metagRoot

F442882

General Info

Members	Datasets	Scaffolds	Average Seq Length
433	229	432	251

Family's Representative Sequence

Representative Sequence	3300031852\|Ga0307410_10078151\|Ga0307410_100781512
Length	284
Sequence	MNCHSPEAAVGSPSEFFDPEYRLARPGSTLRLIMRKPVIAGNWKMYKLLSEAVNTALALKPLVANANHCEVIIAPVFTELKTVADRLEGSNIKIAAQDCAAESAHGAHTGEVAADMLKDVGCRYVVVGHSERRQLYGETDQSVNRKVNSALAAGLTPIVCVGEMLEQREAGVVESVVKTQLSGGLAGLTRADVERIIIAYEPVWAIGTGKTATPQQAQEMHGVIRRAAAESHGEEVANSLRILYGGSVKPDNIATLMDQPDVDGALVGGASLEAETFAKIVNYK

Samples

	Sample ID	Description	Type	Environment
1	2786546517	Verrucomicrobia bacterium LW23	Isolate	Rhizoplane
2	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
3	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
4	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
5	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
6	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
14	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
15	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
16	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
17	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
21	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
22	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
23	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
24	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
25	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
26	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
27	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
28	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
29	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
30	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
33	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
34	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
35	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
36	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
40	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
41	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
42	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
43	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
46	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
47	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
48	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
51	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
52	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
53	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
54	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
55	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
56	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
57	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
59	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
60	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
61	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
62	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
65	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
66	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
68	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
71	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
72	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
74	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
75	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
76	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
77	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
78	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
79	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
80	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
83	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
84	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
85	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
86	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
87	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
88	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
89	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
90	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
91	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
139	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
140	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
141	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
142	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
143	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
144	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
145	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
146	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
147	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
148	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
149	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
150	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
151	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
152	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
153	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
154	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
155	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
156	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
157	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
158	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
159	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
160	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
161	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
162	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
163	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
164	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
165	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
166	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
167	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
168	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
169	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
170	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
171	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
172	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
173	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
174	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
175	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
176	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
177	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
178	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
179	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
180	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
181	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
182	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
183	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
184	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
185	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
186	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
187	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
188	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
189	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
190	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
191	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
192	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
193	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
194	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
195	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
196	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
197	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
200	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
201	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
202	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
203	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
204	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
205	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
206	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
207	3300049674	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought	Metagenome	Rhizosphere
208	3300049677	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control	Metagenome	Rhizosphere
209	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
210	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
212	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
213	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
214	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
216	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
217	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
218	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
219	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
220	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
221	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
222	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
223	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
224	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
225	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
226	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
227	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
228	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
229	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.15
Metatranscriptomes	1.62
Isolates	0.23

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.15
Nodule	0
Rhizoplane	1.62
Rhizosphere	95.61
Stem	0
Stem Tuber	0
Unclassified	1.62

