1294
425	nmdc:mga0a205_418336_c1	3300050515	Bacteria	1202
426	nmdc:mga0a205_818897_c1	3300050515	Unclassified	779
427	nmdc:mga0sz30_42837_c1	3300050516	Unclassified	1905
428	Ga0495655_0364104	3300053083	Unclassified	508
429	Ga0501084_0516503	3300054114	Bacteria	1010
430	Ga0590075_009071	3300059424	Unclassified	2381
431	Ga0590077_034493	3300059426	Bacteria	1112
432	Ga0501082_0255122	3300060353	Bacteria	1526
433	Ga0501082_0888302	3300060353	Bacteria	780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031727	Ga0316576_10865323	Ga0316576_108653231	110
2	3300031728	Ga0316578_10305139	Ga0316578_103051392	110
3	3300036712	Ga0316584_0866866	Ga0316584_0866866_267_599	110
4	3300042435	Ga0439434_0374179	Ga0439434_0374179_85_417	110
5	3300005617	Ga0068859_100139935	Ga0068859_1001399352	111
6	3300006931	Ga0097620_100139936	Ga0097620_1001399362	111
7	3300025940	Ga0207691_10008992	Ga0207691_100089922	112
8	3300005336	Ga0070680_101962899	Ga0070680_1019628991	113
9	3300005340	Ga0070689_100951015	Ga0070689_1009510152	113
10	3300005356	Ga0070674_101638010	Ga0070674_1016380101	113
11	3300005458	Ga0070681_10524972	Ga0070681_105249722	113
12	3300005563	Ga0068855_100088644	Ga0068855_1000886442	113
13	3300005614	Ga0068856_100464659	Ga0068856_1004646593	113
14	3300006177	Ga0075362_10648712	Ga0075362_106487122	113
15	3300006195	Ga0075366_10477507	Ga0075366_104775072	113
16	3300006852	Ga0075433_10499011	Ga0075433_104990112	113
17	3300009147	Ga0114129_10008098	Ga0114129_100080988	113
18	3300025912	Ga0207707_10159393	Ga0207707_101593931	113
19	3300025913	Ga0207695_10789543	Ga0207695_107895431	113
20	3300025917	Ga0207660_11688428	Ga0207660_116884281	113
21	3300025949	Ga0207667_10135582	Ga0207667_101355823	113
22	3300031852	Ga0307410_10296418	Ga0307410_102964182	113
23	3300031901	Ga0307406_10702431	Ga0307406_107024312	113
24	3300031903	Ga0307407_10715336	Ga0307407_107153361	113
25	3300032002	Ga0307416_100011134	Ga0307416_1000111342	113
26	3300032005	Ga0307411_10005992	Ga0307411_100059922	113
27	3300032126	Ga0307415_100437061	Ga0307415_1004370612	113
28	3300049522	Ga0501299_044356	Ga0501299_044356_383_724	113
29	3300049656	Ga0501209_213999	Ga0501209_213999_116_457	113
30	3300049704	Ga0501221_043108	Ga0501221_043108_218_559	113
31	3300049770	Ga0501273_019502	Ga0501273_019502_419_760	113
32	3300050493	nmdc:mga0k408_546533_c1	nmdc:mga0k408_546533_c1_32_373	113
33	3300050507	nmdc:mga05p37_184914_c1	nmdc:mga05p37_184914_c1_777_1118	113
34	3300050513	nmdc:mga0rr50_21868_c1	nmdc:mga0rr50_21868_c1_3824_4165	113
35	3300050515	nmdc:mga0a205_418336_c1	nmdc:mga0a205_418336_c1_553_894	113
36	3300059424	Ga0590075_009071	Ga0590075_009071_175_516	113
37	3300059426	Ga0590077_034493	Ga0590077_034493_138_479	113
38	3300000044	ARSoilOldRDRAFT_c011720	ARSoilOldRDRAFT_0117202	114
39	3300005293	Ga0065715_10123734	Ga0065715_101237342	114
40	3300005293	Ga0065715_10439526	Ga0065715_104395261	114
41	3300005328	Ga0070676_10539604	Ga0070676_105396041	114
42	3300005328	Ga0070676_11098069	Ga0070676_110980692	114
43	3300005328	Ga0070676_11554404	Ga0070676_115544041	114
44	3300005329	Ga0070683_100001291	Ga0070683_10000129115	114
45	3300005330	Ga0070690_100720624	Ga0070690_1007206242	114
46	3300005331	Ga0070670_100004508	Ga0070670_1000045087	114
47	3300005331	Ga0070670_100018958	Ga0070670_1000189583	114
48	3300005331	Ga0070670_100098644	Ga0070670_1000986441	114
49	3300005331	Ga0070670_100540411	Ga0070670_1005404112	114
50	3300005331	Ga0070670_100830181	Ga0070670_1008301811	114
51	3300005334	Ga0068869_100016854	Ga0068869_1000168542	114
52	3300005334	Ga0068869_101706520	Ga0068869_1017065201	114
