F442908

General Info

Members Datasets Scaffolds Average Seq Length
433 277 866 322

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0000012|Ga0451576_0000012_326317_327459
Length 380
Sequence MPDFCHQLKKYLCTMKQHDMEPEEESEAGEQELYEHYRFTVDGGQSMLRIDKYLLNKMEGVSRTRIQAAADAGSILVNGKPAKSSYKVKPHDVVVIVLPHPPRVIELIPQDIPIDIVYEDDDVILVNKPPGLVVHPGYGNYSGTLMNAMLYHFKQLPKYSDDMRPGLLHRIDKNTSGLMILAKSERALNKLAVQFFDHSIDRVYNALVWGDFKEDSGTITGHLDRSRHDRKIRAVYPDGLQGKHAVTHWKVLERFGYVTLVQCKLETGRTHQIRVHMQYIGHPLFNDHEYGGDRIVKGTTHQKYKQFIENCFALCPRQALHARTLGFIHPNGQRMDFEVPVPDDMLAVMDKWRKYTQGSTFKNVEEELGENEVDFPNGKK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
213 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
216 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
217 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
223 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
224 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
236 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
237 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
242 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
243 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
244 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
245 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
246 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
247 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
248 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
249 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
250 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
251 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
252 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
253 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
254 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
255 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
256 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
257 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
258 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
259 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
260 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
261 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
262 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
263 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
264 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
265 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
266 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
267 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
268 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
269 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
270 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
271 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
272 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
273 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
274 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
275 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
276 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
277 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.45
Metatranscriptomes 0
Isolates 8.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 1.15
Rhizoplane 2.77
Rhizosphere 83.37
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0000012 3300045051 Bacteria 674684
2 SwRhRL2b_contig_1919535 2162886007 Bacteria 2004
3 SwRhRL2b_contig_211656 2162886007 Bacteria 2199
4 SwRhRL2b_contig_3776203 2162886007 Bacteria 6234
5 JGI24736J21556_1005152 3300001904 Bacteria 2212
6 JGI24741J21665_1000011 3300001915 Bacteria 41868
7 JGI24740J21852_10002185 3300001979 Bacteria 8942
8 JGI24737J22298_10003301 3300001990 Bacteria 5713