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10027960	3300001979	Bacteria	1868
2	rootL2_10003120	3300003322	Bacteria	2419
3	JGI25160J50197_1002547	3300003354	Bacteria	8432
4	Ga0065704_10139825	3300005289	Unclassified	1529
5	Ga0065715_10047481	3300005293	Bacteria	1022
6	Ga0065715_10136972	3300005293	Bacteria	1914
7	Ga0070690_100015764	3300005330	Bacteria	4516
8	Ga0070670_100029895	3300005331	Bacteria	4692
9	Ga0070670_100039092	3300005331	Bacteria	4080
10	Ga0070670_100122402	3300005331	Bacteria	2244
11	Ga0068869_100004307	3300005334	Bacteria	8837
12	Ga0070666_10006503	3300005335	Bacteria	7180
13	Ga0068868_100090078	3300005338	Bacteria	2470
14	Ga0068868_100092979	3300005338	Bacteria	2431
15	Ga0070689_100000001	3300005340	Bacteria	1334580
16	Ga0070689_100030588	3300005340	Bacteria	4088
17	Ga0070689_100055157	3300005340	Bacteria	3078
18	Ga0070689_100656391	3300005340	Bacteria	913
19	Ga0070687_100095956	3300005343	Bacteria	1650
20	Ga0070661_100045839	3300005344	Bacteria	3197
21	Ga0070661_100158937	3300005344	Bacteria	1711
22	Ga0070692_10018035	3300005345	Bacteria	3387
23	Ga0070692_10216521	3300005345	Bacteria	1130
24	Ga0070668_100016045	3300005347	Bacteria	5603
25	Ga0070669_100035407	3300005353	Bacteria	3616
26	Ga0070675_100002846	3300005354	Bacteria	13045
27	Ga0070675_100010709	3300005354	Bacteria	7172
28	Ga0070675_100124350	3300005354	Bacteria	2194
29	Ga0070675_100632048	3300005354	Bacteria	972
30	Ga0070671_100027293	3300005355	Bacteria	4698
31	Ga0070673_100004190	3300005364	Bacteria	9093
32	Ga0070688_100340649	3300005365	Bacteria	1095
33	Ga0070659_100045175	3300005366	Bacteria	3450
34	Ga0070659_100144071	3300005366	Bacteria	1941
35	Ga0070659_100215779	3300005366	Bacteria	1582
36	Ga0070667_100030244	3300005367	Bacteria	4516
37	Ga0070701_10043568	3300005438	Bacteria	2297
38	Ga0070705_100447639	3300005440	Bacteria	968
39	Ga0070700_100012079	3300005441	Bacteria	4803
40	Ga0070700_100471932	3300005441	Bacteria	959
41	Ga0070694_100005509	3300005444	Bacteria	7667
42	Ga0070694_100088692	3300005444	Bacteria	2166
43	Ga0070678_100087990	3300005456	Bacteria	2374
44	Ga0070678_100210799	3300005456	Bacteria	1609
45	Ga0070662_100007050	3300005457	Bacteria	7270
46	Ga0070662_100121877	3300005457	Bacteria	2000
47	Ga0070662_100378343	3300005457	Bacteria	1165
48	Ga0070681_10026910	3300005458	Bacteria	5782
49	Ga0068867_100115719	3300005459	Unclassified	2065
50	Ga0068867_100499768	3300005459	Bacteria	1045
51	Ga0070685_10065763	3300005466	Bacteria	2135
52	Ga0070706_100105642	3300005467	Bacteria	2620
53	Ga0070707_100290709	3300005468	Bacteria	1588
54	Ga0070679_100051012	3300005530	Bacteria	4121
55	Ga0070679_100064550	3300005530	Bacteria	3649
56	Ga0070684_100335835	3300005535	Bacteria	1389
57	Ga0068853_100016651	3300005539	Bacteria	6053
58	Ga0068853_100046617	3300005539	Bacteria	3717
59	Ga0070672_100032691	3300005543	Bacteria	3930
60	Ga0070686_100111068	3300005544	Bacteria	1868
61	Ga0070695_100007216	3300005545	Bacteria	6588
62	Ga0070665_100012879	3300005548	Bacteria	8422
63	Ga0070704_100215328	3300005549	Bacteria	1559
64	Ga0070704_100470268	3300005549	Bacteria	1086
65	Ga0068855_100002075	3300005563	Bacteria	24814
66	Ga0070664_100003190	3300005564	Bacteria	13251
67	Ga0070664_100007343	3300005564	Bacteria	8883
68	Ga0070664_100058365	3300005564	Bacteria	3282
69	Ga0068857_100045680	3300005577	Bacteria	3886
70	Ga0068857_100050711	3300005577	Bacteria	3680
71	Ga0068857_100224207	3300005577	Bacteria	1718
72	Ga0068857_100330061	3300005577	Bacteria	1410
73	Ga0068856_100004637	3300005614	Bacteria	13653
74	Ga0070702_100179785	3300005615	Bacteria	1383
75	Ga0068852_100123837	3300005616	Bacteria	2371
76	Ga0068859_100020509	3300005617	Bacteria	6633
77	Ga0068859_100315502	3300005617	Bacteria	1657
78	Ga0068859_100465151	3300005617	Unclassified	1360
79	Ga0068864_100108196	3300005618	Bacteria	2474
80	Ga0068864_100333496	3300005618	Bacteria	1428
81	Ga0068864_100531216	3300005618	Bacteria	1135
82	Ga0068861_100115354	3300005719	Bacteria	2158
83	Ga0068861_100225674	3300005719	Bacteria	1586
84	Ga0068861_100424987	3300005719	Bacteria	1185
85	Ga0068861_100508718	3300005719	Bacteria	1090
86	Ga0068870_10054158	3300005840	Bacteria	2133
87	Ga0068870_10373499	3300005840	Bacteria	921
88	Ga0068863_100003431	3300005841	Bacteria	15619
89	Ga0068863_100045705	3300005841	Bacteria	4156
90	Ga0068863_100302453	3300005841	Bacteria	1552
91	Ga0068858_100118667	3300005842	Bacteria	2473
92	Ga0068860_100027747	3300005843	Bacteria	5452
93	Ga0068860_100205056	3300005843	Bacteria	1912
94	Ga0068862_100002210	3300005844	Bacteria	17455
95	Ga0068862_100004938	3300005844	Bacteria	11228
96	Ga0068862_100133566	3300005844	Bacteria	2197
97	Ga0068862_100154137	3300005844	Bacteria	2047
98	Ga0068862_100316269	3300005844	Bacteria	1440
99	Ga0097621_100088403	3300006237	Bacteria	2589
100	Ga0097621_100597837	3300006237	Bacteria	1008
101	Ga0068871_100067829	3300006358	Bacteria	2928
102	Ga0075428_100010699	3300006844	Bacteria	10196
103	Ga0075428_100023421	3300006844	Bacteria	6833
104	Ga0075428_100038985	3300006844	Bacteria	5229
105	Ga0075428_100043503	3300006844	Bacteria	4937
106	Ga0075428_100329450	3300006844	Bacteria	1640
107	Ga0075430_100017628	3300006846	Bacteria	6081
108	Ga0075430_100039395	3300006846	Bacteria	4001
109	Ga0075430_100054827	3300006846	Bacteria	3353
110	Ga0075430_100174620	3300006846	Bacteria	1788
111	Ga0075431_100000895	3300006847	Bacteria	26293
112	Ga0075431_100051524	3300006847	Bacteria	4244
113	Ga0075433_10123331	3300006852	Bacteria	2302
114	Ga0075433_10275482	3300006852	Bacteria	1491
115	Ga0075434_100282059	3300006871	Bacteria	1681
116	Ga0075429_100004626	3300006880	Bacteria	11835
117	Ga0075429_100023227	3300006880	Bacteria	5379
118	Ga0075429_100225900	3300006880	Bacteria	1640
119	Ga0068865_100179135	3300006881	Bacteria	1631
120	Ga0097620_100020509	3300006931	Bacteria	6633
121	Ga0097620_100315503	3300006931	Bacteria	1657
122	Ga0097620_100465162	3300006931	Unclassified	1360
123	Ga0105250_10057219	3300009092	Bacteria	1565
124	Ga0105240_10000164	3300009093	Bacteria	135111
125	Ga0105240_10160466	3300009093	Bacteria	2671
126	Ga0111539_10004080	3300009094	Bacteria	19165
127	Ga0111539_10174225	3300009094	Bacteria	2513
128	Ga0111539_10285595	3300009094	Bacteria	1920
129	Ga0111539_10298956	3300009094	Bacteria	1873
130	Ga0111539_10312309	3300009094	Bacteria	1830
131	Ga0111539_10333080	3300009094	Bacteria	1767
132	Ga0111539_10532608	3300009094	Bacteria	1368
133	Ga0111539_10641790	3300009094	Bacteria	1236
134	Ga0105245_10010431	3300009098	Bacteria	8090
135	Ga0105247_10030630	3300009101	Bacteria	3261
136	Ga0114129_10019435	3300009147	Bacteria	9672
137	Ga0114129_10066609	3300009147	Bacteria	5023
138	Ga0114129_10195820	3300009147	Bacteria	2741
139	Ga0114129_10553703	3300009147	Bacteria	1495
140	Ga0114129_10571227	3300009147	Bacteria	1468
141	Ga0105248_10023386	3300009177	Bacteria	6865
142	Ga0105248_11028333	3300009177	Bacteria	931
143	Ga0105238_10150114	3300009551	Bacteria	2306
144	Ga0105249_10083339	3300009553	Bacteria	2976
145	Ga0105249_10089616	3300009553	Bacteria	2875
146	Ga0105249_10138746	3300009553	Bacteria	2329
147	Ga0105249_10148420	3300009553	Bacteria	2255
148	Ga0099796_10007870	3300010159	Bacteria	2810
149	Ga0105239_10156389	3300010375	Bacteria	2546
150	Ga0105239_10179943	3300010375	Bacteria	2366
151	Ga0105239_10649085	3300010375	Bacteria	1205
152	Ga0157371_10050028	3300013102	Bacteria	2969
153	Ga0157371_10190856	3300013102	Bacteria	1467
154	Ga0157369_10196256	3300013105	Bacteria	2120
155	Ga0157369_10395534	3300013105	Bacteria	1434
156	Ga0157374_10404264	3300013296	Bacteria	1363
157	Ga0157378_10481134	3300013297	Bacteria	1237
158	Ga0163162_10290249	3300013306	Bacteria	1767
159	Ga0163162_10446574	3300013306	Bacteria	1425
160	Ga0157372_10005609	3300013307	Bacteria	13346
161	Ga0157372_10061957	3300013307	Bacteria	4190
162	Ga0157372_10187443	3300013307	Bacteria	2396