53	3300005335	Ga0070666_10084544	Ga0070666_100845442	114
54	3300005335	Ga0070666_10867642	Ga0070666_108676421	114
55	3300005336	Ga0070680_101013679	Ga0070680_1010136791	114
56	3300005338	Ga0068868_100073387	Ga0068868_1000733872	114
57	3300005339	Ga0070660_100702604	Ga0070660_1007026042	114
58	3300005339	Ga0070660_101408864	Ga0070660_1014088642	114
59	3300005340	Ga0070689_100044393	Ga0070689_1000443932	114
60	3300005341	Ga0070691_10062122	Ga0070691_100621222	114
61	3300005343	Ga0070687_100021347	Ga0070687_1000213472	114
62	3300005344	Ga0070661_100005089	Ga0070661_1000050899	114
63	3300005344	Ga0070661_100432895	Ga0070661_1004328952	114
64	3300005344	Ga0070661_101729874	Ga0070661_1017298742	114
65	3300005345	Ga0070692_11074266	Ga0070692_110742661	114
66	3300005347	Ga0070668_100073673	Ga0070668_1000736732	114
67	3300005347	Ga0070668_100368409	Ga0070668_1003684092	114
68	3300005353	Ga0070669_100188437	Ga0070669_1001884372	114
69	3300005353	Ga0070669_101292512	Ga0070669_1012925121	114
70	3300005354	Ga0070675_100005678	Ga0070675_1000056789	114
71	3300005354	Ga0070675_100052850	Ga0070675_1000528505	114
72	3300005354	Ga0070675_100420308	Ga0070675_1004203082	114
73	3300005356	Ga0070674_100030256	Ga0070674_1000302562	114
74	3300005356	Ga0070674_100076792	Ga0070674_1000767922	114
75	3300005356	Ga0070674_100085304	Ga0070674_1000853042	114
76	3300005364	Ga0070673_100164498	Ga0070673_1001644982	114
77	3300005364	Ga0070673_100715944	Ga0070673_1007159442	114
78	3300005364	Ga0070673_100973057	Ga0070673_1009730572	114
79	3300005365	Ga0070688_100070288	Ga0070688_1000702883	114
80	3300005367	Ga0070667_100058651	Ga0070667_1000586512	114
81	3300005438	Ga0070701_10299069	Ga0070701_102990692	114
82	3300005439	Ga0070711_100536115	Ga0070711_1005361152	114
83	3300005441	Ga0070700_100543141	Ga0070700_1005431412	114
84	3300005444	Ga0070694_100104642	Ga0070694_1001046422	114
85	3300005444	Ga0070694_101291099	Ga0070694_1012910991	114
86	3300005444	Ga0070694_101405191	Ga0070694_1014051911	114
87	3300005455	Ga0070663_100057657	Ga0070663_1000576573	114
88	3300005456	Ga0070678_100008937	Ga0070678_1000089374	114
89	3300005457	Ga0070662_100169288	Ga0070662_1001692882	114
90	3300005457	Ga0070662_101149023	Ga0070662_1011490231	114
91	3300005457	Ga0070662_101635084	Ga0070662_1016350841	114
92	3300005458	Ga0070681_10427876	Ga0070681_104278762	114
93	3300005459	Ga0068867_100059178	Ga0068867_1000591782	114
94	3300005466	Ga0070685_10010990	Ga0070685_100109902	114
95	3300005466	Ga0070685_11367895	Ga0070685_113678952	114
96	3300005467	Ga0070706_100721389	Ga0070706_1007213892	114
97	3300005518	Ga0070699_100109892	Ga0070699_1001098921	114
98	3300005518	Ga0070699_100289800	Ga0070699_1002898002	114
99	3300005530	Ga0070679_100307290	Ga0070679_1003072902	114
100	3300005535	Ga0070684_100002598	Ga0070684_1000025985	114
101	3300005543	Ga0070672_100051872	Ga0070672_1000518722	114
102	3300005544	Ga0070686_100033017	Ga0070686_1000330172	114
103	3300005545	Ga0070695_100423756	Ga0070695_1004237562	114
104	3300005546	Ga0070696_100104703	Ga0070696_1001047032	114
105	3300005547	Ga0070693_100011551	Ga0070693_1000115511	114
106	3300005548	Ga0070665_100229772	Ga0070665_1002297722	114
107	3300005548	Ga0070665_101643631	Ga0070665_1016436312	114
108	3300005549	Ga0070704_100039551	Ga0070704_1000395511	114
109	3300005549	Ga0070704_101378500	Ga0070704_1013785001	114
110	3300005564	Ga0070664_100001167	Ga0070664_10000116711	114
111	3300005564	Ga0070664_100059400	Ga0070664_1000594002	114
112	3300005564	Ga0070664_100187018	Ga0070664_1001870182	114
113	3300005564	Ga0070664_101249068	Ga0070664_1012490681	114
114	3300005577	Ga0068857_100016084	Ga0068857_1000160842	114