9 JGI24735J21928_10002310 3300002067 Bacteria 6650
10 Ga0065714_10074642 3300005288 Bacteria 3010
11 Ga0065714_10095507 3300005288 Bacteria 1785
12 Ga0065704_10072307 3300005289 Bacteria 8765
13 Ga0065704_10094789 3300005289 Bacteria 2524
14 Ga0065704_10124164 3300005289 Bacteria 1711
15 Ga0065715_10122570 3300005293 Bacteria 2201
16 Ga0070676_10020262 3300005328 Bacteria 3710
17 Ga0070683_100003945 3300005329 Bacteria 12140
18 Ga0070683_100179128 3300005329 Bacteria 2012
19 Ga0070690_100002980 3300005330 Bacteria 9168
20 Ga0068868_100037545 3300005338 Bacteria 3756
21 Ga0070660_100120376 3300005339 Bacteria 2095
22 Ga0070689_100012137 3300005340 Bacteria 6196
23 Ga0070661_100009696 3300005344 Bacteria 6679
24 Ga0070692_10011480 3300005345 Bacteria 4068
25 Ga0070668_100005056 3300005347 Bacteria 9764
26 Ga0070669_100010713 3300005353 Bacteria 6506
27 Ga0070671_100158903 3300005355 Bacteria 1910
28 Ga0070674_100009050 3300005356 Bacteria 5951
29 Ga0070673_100006401 3300005364 Bacteria 7654
30 Ga0070673_100115730 3300005364 Bacteria 2230
31 Ga0070673_100180481 3300005364 Bacteria 1807
32 Ga0070659_100045684 3300005366 Bacteria 3431
33 Ga0070659_100059702 3300005366 Bacteria 3011
34 Ga0070667_100000062 3300005367 Bacteria 143729
35 Ga0070667_100268789 3300005367 Bacteria 1528
36 Ga0070709_10273419 3300005434 Bacteria 1225
37 Ga0070701_10082750 3300005438 Bacteria 1741
38 Ga0070700_100019878 3300005441 Bacteria 3881
39 Ga0070663_100036643 3300005455 Bacteria 3408
40 Ga0070678_100130170 3300005456 Bacteria 1998
41 Ga0070662_100106144 3300005457 Bacteria 2133
42 Ga0068867_100158222 3300005459 Bacteria 1785
43 Ga0070684_100007676 3300005535 Bacteria 8411
44 Ga0068853_100128883 3300005539 Bacteria 2263
45 Ga0070672_100045395 3300005543 Bacteria 3398
46 Ga0070672_100083527 3300005543 Bacteria 2563
47 Ga0070686_100015343 3300005544 Bacteria 4435
48 Ga0070686_100068078 3300005544 Bacteria 2322
49 Ga0070665_100176169 3300005548 Bacteria 2139
50 Ga0068855_100020173 3300005563 Bacteria 8004
51 Ga0070664_100008957 3300005564 Bacteria 8115
52 Ga0068856_100061277 3300005614 Bacteria 3716
53 Ga0068856_100209853 3300005614 Bacteria 1963
54 Ga0068859_100171159 3300005617 Unclassified 2253
55 Ga0068859_100196292 3300005617 Bacteria 2103
56 Ga0068864_100192402 3300005618 Bacteria 1871
57 Ga0068866_10143702 3300005718 Bacteria 1373
58 Ga0068861_100001813 3300005719 Bacteria 13764
59 Ga0068851_10023367 3300005834 Bacteria 3021
60 Ga0068863_100000054 3300005841 Bacteria 124495
61 Ga0068863_100140272 3300005841 Bacteria 2310
62 Ga0068858_100062527 3300005842 Bacteria 3442
63 Ga0068860_100007815 3300005843 Bacteria 10678
64 Ga0068860_100016315 3300005843 Bacteria 7242
65 Ga0068862_100070159 3300005844 Bacteria 3025
66 Ga0081455_10129839 3300005937 Bacteria 1972
67 Ga0070717_10503549 3300006028 Bacteria 1094
68 Ga0075370_10106639 3300006353 Bacteria 1625
69 Ga0068871_100001400 3300006358 Bacteria 16139
70 Ga0075429_100260821 3300006880 Bacteria 1517
71 Ga0097620_100171172 3300006931 Unclassified 2253
72 Ga0097620_100196287 3300006931 Bacteria 2103
73 Ga0099824_1004056 3300006942 Bacteria 21192
74 Ga0079104_1000061 3300006946 Bacteria 161057
75 Ga0099826_10035207 3300006948 Bacteria 3564
76 Ga0105251_10040416 3300009011 Bacteria 2274
77 Ga0105244_10000278 3300009036 Bacteria 51394
78 Ga0111539_10007333 3300009094 Bacteria 14123
79 Ga0114129_10264675 3300009147 Bacteria 2302
80 Ga0105241_10007612 3300009174 Bacteria 7960
81 Ga0105237_10015295 3300009545 Bacteria 7993
82 Ga0105249_10002016 3300009553 Bacteria 17643
83 Ga0105148_100258 3300009978 Bacteria 7178
84 Ga0157373_10000014 3300013100 Bacteria 185079
85 Ga0157371_10004357 3300013102 Bacteria 12393
86 Ga0157371_10054078 3300013102 Bacteria 2852