163	Ga0157372_10409740	3300013307	Bacteria	1580
164	Ga0157372_10873525	3300013307	Bacteria	1044
165	Ga0157375_10038060	3300013308	Bacteria	4615
166	Ga0157375_10323205	3300013308	Bacteria	1707
167	Ga0157375_10378814	3300013308	Bacteria	1581
168	Ga0163163_10003482	3300014325	Bacteria	13369
169	Ga0163163_10030757	3300014325	Bacteria	5176
170	Ga0163163_10479735	3300014325	Bacteria	1304
171	Ga0157380_10022934	3300014326	Bacteria	4707
172	Ga0157380_10597027	3300014326	Bacteria	1091
173	Ga0157377_10001560	3300014745	Bacteria	9971
174	Ga0157379_10128225	3300014968	Bacteria	2283
175	Ga0157379_10165946	3300014968	Bacteria	1993
176	Ga0157376_10351250	3300014969	Bacteria	1411
177	Ga0157376_10523060	3300014969	Bacteria	1169
178	Ga0163161_10130590	3300017792	Bacteria	1894
179	Ga0163161_10167403	3300017792	Bacteria	1679
180	Ga0207426_1000019	3300025302	Bacteria	558579
181	Ga0207642_10075405	3300025899	Bacteria	1620
182	Ga0207710_10033543	3300025900	Bacteria	2252
183	Ga0207680_10032707	3300025903	Bacteria	2959
184	Ga0207643_10020898	3300025908	Bacteria	3593
185	Ga0207643_10068179	3300025908	Bacteria	2043
186	Ga0207643_10346382	3300025908	Bacteria	932
187	Ga0207705_10179302	3300025909	Bacteria	1598
188	Ga0207684_10153758	3300025910	Bacteria	1980
189	Ga0207707_10036065	3300025912	Bacteria	4325
190	Ga0207707_10119700	3300025912	Bacteria	2301
191	Ga0207695_10000201	3300025913	Bacteria	165092
192	Ga0207695_10056305	3300025913	Bacteria	4092
193	Ga0207660_10062878	3300025917	Bacteria	2675
194	Ga0207660_10164459	3300025917	Bacteria	1714
195	Ga0207662_10105793	3300025918	Bacteria	1749
196	Ga0207649_10036382	3300025920	Bacteria	2965
197	Ga0207649_10103699	3300025920	Bacteria	1887
198	Ga0207652_10168520	3300025921	Bacteria	1965
199	Ga0207646_10145352	3300025922	Bacteria	2137
200	Ga0207681_10006828	3300025923	Bacteria	7000
201	Ga0207681_10079714	3300025923	Bacteria	2308
202	Ga0207694_10104516	3300025924	Bacteria	2247
203	Ga0207659_10029184	3300025926	Bacteria	3757
204	Ga0207659_10059378	3300025926	Bacteria	2749
205	Ga0207687_10003793	3300025927	Bacteria	10158
206	Ga0207690_10031825	3300025932	Bacteria	3380
207	Ga0207690_10416784	3300025932	Bacteria	1074
208	Ga0207706_10025518	3300025933	Bacteria	5295
209	Ga0207706_10123121	3300025933	Bacteria	2281
210	Ga0207706_10287873	3300025933	Bacteria	1432
211	Ga0207670_10000011	3300025936	Bacteria	266639
212	Ga0207670_10015546	3300025936	Bacteria	4550
213	Ga0207704_10305194	3300025938	Bacteria	1221
214	Ga0207691_10024030	3300025940	Bacteria	5733
215	Ga0207691_10118479	3300025940	Bacteria	2349
216	Ga0207711_10077403	3300025941	Bacteria	2899
217	Ga0207689_10005036	3300025942	Bacteria	11907
218	Ga0207689_10009293	3300025942	Bacteria	8499
219	Ga0207679_10003230	3300025945	Bacteria	10051
220	Ga0207679_10021848	3300025945	Bacteria	4346
221	Ga0207667_10001163	3300025949	Bacteria	33062
222	Ga0207651_10161848	3300025960	Bacteria	1755
223	Ga0207712_10004676	3300025961	Bacteria	8656
224	Ga0207712_10012292	3300025961	Bacteria	5470
225	Ga0207712_10125106	3300025961	Bacteria	1951
226	Ga0207712_10303738	3300025961	Bacteria	1311
227	Ga0207668_10005023	3300025972	Bacteria	7787
228	Ga0207640_10044086	3300025981	Bacteria	2856
229	Ga0207640_10500334	3300025981	Bacteria	1012
230	Ga0207658_10163676	3300025986	Bacteria	1825
231	Ga0207677_10035936	3300026023	Bacteria	3223
232	Ga0207677_10097313	3300026023	Bacteria	2156
233	Ga0207639_10014058	3300026041	Bacteria	5618
234	Ga0207708_10026544	3300026075	Bacteria	4385
235	Ga0207702_10108449	3300026078	Bacteria	2464
236	Ga0207641_10004780	3300026088	Bacteria	11682
237	Ga0207641_10035150	3300026088	Bacteria	4173
238	Ga0207648_10005339	3300026089	Bacteria	12954
239	Ga0207648_10129146	3300026089	Unclassified	2224
240	Ga0207648_10382627	3300026089	Bacteria	1272
241	Ga0207676_10002529	3300026095	Bacteria	13044
242	Ga0207676_10078876	3300026095	Bacteria	2668
243	Ga0207676_10129502	3300026095	Bacteria	2143
244	Ga0207674_10043128	3300026116	Bacteria	4653
245	Ga0207674_10049390	3300026116	Bacteria	4303
246	Ga0207674_10058863	3300026116	Bacteria	3890
247	Ga0207674_10226065	3300026116	Bacteria	1820
248	Ga0207674_10234142	3300026116	Bacteria	1784
249	Ga0207675_100005180	3300026118	Bacteria	12550
250	Ga0207675_100035068	3300026118	Bacteria	4680
251	Ga0207675_100170185	3300026118	Bacteria	2082
252	Ga0207675_100215771	3300026118	Bacteria	1847
253	Ga0207675_100330961	3300026118	Bacteria	1489
254	Ga0207683_10076145	3300026121	Bacteria	2971
255	Ga0207683_10080553	3300026121	Bacteria	2889
256	Ga0207683_10449090	3300026121	Bacteria	1188
257	Ga0207698_10050350	3300026142	Bacteria	3177
258	Ga0207698_10086832	3300026142	Bacteria	2546
259	Ga0207698_10416028	3300026142	Bacteria	1289
260	Ga0207698_10725657	3300026142	Unclassified	991
261	Ga0207428_10002897	3300027907	Bacteria	17005
262	Ga0207428_10007492	3300027907	Bacteria	9946
263	Ga0207428_10036729	3300027907	Bacteria	3993
264	Ga0207428_10113293	3300027907	Bacteria	2085
265	Ga0268266_10253556	3300028379	Bacteria	1628
266	Ga0268265_10000595	3300028380	Bacteria	36375
267	Ga0268265_10001632	3300028380	Bacteria	18447
268	Ga0268264_10042763	3300028381	Bacteria	3751
269	Ga0268264_10116272	3300028381	Bacteria	2351
270	Ga0316182_1145792	3300030745	Bacteria	1350
271	Ga0265325_10046400	3300031241	Bacteria	2254
272	Ga0265340_10006029	3300031247	Bacteria	6690
273	Ga0265331_10013760	3300031250	Bacteria	4338
274	Ga0265327_10000238	3300031251	Bacteria	109943
275	Ga0265327_10041529	3300031251	Bacteria	2478
276	Ga0307408_100015715	3300031548	Bacteria	5043
277	Ga0307408_100033535	3300031548	Bacteria	3588
278	Ga0307408_100069562	3300031548	Bacteria	2596
279	Ga0307408_100187737	3300031548	Bacteria	1663
280	Ga0307508_10443855	3300031616	Bacteria	890
281	Ga0316579_10023445	3300031691	Bacteria	2770
282	Ga0316579_10252703	3300031691	Bacteria	852
283	Ga0316576_10007513	3300031727	Bacteria	6871
284	Ga0316576_10019651	3300031727	Bacteria	4632
285	Ga0316576_10169382	3300031727	Bacteria	1648
286	Ga0316576_10184335	3300031727	Bacteria	1574
287	Ga0316576_10189067	3300031727	Bacteria	1553
288	Ga0316578_10067840	3300031728	Bacteria	2109
289	Ga0316578_10199001	3300031728	Bacteria	1206
290	Ga0307405_10146199	3300031731	Bacteria	1656
291	Ga0316577_10055178	3300031733	Bacteria	2217
292	Ga0316577_10218887	3300031733	Bacteria	1076
293	Ga0307413_10075449	3300031824	Bacteria	2140
294	Ga0307413_10275536	3300031824	Bacteria	1262
295	Ga0307410_10026968	3300031852	Bacteria	3625
296	Ga0307410_10078151	3300031852	Bacteria	2315
297	Ga0307406_10015176	3300031901	Bacteria	4452
298	Ga0307406_10064660	3300031901	Bacteria	2375
299	Ga0307407_10004580	3300031903	Bacteria	5888
300	Ga0307407_10010700	3300031903	Bacteria	4336
301	Ga0307409_100131973	3300031995	Bacteria	2136
302	Ga0307409_100222370	3300031995	Bacteria	1705
303	Ga0307416_100002768	3300032002	Bacteria	10180
304	Ga0307416_100134533	3300032002	Bacteria	2233
305	Ga0307414_10195451	3300032004	Bacteria	1641
306	Ga0307411_10009930	3300032005	Bacteria	5040
307	Ga0307411_10052004	3300032005	Bacteria	2676
308	Ga0307411_10092055	3300032005	Bacteria	2120
309	Ga0307411_10181239	3300032005	Bacteria	1599
310	Ga0307415_100008438	3300032126	Bacteria	5710
311	Ga0307415_100029695	3300032126	Bacteria	3497
312	Ga0307415_100048600	3300032126	Bacteria	2864
313	Ga0307415_100221065	3300032126	Bacteria	1518
314	Ga0307415_100573080	3300032126	Unclassified	1000
315	Ga0316583_10008780	3300032133	Bacteria	3646
316	Ga0316580_10041937	3300032139	Bacteria	1413
317	Ga0316580_10045937	3300032139	Bacteria	1346
318	Ga0316593_10011773	3300032168	Bacteria	2552
319	Ga0316593_10021928	3300032168	Bacteria	2001
320	Ga0316592_1009028	3300033524	Bacteria	1989
321	Ga0316592_1017968	3300033524	Bacteria	1487
322	Ga0316592_1036523	3300033524	Bacteria	1080
323	Ga0316588_1016812	3300033528	Bacteria	1625
324	Ga0316596_1000002	3300033541	Bacteria	24681
325	Ga0316574_0004019	3300035398	Bacteria	7666