115	3300005578	Ga0068854_100607810	Ga0068854_1006078103	114
116	3300005615	Ga0070702_100225309	Ga0070702_1002253093	114
117	3300005616	Ga0068852_101825751	Ga0068852_1018257512	114
118	3300005617	Ga0068859_100033779	Ga0068859_1000337795	114
119	3300005617	Ga0068859_100864088	Ga0068859_1008640882	114
120	3300005618	Ga0068864_100663138	Ga0068864_1006631382	114
121	3300005618	Ga0068864_100975343	Ga0068864_1009753432	114
122	3300005718	Ga0068866_10010213	Ga0068866_100102133	114
123	3300005719	Ga0068861_100073378	Ga0068861_1000733782	114
124	3300005841	Ga0068863_100026718	Ga0068863_1000267184	114
125	3300005842	Ga0068858_100027665	Ga0068858_1000276653	114
126	3300005843	Ga0068860_100023059	Ga0068860_1000230592	114
127	3300005844	Ga0068862_100201544	Ga0068862_1002015443	114
128	3300005844	Ga0068862_101030565	Ga0068862_1010305652	114
129	3300005937	Ga0081455_10686733	Ga0081455_106867331	114
130	3300006038	Ga0075365_10232608	Ga0075365_102326082	114
131	3300006042	Ga0075368_10022457	Ga0075368_100224572	114
132	3300006048	Ga0075363_100137472	Ga0075363_1001374722	114
133	3300006051	Ga0075364_10006716	Ga0075364_100067166	114
134	3300006051	Ga0075364_10014480	Ga0075364_100144805	114
135	3300006051	Ga0075364_10059271	Ga0075364_100592713	114
136	3300006177	Ga0075362_10043257	Ga0075362_100432572	114
137	3300006178	Ga0075367_10000811	Ga0075367_100008116	114
138	3300006195	Ga0075366_10000053	Ga0075366_1000005330	114
139	3300006237	Ga0097621_100616277	Ga0097621_1006162772	114
140	3300006353	Ga0075370_10010513	Ga0075370_100105135	114
141	3300006353	Ga0075370_10674752	Ga0075370_106747522	114
142	3300006844	Ga0075428_100003387	Ga0075428_10000338716	114
143	3300006844	Ga0075428_100010142	Ga0075428_1000101422	114
144	3300006844	Ga0075428_100012136	Ga0075428_1000121361	114
145	3300006844	Ga0075428_100133032	Ga0075428_1001330322	114
146	3300006844	Ga0075428_100474257	Ga0075428_1004742572	114
147	3300006846	Ga0075430_100034108	Ga0075430_1000341082	114
148	3300006846	Ga0075430_100076753	Ga0075430_1000767532	114
149	3300006846	Ga0075430_100360967	Ga0075430_1003609672	114
150	3300006847	Ga0075431_100019635	Ga0075431_1000196354	114
151	3300006847	Ga0075431_100022774	Ga0075431_1000227742	114
152	3300006847	Ga0075431_100114172	Ga0075431_1001141722	114
153	3300006847	Ga0075431_100177324	Ga0075431_1001773242	114
154	3300006847	Ga0075431_100318110	Ga0075431_1003181102	114
155	3300006847	Ga0075431_100470822	Ga0075431_1004708222	114
156	3300006847	Ga0075431_100710988	Ga0075431_1007109882	114
157	3300006847	Ga0075431_100974378	Ga0075431_1009743781	114
158	3300006852	Ga0075433_10030444	Ga0075433_100304442	114
159	3300006852	Ga0075433_10252063	Ga0075433_102520631	114
160	3300006852	Ga0075433_10856308	Ga0075433_108563082	114
161	3300006852	Ga0075433_10928748	Ga0075433_109287482	114
162	3300006871	Ga0075434_100018392	Ga0075434_1000183923	114
163	3300006871	Ga0075434_100079447	Ga0075434_1000794472	114
164	3300006880	Ga0075429_100020077	Ga0075429_1000200772	114
165	3300006880	Ga0075429_100068257	Ga0075429_1000682572	114
166	3300006880	Ga0075429_100069289	Ga0075429_1000692892	114
167	3300006880	Ga0075429_100231436	Ga0075429_1002314362	114
168	3300006880	Ga0075429_100308336	Ga0075429_1003083362	114
169	3300006881	Ga0068865_100391722	Ga0068865_1003917222	114
170	3300006914	Ga0075436_100957269	Ga0075436_1009572691	114
171	3300006931	Ga0097620_100033780	Ga0097620_1000337802	114
172	3300006931	Ga0097620_100864317	Ga0097620_1008643172	114
173	3300007076	Ga0075435_100080528	Ga0075435_1000805281	114
174	3300007076	Ga0075435_100537543	Ga0075435_1005375432	114
175	3300007076	Ga0075435_100574980	Ga0075435_1005749802	114