87 Ga0157370_10000393 3300013104 Bacteria 54961
88 Ga0157370_10002621 3300013104 Bacteria 21633
89 Ga0157370_10005927 3300013104 Bacteria 13618
90 Ga0157370_10030786 3300013104 Bacteria 5256
91 Ga0157370_10041849 3300013104 Bacteria 4417
92 Ga0157369_10007299 3300013105 Bacteria 12723
93 Ga0157369_10091168 3300013105 Bacteria 3254
94 Ga0157369_10112164 3300013105 Bacteria 2897
95 Ga0163162_10017317 3300013306 Bacteria 7050
96 Ga0163162_10091861 3300013306 Bacteria 3119
97 Ga0157372_10057886 3300013307 Bacteria 4332
98 Ga0157372_10103678 3300013307 Bacteria 3250
99 Ga0157375_10110721 3300013308 Bacteria 2843
100 Ga0157377_10162926 3300014745 Bacteria 1388
101 Ga0182006_1010486 3300015261 Bacteria 4118
102 Ga0163161_10000176 3300017792 Bacteria 58967
103 Ga0163161_10021136 3300017792 Bacteria 4575
104 Ga0163161_10070961 3300017792 Bacteria 2548
105 Ga0163161_10253069 3300017792 Bacteria 1373
106 Ga0209147_101181 3300025229 Bacteria 10615
107 Ga0209455_1005601 3300025272 Bacteria 3850
108 Ga0207655_1000008 3300025728 Bacteria 734289
109 Ga0207642_10113121 3300025899 Bacteria 1386
110 Ga0207647_10018423 3300025904 Bacteria 4722
111 Ga0207645_10006785 3300025907 Bacteria 8174
112 Ga0207707_10313107 3300025912 Bacteria 1356
113 Ga0207695_10128835 3300025913 Bacteria 2489
114 Ga0207649_10130964 3300025920 Bacteria 1703
115 Ga0207681_10001474 3300025923 Bacteria 15164
116 Ga0207681_10051669 3300025923 Bacteria 2785
117 Ga0207694_10034586 3300025924 Bacteria 3875
118 Ga0207659_10208251 3300025926 Bacteria 1566
119 Ga0207644_10032286 3300025931 Bacteria 3652
120 Ga0207690_10046505 3300025932 Bacteria 2875
121 Ga0207706_10123415 3300025933 Bacteria 2278
122 Ga0207670_10036284 3300025936 Bacteria 3204
123 Ga0207669_10001928 3300025937 Bacteria 8794
124 Ga0207704_10003164 3300025938 Bacteria 7447
125 Ga0207689_10034633 3300025942 Bacteria 4193
126 Ga0207689_10051347 3300025942 Bacteria 3399
127 Ga0207661_10016980 3300025944 Bacteria 5376
128 Ga0207661_10346769 3300025944 Bacteria 1339
129 Ga0207667_10097395 3300025949 Bacteria 3036
130 Ga0207651_10004122 3300025960 Bacteria 7259
131 Ga0207651_10012569 3300025960 Bacteria 4799
132 Ga0207651_10054050 3300025960 Bacteria 2749
133 Ga0207668_10001375 3300025972 Bacteria 14333
134 Ga0207668_10043765 3300025972 Bacteria 3041
135 Ga0207668_10044141 3300025972 Bacteria 3030
136 Ga0207658_10000039 3300025986 Bacteria 143707
137 Ga0207658_10142962 3300025986 Bacteria 1939
138 Ga0207658_10180845 3300025986 Bacteria 1745
139 Ga0207639_10002664 3300026041 Bacteria 11983
140 Ga0207678_10004956 3300026067 Bacteria 11953
141 Ga0207702_10008432 3300026078 Bacteria 8693
142 Ga0207702_10175039 3300026078 Bacteria 1971
143 Ga0207641_10000095 3300026088 Bacteria 124498
144 Ga0207641_10098429 3300026088 Bacteria 2572
145 Ga0207648_10020917 3300026089 Bacteria 5891
146 Ga0207676_10171859 3300026095 Bacteria 1889
147 Ga0207674_10062979 3300026116 Bacteria 3745
148 Ga0207675_100042508 3300026118 Bacteria 4244
149 Ga0207698_10005940 3300026142 Bacteria 7583
150 Ga0209281_1000561 3300027111 Bacteria 45012
151 Ga0209282_1029634 3300027666 Bacteria 3376
152 Ga0268264_10003143 3300028381 Bacteria 14302
153 Ga0268264_10003566 3300028381 Bacteria 13397
154 Ga0265334_10014646 3300028573 Unclassified 3267
155 Ga0265318_10037504 3300028577 Bacteria 1856
156 Ga0265336_10009898 3300028666 Bacteria 3280
157 Ga0265338_10001492 3300028800 Bacteria 37897
158 Ga0265338_10017243 3300028800 Bacteria 7799
159 Ga0265332_10000865 3300031238 Bacteria 18356
160 Ga0265332_10015551 3300031238 Bacteria 3360
161 Ga0265320_10000954 3300031240 Bacteria 21540
162 Ga0265320_10006836 3300031240 Bacteria 7147
163 Ga0265320_10030345 3300031240 Bacteria 2788