326	Ga0316574_0016008	3300035398	Bacteria	4361
327	Ga0316574_0025880	3300035398	Bacteria	3525
328	Ga0316574_0027830	3300035398	Bacteria	3406
329	Ga0316574_0119274	3300035398	Bacteria	1693
330	Ga0316574_0172171	3300035398	Bacteria	1394
331	Ga0316574_0428967	3300035398	Bacteria	830
332	Ga0316582_0004519	3300036647	Bacteria	7044
333	Ga0316582_0208151	3300036647	Bacteria	1336
334	Ga0316582_0265822	3300036647	Bacteria	1176
335	Ga0316584_0002666	3300036712	Bacteria	11391
336	Ga0316584_0031991	3300036712	Bacteria	3892
337	Ga0316584_0168801	3300036712	Bacteria	1624
338	Ga0316584_0272967	3300036712	Bacteria	1230
339	Ga0373925_0117085	3300037068	Bacteria	2065
340	Ga0373925_0139940	3300037068	Bacteria	1893
341	Ga0316581_0025651	3300037588	Bacteria	1754
342	Ga0395901_0640847	3300038443	Bacteria	1067
343	Ga0400490_07976	3300038726	Bacteria	5754
344	Ga0400487_39832	3300039110	Bacteria	22275
345	Ga0439448_0010723	3300042005	Bacteria	2721
346	Ga0450896_004849	3300042133	Bacteria	1831
347	Ga0450902_014841	3300042137	Bacteria	1261
348	Ga0451577_0153241	3300042876	Bacteria	2074
349	Ga0451577_0656756	3300042876	Bacteria	951
350	Ga0466969_0048807	3300044656	Bacteria	2091
351	Ga0466961_0129064	3300044693	Bacteria	1585
352	Ga0451576_0093186	3300045051	Bacteria	3132
353	Ga0495638_0002755	3300046460	Bacteria	14122
354	Ga0495638_0084310	3300046460	Bacteria	1923
355	Ga0495650_0000240	3300046471	Bacteria	109029
356	Ga0495650_0022030	3300046471	Bacteria	3063
357	Ga0495616_0160045	3300046513	Bacteria	1013
358	Ga0495618_0161745	3300046514	Bacteria	1427
359	Ga0495625_0000623	3300046660	Bacteria	51222
360	Ga0495625_0034215	3300046660	Bacteria	3751
361	Ga0496101_0270458	3300048904	Bacteria	1327
362	Ga0496102_0112289	3300048905	Bacteria	2542
363	Ga0496106_0038348	3300048909	Bacteria	3585
364	Ga0496106_0087126	3300048909	Bacteria	2406
365	Ga0496107_0543804	3300048910	Bacteria	860
366	Ga0496110_0161663	3300048913	Bacteria	2030
367	Ga0496116_0017533	3300048919	Bacteria	5552
368	Ga0496118_0280646	3300048921	Bacteria	927
369	Ga0496121_0116854	3300048924	Bacteria	2022
370	Ga0501034_0510490	3300049571	Bacteria	1115
371	Ga0501036_0329783	3300049572	Bacteria	1275
372	Ga0501039_0138727	3300049575	Bacteria	1910
373	Ga0501040_0189457	3300049576	Bacteria	1459
374	Ga0501041_0099767	3300049577	Bacteria	1797
375	Ga0501041_0280751	3300049577	Bacteria	1048
376	Ga0501042_0162413	3300049578	Bacteria	1612
377	Ga0501047_0006822	3300049581	Bacteria	10730
378	Ga0501069_0032068	3300049585	Bacteria	2892
379	Ga0501070_0000052	3300049586	Bacteria	101405
380	Ga0501070_0253518	3300049586	Bacteria	1439
381	Ga0501070_0424402	3300049586	Bacteria	1074
382	Ga0501071_0039756	3300049587	Bacteria	3365
383	Ga0501072_0202120	3300049588	Bacteria	1584
384	Ga0501073_0020809	3300049589	Bacteria	4731
385	Ga0501074_0099957	3300049590	Bacteria	2076
386	Ga0501239_014146	3300049672	Bacteria	920
387	Ga0501242_002352	3300049674	Bacteria	1981
388	Ga0501247_000670	3300049677	Bacteria	2887
389	Ga0501249_001352	3300049679	Bacteria	5093
390	Ga0501079_0101030	3300049741	Bacteria	2236
391	Ga0501079_0214980	3300049741	Bacteria	1502
392	Ga0501080_0073469	3300049742	Bacteria	3182
393	Ga0501080_0185038	3300049742	Bacteria	1915
394	Ga0501081_0091995	3300049743	Bacteria	2134
395	Ga0501083_0218913	3300049744	Bacteria	1240
396	Ga0501035_0029887	3300049822	Bacteria	4969
397	Ga0501044_0032572	3300049823	Bacteria	5478
398	nmdc:mga05p37_218612_c1	3300050507	Bacteria	2300
399	nmdc:mga05p37_252411_c1	3300050507	Bacteria	2115
400	nmdc:mga05p37_41697_c1	3300050507	Bacteria	5637
401	nmdc:mga05p37_82958_c1	3300050507	Bacteria	3949
402	nmdc:mga05p37_93960_c1	3300050507	Bacteria	3695
403	nmdc:mga09592_1625_c1	3300050508	Bacteria	18092
404	nmdc:mga09592_31339_c2	3300050508	Bacteria	3007
405	nmdc:mga09592_31860_c1	3300050508	Bacteria	4395
406	nmdc:mga09592_70111_c1	3300050508	Bacteria	2974
407	nmdc:mga09592_88343_c1	3300050508	Bacteria	2647
408	nmdc:mga0qj67_68988_c1	3300050509	Bacteria	2819
409	nmdc:mga0qj67_8249_c1	3300050509	Bacteria	7723
410	nmdc:mga06r32_112698_c1	3300050510	Bacteria	2677
411	nmdc:mga06r32_193246_c1	3300050510	Bacteria	2022
412	nmdc:mga06r32_2847_c1	3300050510	Bacteria	15521
413	nmdc:mga06r32_407466_c1	3300050510	Bacteria	1341
414	nmdc:mga06r32_7157_c1	3300050510	Bacteria	10052
415	nmdc:mga08y16_100758_c1	3300050511	Bacteria	3007
416	nmdc:mga08y16_10114_c1	3300050511	Bacteria	9904
417	nmdc:mga08y16_102496_c1	3300050511	Bacteria	2980
418	nmdc:mga08y16_138362_c1	3300050511	Bacteria	2532
419	nmdc:mga08y16_146220_c1	3300050511	Bacteria	2457
420	nmdc:mga08y16_160538_c1	3300050511	Bacteria	2336
421	nmdc:mga08y16_524703_c1	3300050511	Bacteria	1201
422	nmdc:mga0n895_286107_c1	3300050512	Bacteria	1671
423	nmdc:mga0n895_664545_c1	3300050512	Bacteria	1040
424	nmdc:mga0a205_394916_c1	3300050515	Bacteria	1247
425	nmdc:mga0a205_79850_c1	3300050515	Bacteria	3161
426	Ga0500595_025560	3300053119	Bacteria	2045
427	Ga0500642_0203854	3300053130	Bacteria	920
428	Ga0500658_0033538	3300053134	Bacteria	2020
429	Ga0501084_0067025	3300054114	Bacteria	3004
430	Ga0590071_045800	3300059421	Bacteria	1056
431	Ga0501082_0004107	3300060353	Bacteria	12717
432	Ga0530510_0171894	3300061734	Bacteria	1605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013102	Ga0157371_10050028	Ga0157371_100500281	211
2	3300010159	Ga0099796_10007870	Ga0099796_100078702	225
3	3300031727	Ga0316576_10189067	Ga0316576_101890671	232
4	3300035398	Ga0316574_0025880	Ga0316574_0025880_2559_3326	232
5	3300053119	Ga0500595_025560	Ga0500595_025560_507_1250	232
6	3300031691	Ga0316579_10252703	Ga0316579_102527031	234
7	3300031733	Ga0316577_10055178	Ga0316577_100551782	234
8	3300032139	Ga0316580_10045937	Ga0316580_100459372	234
9	3300032168	Ga0316593_10021928	Ga0316593_100219281	234
10	3300033524	Ga0316592_1009028	Ga0316592_10090284	234
11	3300033528	Ga0316588_1016812	Ga0316588_10168123	234
12	3300036712	Ga0316584_0272967	Ga0316584_0272967_150_905	234
13	3300005841	Ga0068863_100045705	Ga0068863_1000457052	235
14	3300026088	Ga0207641_10035150	Ga0207641_100351502	235
15	3300035398	Ga0316574_0428967	Ga0316574_0428967_30_785	236
16	3300031691	Ga0316579_10023445	Ga0316579_100234451	237
17	3300031727	Ga0316576_10169382	Ga0316576_101693823	237
18	3300031728	Ga0316578_10067840	Ga0316578_100678404	237
19	3300031728	Ga0316578_10199001	Ga0316578_101990011	237
20	3300031733	Ga0316577_10218887	Ga0316577_102188872	237
21	3300032133	Ga0316583_10008780	Ga0316583_100087802	237
22	3300032139	Ga0316580_10041937	Ga0316580_100419371	237
23	3300032168	Ga0316593_10011773	Ga0316593_100117735	237
24	3300035398	Ga0316574_0119274	Ga0316574_0119274_145_900	237
25	3300036647	Ga0316582_0208151	Ga0316582_0208151_569_1324	237
26	3300036647	Ga0316582_0265822	Ga0316582_0265822_361_1116	237
27	3300036712	Ga0316584_0168801	Ga0316584_0168801_588_1343	237
28	3300037588	Ga0316581_0025651	Ga0316581_0025651_690_1445	237
29	3300048919	Ga0496116_0017533	Ga0496116_0017533_1390_2121	237
30	3300005366	Ga0070659_100144071	Ga0070659_1001440712	239
31	3300005457	Ga0070662_100378343	Ga0070662_1003783431	239
32	3300005530	Ga0070679_100051012	Ga0070679_1000510124	239
33	3300005535	Ga0070684_100335835	Ga0070684_1003358352	239
34	3300005539	Ga0068853_100046617	Ga0068853_1000466174	239
35	3300005577	Ga0068857_100330061	Ga0068857_1003300612	239
36	3300005614	Ga0068856_100004637	Ga0068856_1000046379	239
37	3300005617	Ga0068859_100315502	Ga0068859_1003155023	239
38	3300005844	Ga0068862_100133566	Ga0068862_1001335664	239
39	3300005844	Ga0068862_100316269	Ga0068862_1003162692	239
40	3300006931	Ga0097620_100315503	Ga0097620_1003155033	239
41	3300013308	Ga0157375_10323205	Ga0157375_103232052	239
42	3300025900	Ga0207710_10033543	Ga0207710_100335434	239
43	3300025909	Ga0207705_10179302	Ga0207705_101793022	239
44	3300025917	Ga0207660_10164459	Ga0207660_101644592	239
45	3300025932	Ga0207690_10416784	Ga0207690_104167842	239