176	3300007076	Ga0075435_100800588	Ga0075435_1008005882	114
177	3300009093	Ga0105240_11112700	Ga0105240_111127002	114
178	3300009094	Ga0111539_10000060	Ga0111539_1000006054	114
179	3300009094	Ga0111539_10021362	Ga0111539_100213628	114
180	3300009094	Ga0111539_10138659	Ga0111539_101386592	114
181	3300009094	Ga0111539_10475842	Ga0111539_104758421	114
182	3300009094	Ga0111539_11066858	Ga0111539_110668581	114
183	3300009094	Ga0111539_11229709	Ga0111539_112297092	114
184	3300009094	Ga0111539_12362222	Ga0111539_123622222	114
185	3300009094	Ga0111539_12484801	Ga0111539_124848011	114
186	3300009098	Ga0105245_10065831	Ga0105245_100658313	114
187	3300009147	Ga0114129_10013047	Ga0114129_100130477	114
188	3300009147	Ga0114129_10065625	Ga0114129_100656254	114
189	3300009147	Ga0114129_10066040	Ga0114129_100660402	114
190	3300009147	Ga0114129_10218679	Ga0114129_102186792	114
191	3300009147	Ga0114129_10243504	Ga0114129_102435042	114
192	3300009148	Ga0105243_10003419	Ga0105243_100034198	114
193	3300009148	Ga0105243_10985202	Ga0105243_109852022	114
194	3300009148	Ga0105243_11469078	Ga0105243_114690782	114
195	3300009148	Ga0105243_11555908	Ga0105243_115559082	114
196	3300009176	Ga0105242_10047262	Ga0105242_100472622	114
197	3300009177	Ga0105248_10017600	Ga0105248_100176003	114
198	3300009177	Ga0105248_10049359	Ga0105248_100493592	114
199	3300009177	Ga0105248_11681872	Ga0105248_116818722	114
200	3300009177	Ga0105248_13093092	Ga0105248_130930921	114
201	3300009553	Ga0105249_10091608	Ga0105249_100916082	114
202	3300009553	Ga0105249_12334683	Ga0105249_123346832	114
203	3300010375	Ga0105239_11981064	Ga0105239_119810642	114
204	3300011119	Ga0105246_10587016	Ga0105246_105870162	114
205	3300013296	Ga0157374_10082924	Ga0157374_100829242	114
206	3300013306	Ga0163162_12533455	Ga0163162_125334552	114
207	3300013307	Ga0157372_10318607	Ga0157372_103186073	114
208	3300013308	Ga0157375_10060534	Ga0157375_100605342	114
209	3300014325	Ga0163163_10099607	Ga0163163_100996072	114
210	3300014325	Ga0163163_10725279	Ga0163163_107252792	114
211	3300014326	Ga0157380_11935362	Ga0157380_119353622	114
212	3300014326	Ga0157380_12159643	Ga0157380_121596431	114
213	3300014745	Ga0157377_11488952	Ga0157377_114889521	114
214	3300014968	Ga0157379_10346959	Ga0157379_103469592	114
215	3300021384	Ga0213876_10637158	Ga0213876_106371581	114
216	3300025315	Ga0207697_10195658	Ga0207697_101956582	114
217	3300025903	Ga0207680_10701032	Ga0207680_107010321	114
218	3300025912	Ga0207707_11275326	Ga0207707_112753262	114
219	3300025918	Ga0207662_10007229	Ga0207662_100072294	114
220	3300025919	Ga0207657_10474888	Ga0207657_104748882	114
221	3300025920	Ga0207649_10041261	Ga0207649_100412612	114
222	3300025920	Ga0207649_10506368	Ga0207649_105063682	114
223	3300025921	Ga0207652_11701047	Ga0207652_117010471	114
224	3300025925	Ga0207650_10076534	Ga0207650_100765341	114
225	3300025925	Ga0207650_10243037	Ga0207650_102430371	114
226	3300025925	Ga0207650_10575868	Ga0207650_105758682	114
227	3300025925	Ga0207650_11803740	Ga0207650_118037401	114
228	3300025926	Ga0207659_10174911	Ga0207659_101749112	114
229	3300025926	Ga0207659_10400073	Ga0207659_104000731	114
230	3300025926	Ga0207659_10417887	Ga0207659_104178872	114
231	3300025927	Ga0207687_10437683	Ga0207687_104376832	114
232	3300025931	Ga0207644_10947852	Ga0207644_109478522	114
233	3300025932	Ga0207690_10154186	Ga0207690_101541862	114
234	3300025933	Ga0207706_10034969	Ga0207706_100349692	114
235	3300025933	Ga0207706_10421902	Ga0207706_104219022	114
236	3300025933	Ga0207706_11421751	Ga0207706_114217512	114
237	3300025934	Ga0207686_10049051	Ga0207686_100490512	114