46	3300025949	Ga0207667_10001163	Ga0207667_1000116314	239
47	3300026041	Ga0207639_10014058	Ga0207639_100140586	239
48	3300026116	Ga0207674_10049390	Ga0207674_100493904	239
49	3300026121	Ga0207683_10080553	Ga0207683_100805532	239
50	3300031901	Ga0307406_10064660	Ga0307406_100646603	239
51	3300031995	Ga0307409_100131973	Ga0307409_1001319732	239
52	3300032126	Ga0307415_100573080	Ga0307415_1005730801	239
53	3300042005	Ga0439448_0010723	Ga0439448_0010723_17_742	239
54	3300049581	Ga0501047_0006822	Ga0501047_0006822_7565_8296	239
55	3300049586	Ga0501070_0253518	Ga0501070_0253518_72_803	239
56	3300049742	Ga0501080_0073469	Ga0501080_0073469_1344_2075	239
57	3300049822	Ga0501035_0029887	Ga0501035_0029887_2310_3041	239
58	3300049823	Ga0501044_0032572	Ga0501044_0032572_2985_3716	239
59	3300050510	nmdc:mga06r32_112698_c1	nmdc:mga06r32_112698_c1_19_744	239
60	3300009093	Ga0105240_10000164	Ga0105240_1000016459	240
61	3300009147	Ga0114129_10571227	Ga0114129_105712272	240
62	3300013306	Ga0163162_10446574	Ga0163162_104465741	240
63	3300025913	Ga0207695_10000201	Ga0207695_1000020161	240
64	3300037068	Ga0373925_0117085	Ga0373925_0117085_342_1070	240
65	3300046460	Ga0495638_0084310	Ga0495638_0084310_214_954	240
66	3300046471	Ga0495650_0000240	Ga0495650_0000240_35965_36705	240
67	3300046514	Ga0495618_0161745	Ga0495618_0161745_403_1131	240
68	3300046660	Ga0495625_0000623	Ga0495625_0000623_12972_13712	240
69	3300050507	nmdc:mga05p37_252411_c1	nmdc:mga05p37_252411_c1_404_1147	240
70	3300050508	nmdc:mga09592_70111_c1	nmdc:mga09592_70111_c1_316_1044	240
71	3300050510	nmdc:mga06r32_193246_c1	nmdc:mga06r32_193246_c1_228_971	240
72	3300050512	nmdc:mga0n895_286107_c1	nmdc:mga0n895_286107_c1_44_775	240
73	3300050515	nmdc:mga0a205_394916_c1	nmdc:mga0a205_394916_c1_97_831	240
74	3300005441	Ga0070700_100471932	Ga0070700_1004719321	241
75	3300005549	Ga0070704_100215328	Ga0070704_1002153282	241
76	3300005719	Ga0068861_100508718	Ga0068861_1005087181	241
77	3300006852	Ga0075433_10123331	Ga0075433_101233313	241
78	3300009147	Ga0114129_10195820	Ga0114129_101958202	241
79	3300010375	Ga0105239_10156389	Ga0105239_101563893	241
80	3300048905	Ga0496102_0112289	Ga0496102_0112289_578_1315	241
81	3300048909	Ga0496106_0038348	Ga0496106_0038348_1840_2577	241
82	3300048910	Ga0496107_0543804	Ga0496107_0543804_63_800	241
83	3300050507	nmdc:mga05p37_82958_c1	nmdc:mga05p37_82958_c1_2145_2882	241
84	3300050515	nmdc:mga0a205_79850_c1	nmdc:mga0a205_79850_c1_2374_3111	241
85	3300038726	Ga0400490_07976	Ga0400490_07976_4805_5572	242
86	3300009094	Ga0111539_10004080	Ga0111539_100040809	243
87	3300009098	Ga0105245_10010431	Ga0105245_100104316	243
88	3300010375	Ga0105239_10179943	Ga0105239_101799434	243
89	3300013306	Ga0163162_10290249	Ga0163162_102902492	243
90	3300014745	Ga0157377_10001560	Ga0157377_100015607	243
91	3300031727	Ga0316576_10019651	Ga0316576_100196513	243
92	3300050511	nmdc:mga08y16_10114_c1	nmdc:mga08y16_10114_c1_4773_5522	243
93	3300009177	Ga0105248_11028333	Ga0105248_110283331	245
94	3300049572	Ga0501036_0329783	Ga0501036_0329783_311_1054	246
95	3300049575	Ga0501039_0138727	Ga0501039_0138727_958_1701	246
96	3300049577	Ga0501041_0099767	Ga0501041_0099767_981_1724	246
97	3300049587	Ga0501071_0039756	Ga0501071_0039756_2503_3246	246
98	3300049588	Ga0501072_0202120	Ga0501072_0202120_519_1262	246
99	3300049741	Ga0501079_0214980	Ga0501079_0214980_605_1348	246
100	3300054114	Ga0501084_0067025	Ga0501084_0067025_1788_2528	246
101	3300044656	Ga0466969_0048807	Ga0466969_0048807_543_1310	247
102	3300005331	Ga0070670_100122402	Ga0070670_1001224024	248
103	3300005334	Ga0068869_100004307	Ga0068869_1000043075	248
104	3300005338	Ga0068868_100090078	Ga0068868_1000900784	248
105	3300005344	Ga0070661_100045839	Ga0070661_1000458394	248
106	3300005345	Ga0070692_10018035	Ga0070692_100180352	248
107	3300005354	Ga0070675_100002846	Ga0070675_1000028465	248
108	3300005366	Ga0070659_100215779	Ga0070659_1002157792	248
109	3300005441	Ga0070700_100012079	Ga0070700_1000120795	248
110	3300005457	Ga0070662_100121877	Ga0070662_1001218772	248
111	3300005564	Ga0070664_100003190	Ga0070664_1000031907	248
112	3300005577	Ga0068857_100045680	Ga0068857_1000456803	248
113	3300005615	Ga0070702_100179785	Ga0070702_1001797852	248
114	3300005616	Ga0068852_100123837	Ga0068852_1001238372	248
115	3300005618	Ga0068864_100531216	Ga0068864_1005312162	248
116	3300005840	Ga0068870_10373499	Ga0068870_103734991	248
117	3300005842	Ga0068858_100118667	Ga0068858_1001186674	248
118	3300005843	Ga0068860_100205056	Ga0068860_1002050562	248
119	3300025908	Ga0207643_10346382	Ga0207643_103463821	248
120	3300025920	Ga0207649_10036382	Ga0207649_100363824	248
121	3300025923	Ga0207681_10079714	Ga0207681_100797144	248
122	3300025926	Ga0207659_10029184	Ga0207659_100291843	248
123	3300025927	Ga0207687_10003793	Ga0207687_100037934	248
124	3300025933	Ga0207706_10123121	Ga0207706_101231214	248
125	3300025942	Ga0207689_10009293	Ga0207689_100092933	248
126	3300025945	Ga0207679_10003230	Ga0207679_100032302	248
127	3300026023	Ga0207677_10097313	Ga0207677_100973132	248
128	3300026075	Ga0207708_10026544	Ga0207708_100265443	248
129	3300026116	Ga0207674_10058863	Ga0207674_100588634	248
130	3300026118	Ga0207675_100170185	Ga0207675_1001701852	248
131	3300026142	Ga0207698_10050350	Ga0207698_100503504	248
132	3300027907	Ga0207428_10007492	Ga0207428_100074927	248
133	3300028381	Ga0268264_10116272	Ga0268264_101162723	248
134	3300031731	Ga0307405_10146199	Ga0307405_101461992	248
135	3300031995	Ga0307409_100222370	Ga0307409_1002223703	248
136	3300032126	Ga0307415_100048600	Ga0307415_1000486002	248
137	3300005340	Ga0070689_100656391	Ga0070689_1006563911	249
138	3300031250	Ga0265331_10013760	Ga0265331_100137603	249
139	3300031251	Ga0265327_10000238	Ga0265327_1000023820	249
140	3300031824	Ga0307413_10075449	Ga0307413_100754492	249
141	3300037068	Ga0373925_0139940	Ga0373925_0139940_876_1652	249
142	3300005289	Ga0065704_10139825	Ga0065704_101398252	250
143	3300005293	Ga0065715_10047481	Ga0065715_100474811	250
144	3300005293	Ga0065715_10136972	Ga0065715_101369722	250
145	3300005330	Ga0070690_100015764	Ga0070690_1000157647	250
146	3300005331	Ga0070670_100029895	Ga0070670_1000298954	250
147	3300005331	Ga0070670_100039092	Ga0070670_1000390922	250
148	3300005335	Ga0070666_10006503	Ga0070666_100065035	250
149	3300005338	Ga0068868_100092979	Ga0068868_1000929792	250
150	3300005340	Ga0070689_100000001	Ga0070689_100000001907	250
151	3300005340	Ga0070689_100030588	Ga0070689_1000305885	250
152	3300005340	Ga0070689_100055157	Ga0070689_1000551575	250
153	3300005343	Ga0070687_100095956	Ga0070687_1000959561	250
154	3300005344	Ga0070661_100158937	Ga0070661_1001589371	250
155	3300005345	Ga0070692_10216521	Ga0070692_102165212	250
156	3300005347	Ga0070668_100016045	Ga0070668_1000160453	250
157	3300005353	Ga0070669_100035407	Ga0070669_1000354073	250
158	3300005354	Ga0070675_100010709	Ga0070675_1000107092	250
159	3300005354	Ga0070675_100124350	Ga0070675_1001243503	250
160	3300005355	Ga0070671_100027293	Ga0070671_1000272934	250
161	3300005364	Ga0070673_100004190	Ga0070673_1000041902	250
162	3300005366	Ga0070659_100045175	Ga0070659_1000451752	250
163	3300005367	Ga0070667_100030244	Ga0070667_1000302442	250
164	3300005438	Ga0070701_10043568	Ga0070701_100435682	250
165	3300005444	Ga0070694_100088692	Ga0070694_1000886921	250
166	3300005456	Ga0070678_100087990	Ga0070678_1000879904	250
167	3300005456	Ga0070678_100210799	Ga0070678_1002107991	250
168	3300005457	Ga0070662_100007050	Ga0070662_1000070504	250
169	3300005458	Ga0070681_10026910	Ga0070681_100269106	250
170	3300005459	Ga0068867_100499768	Ga0068867_1004997681	250
171	3300005466	Ga0070685_10065763	Ga0070685_100657635	250
172	3300005467	Ga0070706_100105642	Ga0070706_1001056422	250
173	3300005468	Ga0070707_100290709	Ga0070707_1002907092	250
174	3300005530	Ga0070679_100064550	Ga0070679_1000645504	250
175	3300005539	Ga0068853_100016651	Ga0068853_1000166515	250