238	3300025935	Ga0207709_10039594	Ga0207709_100395942	114
239	3300025936	Ga0207670_10919449	Ga0207670_109194491	114
240	3300025937	Ga0207669_10124112	Ga0207669_101241122	114
241	3300025938	Ga0207704_10203753	Ga0207704_102037532	114
242	3300025940	Ga0207691_10810894	Ga0207691_108108942	114
243	3300025941	Ga0207711_10065065	Ga0207711_100650653	114
244	3300025941	Ga0207711_11379189	Ga0207711_113791892	114
245	3300025941	Ga0207711_11571365	Ga0207711_115713651	114
246	3300025942	Ga0207689_10026509	Ga0207689_100265093	114
247	3300025942	Ga0207689_11375590	Ga0207689_113755901	114
248	3300025944	Ga0207661_10007488	Ga0207661_100074881	114
249	3300025944	Ga0207661_10009120	Ga0207661_100091202	114
250	3300025945	Ga0207679_10050875	Ga0207679_100508753	114
251	3300025945	Ga0207679_10150813	Ga0207679_101508132	114
252	3300025945	Ga0207679_11058499	Ga0207679_110584992	114
253	3300025945	Ga0207679_11871015	Ga0207679_118710151	114
254	3300025960	Ga0207651_10749900	Ga0207651_107499001	114
255	3300025960	Ga0207651_12118133	Ga0207651_121181331	114
256	3300025961	Ga0207712_10266449	Ga0207712_102664492	114
257	3300025972	Ga0207668_10179894	Ga0207668_101798942	114
258	3300025972	Ga0207668_10594831	Ga0207668_105948312	114
259	3300025986	Ga0207658_10435676	Ga0207658_104356762	114
260	3300026023	Ga0207677_10029945	Ga0207677_100299452	114
261	3300026035	Ga0207703_11623136	Ga0207703_116231362	114
262	3300026067	Ga0207678_10006607	Ga0207678_100066073	114
263	3300026067	Ga0207678_10040652	Ga0207678_100406521	114
264	3300026075	Ga0207708_10094952	Ga0207708_100949522	114
265	3300026075	Ga0207708_10765234	Ga0207708_107652342	114
266	3300026089	Ga0207648_10003039	Ga0207648_100030399	114
267	3300026095	Ga0207676_10154202	Ga0207676_101542022	114
268	3300026095	Ga0207676_11198616	Ga0207676_111986161	114
269	3300026095	Ga0207676_12514683	Ga0207676_125146832	114
270	3300026116	Ga0207674_10008498	Ga0207674_100084986	114
271	3300026118	Ga0207675_100005022	Ga0207675_1000050228	114
272	3300026118	Ga0207675_102222398	Ga0207675_1022223982	114
273	3300026121	Ga0207683_10070272	Ga0207683_100702724	114
274	3300027665	Ga0209983_1021775	Ga0209983_10217751	114
275	3300027866	Ga0209813_10056380	Ga0209813_100563802	114
276	3300027866	Ga0209813_10160490	Ga0209813_101604902	114
277	3300027907	Ga0207428_10000065	Ga0207428_1000006552	114
278	3300027907	Ga0207428_10212250	Ga0207428_102122502	114
279	3300027907	Ga0207428_10304778	Ga0207428_103047782	114
280	3300028379	Ga0268266_11301547	Ga0268266_113015472	114
281	3300028379	Ga0268266_11320340	Ga0268266_113203401	114
282	3300028380	Ga0268265_10238669	Ga0268265_102386692	114
283	3300028380	Ga0268265_10370931	Ga0268265_103709312	114
284	3300028381	Ga0268264_10124317	Ga0268264_101243172	114
285	3300031548	Ga0307408_100752908	Ga0307408_1007529082	114
286	3300031731	Ga0307405_10024322	Ga0307405_100243221	114
287	3300031824	Ga0307413_10096772	Ga0307413_100967722	114
288	3300031824	Ga0307413_10321086	Ga0307413_103210862	114
289	3300031852	Ga0307410_10028225	Ga0307410_100282253	114
290	3300031852	Ga0307410_10659153	Ga0307410_106591532	114
291	3300031852	Ga0307410_11561241	Ga0307410_115612412	114
292	3300031903	Ga0307407_10023468	Ga0307407_100234682	114
293	3300031903	Ga0307407_10087515	Ga0307407_100875152	114
294	3300031903	Ga0307407_10835354	Ga0307407_108353542	114
295	3300031911	Ga0307412_11152922	Ga0307412_111529222	114
296	3300031995	Ga0307409_100047681	Ga0307409_1000476812	114
297	3300031995	Ga0307409_100438072	Ga0307409_1004380722	114
298	3300031995	Ga0307409_100446606	Ga0307409_1004466062	114
299	3300031995	Ga0307409_100768246	Ga0307409_1007682462	114