176	3300005543	Ga0070672_100032691	Ga0070672_1000326912	250
177	3300005544	Ga0070686_100111068	Ga0070686_1001110682	250
178	3300005548	Ga0070665_100012879	Ga0070665_1000128799	250
179	3300005549	Ga0070704_100470268	Ga0070704_1004702682	250
180	3300005563	Ga0068855_100002075	Ga0068855_10000207524	250
181	3300005564	Ga0070664_100007343	Ga0070664_1000073439	250
182	3300005564	Ga0070664_100058365	Ga0070664_1000583654	250
183	3300005577	Ga0068857_100050711	Ga0068857_1000507116	250
184	3300005577	Ga0068857_100224207	Ga0068857_1002242072	250
185	3300005617	Ga0068859_100020509	Ga0068859_1000205093	250
186	3300005617	Ga0068859_100465151	Ga0068859_1004651512	250
187	3300005618	Ga0068864_100108196	Ga0068864_1001081963	250
188	3300005719	Ga0068861_100115354	Ga0068861_1001153542	250
189	3300005719	Ga0068861_100225674	Ga0068861_1002256741	250
190	3300005719	Ga0068861_100424987	Ga0068861_1004249872	250
191	3300005840	Ga0068870_10054158	Ga0068870_100541582	250
192	3300005841	Ga0068863_100003431	Ga0068863_1000034314	250
193	3300005841	Ga0068863_100302453	Ga0068863_1003024532	250
194	3300005843	Ga0068860_100027747	Ga0068860_1000277474	250
195	3300005844	Ga0068862_100002210	Ga0068862_10000221011	250
196	3300005844	Ga0068862_100004938	Ga0068862_10000493814	250
197	3300005844	Ga0068862_100154137	Ga0068862_1001541373	250
198	3300006237	Ga0097621_100088403	Ga0097621_1000884032	250
199	3300006237	Ga0097621_100597837	Ga0097621_1005978371	250
200	3300006358	Ga0068871_100067829	Ga0068871_1000678292	250
201	3300006844	Ga0075428_100010699	Ga0075428_10001069910	250
202	3300006844	Ga0075428_100023421	Ga0075428_1000234213	250
203	3300006844	Ga0075428_100038985	Ga0075428_1000389854	250
204	3300006844	Ga0075428_100043503	Ga0075428_1000435034	250
205	3300006844	Ga0075428_100329450	Ga0075428_1003294504	250
206	3300006846	Ga0075430_100039395	Ga0075430_1000393953	250
207	3300006846	Ga0075430_100054827	Ga0075430_1000548272	250
208	3300006846	Ga0075430_100174620	Ga0075430_1001746201	250
209	3300006847	Ga0075431_100000895	Ga0075431_1000008954	250
210	3300006847	Ga0075431_100051524	Ga0075431_1000515244	250
211	3300006871	Ga0075434_100282059	Ga0075434_1002820591	250
212	3300006880	Ga0075429_100004626	Ga0075429_1000046264	250
213	3300006880	Ga0075429_100023227	Ga0075429_1000232274	250
214	3300006880	Ga0075429_100225900	Ga0075429_1002259003	250
215	3300006881	Ga0068865_100179135	Ga0068865_1001791352	250
216	3300006931	Ga0097620_100020509	Ga0097620_1000205093	250
217	3300006931	Ga0097620_100465162	Ga0097620_1004651621	250
218	3300009092	Ga0105250_10057219	Ga0105250_100572191	250
219	3300009093	Ga0105240_10160466	Ga0105240_101604663	250
220	3300009094	Ga0111539_10174225	Ga0111539_101742252	250
221	3300009094	Ga0111539_10285595	Ga0111539_102855953	250
222	3300009094	Ga0111539_10298956	Ga0111539_102989563	250
223	3300009094	Ga0111539_10312309	Ga0111539_103123092	250
224	3300009094	Ga0111539_10333080	Ga0111539_103330802	250
225	3300009094	Ga0111539_10532608	Ga0111539_105326082	250
226	3300009101	Ga0105247_10030630	Ga0105247_100306302	250
227	3300009147	Ga0114129_10019435	Ga0114129_100194359	250
228	3300009147	Ga0114129_10066609	Ga0114129_100666092	250
229	3300009147	Ga0114129_10553703	Ga0114129_105537032	250
230	3300009177	Ga0105248_10023386	Ga0105248_100233867	250
231	3300009551	Ga0105238_10150114	Ga0105238_101501142	250
232	3300009553	Ga0105249_10083339	Ga0105249_100833393	250
233	3300009553	Ga0105249_10089616	Ga0105249_100896163	250
234	3300009553	Ga0105249_10138746	Ga0105249_101387463	250
235	3300009553	Ga0105249_10148420	Ga0105249_101484202	250
236	3300010375	Ga0105239_10649085	Ga0105239_106490852	250
237	3300013297	Ga0157378_10481134	Ga0157378_104811342	250
238	3300013308	Ga0157375_10038060	Ga0157375_100380604	250
239	3300014325	Ga0163163_10003482	Ga0163163_100034829	250
240	3300014325	Ga0163163_10479735	Ga0163163_104797351	250
241	3300014326	Ga0157380_10022934	Ga0157380_100229344	250
242	3300014326	Ga0157380_10597027	Ga0157380_105970272	250
243	3300014968	Ga0157379_10128225	Ga0157379_101282252	250
244	3300014968	Ga0157379_10165946	Ga0157379_101659461	250
245	3300014969	Ga0157376_10351250	Ga0157376_103512501	250
246	3300017792	Ga0163161_10167403	Ga0163161_101674032	250
247	3300025899	Ga0207642_10075405	Ga0207642_100754052	250
248	3300025903	Ga0207680_10032707	Ga0207680_100327075	250
249	3300025908	Ga0207643_10020898	Ga0207643_100208981	250
250	3300025908	Ga0207643_10068179	Ga0207643_100681792	250
251	3300025910	Ga0207684_10153758	Ga0207684_101537584	250
252	3300025912	Ga0207707_10036065	Ga0207707_100360656	250
253	3300025912	Ga0207707_10119700	Ga0207707_101197002	250
254	3300025913	Ga0207695_10056305	Ga0207695_100563057	250
255	3300025917	Ga0207660_10062878	Ga0207660_100628781	250
256	3300025918	Ga0207662_10105793	Ga0207662_101057933	250
257	3300025920	Ga0207649_10103699	Ga0207649_101036994	250
258	3300025922	Ga0207646_10145352	Ga0207646_101453522	250
259	3300025923	Ga0207681_10006828	Ga0207681_100068287	250
260	3300025924	Ga0207694_10104516	Ga0207694_101045162	250
261	3300025926	Ga0207659_10059378	Ga0207659_100593786	250
262	3300025932	Ga0207690_10031825	Ga0207690_100318253	250
263	3300025933	Ga0207706_10025518	Ga0207706_100255184	250
264	3300025933	Ga0207706_10287873	Ga0207706_102878732	250
265	3300025936	Ga0207670_10000011	Ga0207670_1000001191	250
266	3300025936	Ga0207670_10015546	Ga0207670_100155467	250
267	3300025938	Ga0207704_10305194	Ga0207704_103051941	250
268	3300025940	Ga0207691_10024030	Ga0207691_100240305	250
269	3300025941	Ga0207711_10077403	Ga0207711_100774032	250
270	3300025942	Ga0207689_10005036	Ga0207689_1000503611	250
271	3300025945	Ga0207679_10021848	Ga0207679_100218483	250
272	3300025960	Ga0207651_10161848	Ga0207651_101618482	250
273	3300025961	Ga0207712_10004676	Ga0207712_1000467610	250
274	3300025961	Ga0207712_10012292	Ga0207712_100122925	250
275	3300025961	Ga0207712_10125106	Ga0207712_101251063	250
276	3300025961	Ga0207712_10303738	Ga0207712_103037381	250
277	3300025972	Ga0207668_10005023	Ga0207668_100050237	250
278	3300025981	Ga0207640_10044086	Ga0207640_100440864	250
279	3300025986	Ga0207658_10163676	Ga0207658_101636762	250
280	3300026023	Ga0207677_10035936	Ga0207677_100359362	250
281	3300026078	Ga0207702_10108449	Ga0207702_101084495	250
282	3300026088	Ga0207641_10004780	Ga0207641_1000478012	250
283	3300026089	Ga0207648_10005339	Ga0207648_100053397	250
284	3300026095	Ga0207676_10002529	Ga0207676_100025292	250
285	3300026095	Ga0207676_10078876	Ga0207676_100788762	250
286	3300026116	Ga0207674_10043128	Ga0207674_100431283	250
287	3300026116	Ga0207674_10234142	Ga0207674_102341423	250
288	3300026118	Ga0207675_100005180	Ga0207675_10000518010	250
289	3300026118	Ga0207675_100035068	Ga0207675_1000350684	250
290	3300026118	Ga0207675_100215771	Ga0207675_1002157713	250
291	3300026118	Ga0207675_100330961	Ga0207675_1003309611	250
292	3300026121	Ga0207683_10076145	Ga0207683_100761456	250
293	3300027907	Ga0207428_10002897	Ga0207428_1000289716	250
294	3300027907	Ga0207428_10036729	Ga0207428_100367292	250
295	3300027907	Ga0207428_10113293	Ga0207428_101132932	250
296	3300028379	Ga0268266_10253556	Ga0268266_102535562	250
297	3300028380	Ga0268265_10000595	Ga0268265_1000059527	250
298	3300028380	Ga0268265_10001632	Ga0268265_1000163212	250
299	3300028381	Ga0268264_10042763	Ga0268264_100427632	250
300	3300030745	Ga0316182_1145792	Ga0316182_11457922	250
301	3300031548	Ga0307408_100015715	Ga0307408_1000157154	250
302	3300031548	Ga0307408_100033535	Ga0307408_1000335356	250
303	3300031548	Ga0307408_100069562	Ga0307408_1000695622	250
304	3300031616	Ga0307508_10443855	Ga0307508_104438551	250
305	3300031727	Ga0316576_10007513	Ga0316576_100075132	250
306	3300031727	Ga0316576_10184335	Ga0316576_101843352	250
307	3300031824	Ga0307413_10275536	Ga0307413_102755362	250
308	3300031852	Ga0307410_10026968	Ga0307410_100269682	250
309	3300031852	Ga0307410_10078151	Ga0307410_100781512	250