300	3300032002	Ga0307416_100225356	Ga0307416_1002253562	114
301	3300032002	Ga0307416_100671932	Ga0307416_1006719322	114
302	3300032002	Ga0307416_100826005	Ga0307416_1008260052	114
303	3300032002	Ga0307416_103432219	Ga0307416_1034322191	114
304	3300032004	Ga0307414_10817125	Ga0307414_108171252	114
305	3300032005	Ga0307411_10070299	Ga0307411_100702992	114
306	3300032005	Ga0307411_10511952	Ga0307411_105119522	114
307	3300032005	Ga0307411_10781673	Ga0307411_107816732	114
308	3300032005	Ga0307411_11018370	Ga0307411_110183702	114
309	3300032005	Ga0307411_11426754	Ga0307411_114267541	114
310	3300032005	Ga0307411_11772617	Ga0307411_117726171	114
311	3300032126	Ga0307415_100310695	Ga0307415_1003106952	114
312	3300035083	Ga0373926_0114433	Ga0373926_0114433_598_942	114
313	3300035112	Ga0373932_0290690	Ga0373932_0290690_83_427	114
314	3300035113	Ga0373936_0274526	Ga0373936_0274526_262_606	114
315	3300035116	Ga0373945_0507514	Ga0373945_0507514_178_522	114
316	3300035171	Ga0373946_0432543	Ga0373946_0432543_151_495	114
317	3300035725	Ga0373947_0079114	Ga0373947_0079114_1602_1946	114
318	3300037068	Ga0373925_0588530	Ga0373925_0588530_347_691	114
319	3300039437	Ga0436365_0566076	Ga0436365_0566076_149_493	114
320	3300041406	Ga0439439_0149555	Ga0439439_0149555_281_625	114
321	3300041492	Ga0451835_0651754	Ga0451835_0651754_228_572	114
322	3300041512	Ga0451853_0387463	Ga0451853_0387463_91_441	114
323	3300041512	Ga0451853_3811894	Ga0451853_3811894_117_461	114
324	3300042015	Ga0439462_0035385	Ga0439462_0035385_525_869	114
325	3300042015	Ga0439462_0064633	Ga0439462_0064633_209_553	114
326	3300042125	Ga0450923_010362	Ga0450923_010362_1126_1470	114
327	3300042139	Ga0450904_030992	Ga0450904_030992_55_399	114
328	3300042435	Ga0439434_0217673	Ga0439434_0217673_12_356	114
329	3300042436	Ga0439435_0003253	Ga0439435_0003253_167_511	114
330	3300042436	Ga0439435_0012690	Ga0439435_0012690_1539_1886	114
331	3300042436	Ga0439435_0030219	Ga0439435_0030219_1048_1395	114
332	3300042437	Ga0439444_0160131	Ga0439444_0160131_126_473	114
333	3300042876	Ga0451577_1510276	Ga0451577_1510276_118_474	114
334	3300045976	Ga0466967_0690985	Ga0466967_0690985_619_975	114
335	3300046463	Ga0495653_0009110	Ga0495653_0009110_6240_6620	114
336	3300046519	Ga0495632_0349303	Ga0495632_0349303_231_575	114
337	3300046539	Ga0495621_0502663	Ga0495621_0502663_72_416	114
338	3300046615	Ga0495656_0325810	Ga0495656_0325810_162_506	114
339	3300046683	Ga0495658_0413860	Ga0495658_0413860_380_724	114
340	3300046684	Ga0495669_0125557	Ga0495669_0125557_760_1104	114
341	3300048903	Ga0496100_1022955	Ga0496100_1022955_259_603	114
342	3300048904	Ga0496101_0454320	Ga0496101_0454320_598_942	114
343	3300048906	Ga0496103_0574087	Ga0496103_0574087_150_494	114
344	3300048907	Ga0496104_0232715	Ga0496104_0232715_521_865	114
345	3300048910	Ga0496107_0759599	Ga0496107_0759599_107_451	114
346	3300048911	Ga0496108_0005393	Ga0496108_0005393_7774_8118	114
347	3300048912	Ga0496109_0000593	Ga0496109_0000593_26165_26509	114
348	3300048912	Ga0496109_1822009	Ga0496109_1822009_52_396	114
349	3300048913	Ga0496110_0103288	Ga0496110_0103288_120_464	114
350	3300048914	Ga0496111_0007585	Ga0496111_0007585_285_629	114
351	3300048915	Ga0496112_0011781	Ga0496112_0011781_2443_2787	114
352	3300048916	Ga0496113_0490926	Ga0496113_0490926_47_391	114
353	3300048916	Ga0496113_0800426	Ga0496113_0800426_395_739	114
354	3300049515	Ga0501292_101544	Ga0501292_101544_94_438	114
355	3300049516	Ga0501293_027048	Ga0501293_027048_137_571	114
356	3300049571	Ga0501034_0026059	Ga0501034_0026059_5213_5557	114
357	3300049572	Ga0501036_0254453	Ga0501036_0254453_140_484	114