310	3300031901	Ga0307406_10015176	Ga0307406_100151767	250
311	3300031903	Ga0307407_10004580	Ga0307407_100045804	250
312	3300031903	Ga0307407_10010700	Ga0307407_100107002	250
313	3300032002	Ga0307416_100002768	Ga0307416_1000027681	250
314	3300032002	Ga0307416_100134533	Ga0307416_1001345332	250
315	3300032004	Ga0307414_10195451	Ga0307414_101954514	250
316	3300032005	Ga0307411_10009930	Ga0307411_100099307	250
317	3300032005	Ga0307411_10052004	Ga0307411_100520042	250
318	3300032005	Ga0307411_10181239	Ga0307411_101812392	250
319	3300032126	Ga0307415_100029695	Ga0307415_1000296952	250
320	3300032126	Ga0307415_100221065	Ga0307415_1002210652	250
321	3300033524	Ga0316592_1017968	Ga0316592_10179681	250
322	3300033524	Ga0316592_1036523	Ga0316592_10365232	250
323	3300033541	Ga0316596_1000002	Ga0316596_100000210	250
324	3300035398	Ga0316574_0004019	Ga0316574_0004019_6396_7151	250
325	3300035398	Ga0316574_0016008	Ga0316574_0016008_3577_4329	250
326	3300035398	Ga0316574_0027830	Ga0316574_0027830_490_1242	250
327	3300035398	Ga0316574_0172171	Ga0316574_0172171_340_1104	250
328	3300036647	Ga0316582_0004519	Ga0316582_0004519_1393_2148	250
329	3300036712	Ga0316584_0002666	Ga0316584_0002666_5736_6491	250
330	3300036712	Ga0316584_0031991	Ga0316584_0031991_414_1166	250
331	3300038443	Ga0395901_0640847	Ga0395901_0640847_33_788	250
332	3300039110	Ga0400487_39832	Ga0400487_39832_19696_20448	250
333	3300042133	Ga0450896_004849	Ga0450896_004849_728_1486	250
334	3300042137	Ga0450902_014841	Ga0450902_014841_452_1210	250
335	3300042876	Ga0451577_0656756	Ga0451577_0656756_177_929	250
336	3300045051	Ga0451576_0093186	Ga0451576_0093186_784_1542	250
337	3300046460	Ga0495638_0002755	Ga0495638_0002755_3664_4422	250
338	3300046471	Ga0495650_0022030	Ga0495650_0022030_1278_2030	250
339	3300046513	Ga0495616_0160045	Ga0495616_0160045_94_852	250
340	3300046660	Ga0495625_0034215	Ga0495625_0034215_2846_3604	250
341	3300048904	Ga0496101_0270458	Ga0496101_0270458_434_1204	250
342	3300048909	Ga0496106_0087126	Ga0496106_0087126_948_1706	250
343	3300048913	Ga0496110_0161663	Ga0496110_0161663_112_870	250
344	3300048921	Ga0496118_0280646	Ga0496118_0280646_65_823	250
345	3300048924	Ga0496121_0116854	Ga0496121_0116854_1019_1777	250
346	3300049577	Ga0501041_0280751	Ga0501041_0280751_136_894	250
347	3300049585	Ga0501069_0032068	Ga0501069_0032068_1458_2225	250
348	3300049586	Ga0501070_0000052	Ga0501070_0000052_61247_62014	250
349	3300049589	Ga0501073_0020809	Ga0501073_0020809_2858_3625	250
350	3300049590	Ga0501074_0099957	Ga0501074_0099957_502_1269	250
351	3300049672	Ga0501239_014146	Ga0501239_014146_19_777	250
352	3300049674	Ga0501242_002352	Ga0501242_002352_477_1232	250
353	3300049677	Ga0501247_000670	Ga0501247_000670_138_893	250
354	3300049679	Ga0501249_001352	Ga0501249_001352_251_1006	250
355	3300049741	Ga0501079_0101030	Ga0501079_0101030_667_1434	250
356	3300049742	Ga0501080_0185038	Ga0501080_0185038_392_1159	250
357	3300049744	Ga0501083_0218913	Ga0501083_0218913_229_996	250
358	3300050507	nmdc:mga05p37_218612_c1	nmdc:mga05p37_218612_c1_619_1377	250
359	3300050507	nmdc:mga05p37_41697_c1	nmdc:mga05p37_41697_c1_1306_2064	250
360	3300050507	nmdc:mga05p37_93960_c1	nmdc:mga05p37_93960_c1_642_1400	250
361	3300050508	nmdc:mga09592_1625_c1	nmdc:mga09592_1625_c1_3687_4445	250
362	3300050508	nmdc:mga09592_31860_c1	nmdc:mga09592_31860_c1_1097_1855	250
363	3300050508	nmdc:mga09592_88343_c1	nmdc:mga09592_88343_c1_952_1710	250
364	3300050509	nmdc:mga0qj67_8249_c1	nmdc:mga0qj67_8249_c1_1306_2064	250
365	3300050510	nmdc:mga06r32_2847_c1	nmdc:mga06r32_2847_c1_13234_13992	250
366	3300050510	nmdc:mga06r32_7157_c1	nmdc:mga06r32_7157_c1_8426_9184	250
367	3300050511	nmdc:mga08y16_100758_c1	nmdc:mga08y16_100758_c1_492_1250	250
368	3300050511	nmdc:mga08y16_102496_c1	nmdc:mga08y16_102496_c1_912_1670	250
369	3300050511	nmdc:mga08y16_138362_c1	nmdc:mga08y16_138362_c1_1362_2120	250
370	3300050511	nmdc:mga08y16_146220_c1	nmdc:mga08y16_146220_c1_1357_2112	250
371	3300050511	nmdc:mga08y16_160538_c1	nmdc:mga08y16_160538_c1_530_1288	250
372	3300050511	nmdc:mga08y16_524703_c1	nmdc:mga08y16_524703_c1_78_836	250
373	3300050512	nmdc:mga0n895_664545_c1	nmdc:mga0n895_664545_c1_220_978	250
374	3300053130	Ga0500642_0203854	Ga0500642_0203854_64_822	250
375	3300053134	Ga0500658_0033538	Ga0500658_0033538_626_1384	250
376	3300059421	Ga0590071_045800	Ga0590071_045800_137_895	250
377	3300060353	Ga0501082_0004107	Ga0501082_0004107_8327_9094	250
378	3300061734	Ga0530510_0171894	Ga0530510_0171894_732_1556	250
379	iso_pu_bacteria	2786546517	2787437167	250
380	3300003322	rootL2_10003120	rootL2_100031203	251
381	3300005440	Ga0070705_100447639	Ga0070705_1004476391	251
382	3300005444	Ga0070694_100005509	Ga0070694_1000055091	251
383	3300005545	Ga0070695_100007216	Ga0070695_1000072166	251
384	3300006846	Ga0075430_100017628	Ga0075430_1000176285	251
385	3300006852	Ga0075433_10275482	Ga0075433_102754822	251
386	3300009094	Ga0111539_10641790	Ga0111539_106417902	251
387	3300014325	Ga0163163_10030757	Ga0163163_100307573	251
388	3300025940	Ga0207691_10118479	Ga0207691_101184792	251
389	3300031241	Ga0265325_10046400	Ga0265325_100464001	251
390	3300031247	Ga0265340_10006029	Ga0265340_100060298	251
391	3300031548	Ga0307408_100187737	Ga0307408_1001877372	251
392	3300032005	Ga0307411_10092055	Ga0307411_100920553	251
393	3300042876	Ga0451577_0153241	Ga0451577_0153241_53_811	251
394	3300049576	Ga0501040_0189457	Ga0501040_0189457_324_1079	251
395	3300049578	Ga0501042_0162413	Ga0501042_0162413_77_832	251
396	3300049586	Ga0501070_0424402	Ga0501070_0424402_32_787	251
397	3300049743	Ga0501081_0091995	Ga0501081_0091995_132_887	251
398	3300050508	nmdc:mga09592_31339_c2	nmdc:mga09592_31339_c2_1998_2774	251
399	3300050509	nmdc:mga0qj67_68988_c1	nmdc:mga0qj67_68988_c1_706_1482	251
400	3300050510	nmdc:mga06r32_407466_c1	nmdc:mga06r32_407466_c1_145_918	251
401	3300013296	Ga0157374_10404264	Ga0157374_104042642	252
402	3300025981	Ga0207640_10500334	Ga0207640_105003341	252
403	3300032126	Ga0307415_100008438	Ga0307415_1000084385	252
404	3300044693	Ga0466961_0129064	Ga0466961_0129064_158_949	252
405	3300001979	JGI24740J21852_10027960	JGI24740J21852_100279602	253
406	3300003354	JGI25160J50197_1002547	JGI25160J50197_10025474	253
407	3300005354	Ga0070675_100632048	Ga0070675_1006320481	253
408	3300005365	Ga0070688_100340649	Ga0070688_1003406491	253
409	3300005459	Ga0068867_100115719	Ga0068867_1001157192	253
410	3300005618	Ga0068864_100333496	Ga0068864_1003334962	253
411	3300013102	Ga0157371_10190856	Ga0157371_101908562	253
412	3300013105	Ga0157369_10196256	Ga0157369_101962562	253
413	3300013105	Ga0157369_10395534	Ga0157369_103955342	253
414	3300013307	Ga0157372_10005609	Ga0157372_100056092	253
415	3300013307	Ga0157372_10061957	Ga0157372_100619574	253
416	3300013307	Ga0157372_10187443	Ga0157372_101874431	253
417	3300013307	Ga0157372_10409740	Ga0157372_104097402	253
418	3300013307	Ga0157372_10873525	Ga0157372_108735251	253
419	3300013308	Ga0157375_10378814	Ga0157375_103788142	253
420	3300014969	Ga0157376_10523060	Ga0157376_105230601	253
421	3300017792	Ga0163161_10130590	Ga0163161_101305902	253
422	3300025302	Ga0207426_1000019	Ga0207426_1000019130	253
423	3300025921	Ga0207652_10168520	Ga0207652_101685202	253
424	3300026089	Ga0207648_10129146	Ga0207648_101291462	253
425	3300026089	Ga0207648_10382627	Ga0207648_103826272	253
426	3300026095	Ga0207676_10129502	Ga0207676_101295021	253
427	3300026116	Ga0207674_10226065	Ga0207674_102260653	253
428	3300026121	Ga0207683_10449090	Ga0207683_104490902	253
429	3300026142	Ga0207698_10086832	Ga0207698_100868322	253
430	3300026142	Ga0207698_10416028	Ga0207698_104160282	253
431	3300026142	Ga0207698_10725657	Ga0207698_107256571	253
432	3300031251	Ga0265327_10041529	Ga0265327_100415292	253
433	3300049571	Ga0501034_0510490	Ga0501034_0510490_20_802	253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