358	3300049575	Ga0501039_0095624	Ga0501039_0095624_1096_1440	114
359	3300049575	Ga0501039_0695269	Ga0501039_0695269_391_738	114
360	3300049576	Ga0501040_0164564	Ga0501040_0164564_908_1252	114
361	3300049580	Ga0501046_0315421	Ga0501046_0315421_754_1098	114
362	3300049582	Ga0501048_0105225	Ga0501048_0105225_409_753	114
363	3300049587	Ga0501071_1561679	Ga0501071_1561679_87_431	114
364	3300049588	Ga0501072_0167809	Ga0501072_0167809_1218_1562	114
365	3300049590	Ga0501074_1133350	Ga0501074_1133350_168_512	114
366	3300049591	Ga0501075_0076052	Ga0501075_0076052_70_417	114
367	3300049591	Ga0501075_0319824	Ga0501075_0319824_52_396	114
368	3300049592	Ga0501076_0176372	Ga0501076_0176372_419_763	114
369	3300049660	Ga0501216_141223	Ga0501216_141223_130_474	114
370	3300049741	Ga0501079_0364903	Ga0501079_0364903_30_377	114
371	3300049742	Ga0501080_0314345	Ga0501080_0314345_811_1155	114
372	3300049742	Ga0501080_0684250	Ga0501080_0684250_160_504	114
373	3300049743	Ga0501081_0145470	Ga0501081_0145470_895_1239	114
374	3300049744	Ga0501083_0551292	Ga0501083_0551292_354_698	114
375	3300049822	Ga0501035_0330249	Ga0501035_0330249_405_749	114
376	3300049824	Ga0501045_0141749	Ga0501045_0141749_908_1252	114
377	3300050489	nmdc:mga03683_101998_c1	nmdc:mga03683_101998_c1_15_359	114
378	3300050489	nmdc:mga03683_15921_c1	nmdc:mga03683_15921_c1_2235_2579	114
379	3300050490	nmdc:mga03n38_124379_c1	nmdc:mga03n38_124379_c1_590_934	114
380	3300050491	nmdc:mga00v17_1048689_c1	nmdc:mga00v17_1048689_c1_140_484	114
381	3300050491	nmdc:mga00v17_180356_c1	nmdc:mga00v17_180356_c1_623_967	114
382	3300050491	nmdc:mga00v17_223648_c1	nmdc:mga00v17_223648_c1_23_367	114
383	3300050491	nmdc:mga00v17_3512_c1	nmdc:mga00v17_3512_c1_5725_6069	114
384	3300050491	nmdc:mga00v17_435612_c1	nmdc:mga00v17_435612_c1_473_817	114
385	3300050492	nmdc:mga0yw44_353360_c1	nmdc:mga0yw44_353360_c1_439_783	114
386	3300050492	nmdc:mga0yw44_685590_c1	nmdc:mga0yw44_685590_c1_105_449	114
387	3300050492	nmdc:mga0yw44_78076_c1	nmdc:mga0yw44_78076_c1_358_702	114
388	3300050493	nmdc:mga0k408_1852_c1	nmdc:mga0k408_1852_c1_5523_5867	114
389	3300050494	nmdc:mga06z11_2186_c1	nmdc:mga06z11_2186_c1_5096_5440	114
390	3300050495	nmdc:mga04h51_1219_c1	nmdc:mga04h51_1219_c1_507_851	114
391	3300050495	nmdc:mga04h51_185353_c1	nmdc:mga04h51_185353_c1_248_592	114
392	3300050496	nmdc:mga07m45_151314_c1	nmdc:mga07m45_151314_c1_358_702	114
393	3300050496	nmdc:mga07m45_89422_c1	nmdc:mga07m45_89422_c1_690_1034	114
394	3300050507	nmdc:mga05p37_170029_c1	nmdc:mga05p37_170029_c1_1532_1876	114
395	3300050507	nmdc:mga05p37_19664_c1	nmdc:mga05p37_19664_c1_5758_6102	114
396	3300050507	nmdc:mga05p37_282761_c1	nmdc:mga05p37_282761_c1_577_924	114
397	3300050507	nmdc:mga05p37_29618_c1	nmdc:mga05p37_29618_c1_6273_6617	114
398	3300050507	nmdc:mga05p37_681315_c1	nmdc:mga05p37_681315_c1_444_788	114
399	3300050508	nmdc:mga09592_107815_c1	nmdc:mga09592_107815_c1_1154_1498	114
400	3300050508	nmdc:mga09592_137686_c1	nmdc:mga09592_137686_c1_509_856	114
401	3300050508	nmdc:mga09592_157109_c1	nmdc:mga09592_157109_c1_227_571	114
402	3300050508	nmdc:mga09592_35917_c1	nmdc:mga09592_35917_c1_1135_1482	114
403	3300050508	nmdc:mga09592_64366_c1	nmdc:mga09592_64366_c1_2416_2760	114
404	3300050509	nmdc:mga0qj67_112580_c1	nmdc:mga0qj67_112580_c1_866_1213	114
405	3300050509	nmdc:mga0qj67_219704_c1	nmdc:mga0qj67_219704_c1_752_1096	114
406	3300050509	nmdc:mga0qj67_772780_c1	nmdc:mga0qj67_772780_c1_329_673	114
407	3300050510	nmdc:mga06r32_1185228_c1	nmdc:mga06r32_1185228_c1_327_671	114
408	3300050510	nmdc:mga06r32_271520_c1	nmdc:mga06r32_271520_c1_800_1144	114
409	3300050510	nmdc:mga06r32_477983_c1	nmdc:mga06r32_477983_c1_210_554	114