37

284

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4y8f-assembly1.cif.gz_A-2	crystal structure of triosephosphate isomerase from clostridium perfringens	0.9747	1	250
5cg7-assembly2.cif.gz_B-3	error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/5cg7	0.9709	2	253
5zg4-assembly2.cif.gz_C	crystal structure of triosephosphate isomerase sad deletion mutant from opisthorchis viverrini	0.9687	2	251
6nlh-assembly4.cif.gz_H	structure of human triose phosphate isomerase r189a	0.9686	3	253
2vom-assembly2.cif.gz_D	structural basis of human triosephosphate isomerase deficiency. mutation e104d and correlation to solvent perturbation.	0.9685	2	249

ID	Description	Score	Start	End	Superfamily
af_A0A1D6MQG5_2_109_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9805	162	251	3.20.20.70
af_A0A1D6KAX1_115_218_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9778	162	241	3.20.20.70
af_P17751_41_299_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9701	42	251	3.20.20.70
af_Q4DV43_1_251_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9662	2	253	3.20.20.70
4y96A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.966	1	251	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A5J4PGR7-F1-model_v4	Triosephosphate isomerase (EC 5.3.1.1)	0.9949	93	253	GO:0004807 GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166
AF-A0A1V9E4G5-F1-model_v4	Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase)	0.9933	1	253	GO:0004807 GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166
AF-A0A327QFA2-F1-model_v4	Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase)	0.9928	1	252	GO:0004807 GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166
AF-A0A4Q3W8J7-F1-model_v4	Triosephosphate isomerase (EC 5.3.1.1)	0.992	1	194	GO:0004807 GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166
AF-A0A6J7TMM2-F1-model_v4	Unannotated protein	0.991	84	250	GO:0004807 GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166

Feature Viewer

pLDDT	pTM	Quality
95.46	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442882

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00121

TIM

Triosephosphate isomerase

37

284

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map