410	3300050510	nmdc:mga06r32_5855_c1	nmdc:mga06r32_5855_c1_644_991	114
411	3300050510	nmdc:mga06r32_616947_c1	nmdc:mga06r32_616947_c1_69_413	114
412	3300050510	nmdc:mga06r32_67632_c1	nmdc:mga06r32_67632_c1_3060_3404	114
413	3300050510	nmdc:mga06r32_723274_c1	nmdc:mga06r32_723274_c1_252_620	114
414	3300050510	nmdc:mga06r32_923277_c1	nmdc:mga06r32_923277_c1_188_532	114
415	3300050511	nmdc:mga08y16_181_c1	nmdc:mga08y16_181_c1_12444_12788	114
416	3300050511	nmdc:mga08y16_28256_c1	nmdc:mga08y16_28256_c1_5358_5702	114
417	3300050511	nmdc:mga08y16_45607_c1	nmdc:mga08y16_45607_c1_1769_2116	114
418	3300050511	nmdc:mga08y16_911874_c1	nmdc:mga08y16_911874_c1_102_449	114
419	3300050512	nmdc:mga0n895_1124938_c1	nmdc:mga0n895_1124938_c1_373_717	114
420	3300050512	nmdc:mga0n895_464581_c1	nmdc:mga0n895_464581_c1_38_382	114
421	3300050512	nmdc:mga0n895_55653_c1	nmdc:mga0n895_55653_c1_2154_2498	114
422	3300050512	nmdc:mga0n895_940023_c1	nmdc:mga0n895_940023_c1_292_636	114
423	3300050513	nmdc:mga0rr50_1645256_c1	nmdc:mga0rr50_1645256_c1_65_409	114
424	3300050513	nmdc:mga0rr50_68062_c1	nmdc:mga0rr50_68062_c1_54_398	114
425	3300050515	nmdc:mga0a205_1062335_c1	nmdc:mga0a205_1062335_c1_226_573	114
426	3300050515	nmdc:mga0a205_30216_c1	nmdc:mga0a205_30216_c1_3653_3997	114
427	3300050515	nmdc:mga0a205_372566_c1	nmdc:mga0a205_372566_c1_31_378	114
428	3300050515	nmdc:mga0a205_818897_c1	nmdc:mga0a205_818897_c1_213_557	114
429	3300050516	nmdc:mga0sz30_42837_c1	nmdc:mga0sz30_42837_c1_374_718	114
430	3300053083	Ga0495655_0364104	Ga0495655_0364104_25_369	114
431	3300054114	Ga0501084_0516503	Ga0501084_0516503_182_526	114
432	3300060353	Ga0501082_0255122	Ga0501082_0255122_601_945	114
433	3300060353	Ga0501082_0888302	Ga0501082_0888302_244_588	114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

19

93

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1xma-assembly1.cif.gz_A	structure of a transcriptional regulator from clostridium thermocellum cth-833	0.9305	9	107
1xma-assembly1.cif.gz_B-2	structure of a transcriptional regulator from clostridium thermocellum cth-833	0.9111	1	107
5h20-assembly1.cif.gz_A-2	x-ray structure of padr-like transcription factor from bacteroid fragilis	0.9104	8	108
7wjp-assembly1.cif.gz_A-2	structure of padr-like protein from listeria monocytogenes	0.9021	5	109
2p4w-assembly1.cif.gz_A	crystal structure of heat shock regulator from pyrococcus furiosus	0.8965	14	84

ID	Description	Score	Start	End	Superfamily
af_P64588_52_154_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9434	16	97	1.10.10.10
1xmaA00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9305	9	107	1.10.10.10
af_O50432_1_88_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9106	16	92	1.10.10.10
5h20A00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9104	8	108	1.10.10.10
af_P71704_1_89_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.906	16	92	1.10.10.10

ID	Description	Score	Start	End
AF-A0A534KDG9-F1-model_v4	PadR family transcriptional regulator	0.986	12	108
AF-A0A7V9SMK9-F1-model_v4	PadR family transcriptional regulator	0.9778	15	93
AF-R6PLB6-F1-model_v4	Transcriptional regulator PadR-like family protein	0.9651	18	110
AF-A0A7C5QRK1-F1-model_v4	PadR family transcriptional regulator	0.9628	16	92
AF-A0A847HVX9-F1-model_v4	PadR family transcriptional regulator	0.9624	14	96

Feature Viewer

pLDDT	pTM	Quality
87.31	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442880

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03551

PadR

Transcriptional regulator PadR-like family

19

93

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map