164 Ga0265329_10000316 3300031242 Bacteria 25681
165 Ga0265339_10004144 3300031249 Bacteria 9980
166 Ga0265339_10020388 3300031249 Bacteria 3874
167 Ga0265327_10002375 3300031251 Bacteria 20034
168 Ga0265327_10038776 3300031251 Unclassified 2596
169 Ga0265316_10024119 3300031344 Bacteria 5105
170 Ga0265316_10072647 3300031344 Bacteria 2650
171 Ga0307408_100005466 3300031548 Bacteria 8502
172 Ga0307408_100047158 3300031548 Bacteria 3084
173 Ga0316575_10018167 3300031665 Bacteria 2678
174 Ga0265314_10014319 3300031711 Bacteria 6356
175 Ga0265314_10032349 3300031711 Bacteria 3848
176 Ga0265314_10065613 3300031711 Bacteria 2451
177 Ga0265342_10000539 3300031712 Bacteria 40314
178 Ga0265342_10002567 3300031712 Bacteria 15576
179 Ga0265342_10013105 3300031712 Bacteria 5577
180 Ga0265342_10045829 3300031712 Bacteria 2630
181 Ga0316578_10008185 3300031728 Bacteria 5302
182 Ga0316578_10014622 3300031728 Bacteria 4198
183 Ga0307405_10000101 3300031731 Bacteria 35360
184 Ga0307405_10083888 3300031731 Bacteria 2090
185 Ga0316577_10045469 3300031733 Unclassified 2454
186 Ga0316577_10081581 3300031733 Bacteria 1808
187 Ga0307413_10000058 3300031824 Bacteria 28566
188 Ga0307410_10000351 3300031852 Bacteria 17845
189 Ga0307406_10000322 3300031901 Bacteria 27838
190 Ga0307406_10066395 3300031901 Bacteria 2348
191 Ga0307407_10003153 3300031903 Bacteria 6676
192 Ga0307412_10060626 3300031911 Bacteria 2540
193 Ga0307416_100001260 3300032002 Bacteria 13644
194 Ga0307414_10000001 3300032004 Bacteria 1352954
195 Ga0307414_10034283 3300032004 Bacteria 3363
196 Ga0307414_10078817 3300032004 Bacteria 2402
197 Ga0307414_10085288 3300032004 Bacteria 2326
198 Ga0307411_10000005 3300032005 Bacteria 391311
199 Ga0307411_10122748 3300032005 Bacteria 1883
200 Ga0373950_0000004 3300034818 Bacteria 527382
201 Ga0373950_0000032 3300034818 Bacteria 159066
202 Ga0373956_0013653 3300035119 Bacteria 3381
203 Ga0373956_0047246 3300035119 Bacteria 1925
204 Ga0373957_0026033 3300035120 Bacteria 2113
205 Ga0373957_0039434 3300035120 Bacteria 1771
206 Ga0373955_0006962 3300035172 Bacteria 5174
207 Ga0373955_0018591 3300035172 Bacteria 3460
208 Ga0373955_0128131 3300035172 Bacteria 1480
209 Ga0316574_0093650 3300035398 Bacteria 1918
210 Ga0316574_0170774 3300035398 Bacteria 1400
211 Ga0316574_0194020 3300035398 Bacteria 1305
212 Ga0373933_0007173 3300035724 Bacteria 6073
213 Ga0373947_0231253 3300035725 Bacteria 1218
214 Ga0373937_0005185 3300036401 Bacteria 11120
215 Ga0373937_0012484 3300036401 Bacteria 7475
216 Ga0373937_0269613 3300036401 Bacteria 1606
217 Ga0373937_0271552 3300036401 Bacteria 1601
218 Ga0316582_0004727 3300036647 Archaea 6933
219 Ga0316584_0056077 3300036712 Unclassified 2950
220 Ga0316584_0098483 3300036712 Bacteria 2189
221 Ga0373925_0121885 3300037068 Bacteria 2025
222 Ga0395905_0365773 3300037471 Bacteria 1335
223 Ga0395901_0052276 3300038443 Bacteria 4246
224 Ga0400490_50830 3300038726 Bacteria 40738
225 Ga0436365_1194866 3300039437 Bacteria 3696
226 Ga0439447_002357 3300041407 Bacteria 6907
227 Ga0439466_0021613 3300041411 Bacteria 2277
228 Ga0439466_0041800 3300041411 Bacteria 1528
229 Ga0451855_0509811 3300041511 Bacteria 2341
230 Ga0451577_0000027 3300042876 Bacteria 397014
231 Ga0451577_0000043 3300042876 Bacteria 329533
232 Ga0451577_0000715 3300042876 Bacteria 51599
233 Ga0451577_0025597 3300042876 Bacteria 5352
234 Ga0451577_0030628 3300042876 Bacteria 4860
235 Ga0451577_0061838 3300042876 Bacteria 3339
236 Ga0451577_0073931 3300042876 Bacteria 3041
237 Ga0451577_0129344 3300042876 Bacteria 2265
238 Ga0451577_0147089 3300042876 Bacteria 2119
239 Ga0451577_0163182 3300042876 Bacteria 2007
240 Ga0451577_0523208 3300042876 Bacteria 1077
241 Ga0466972_0045374 3300044658 Bacteria 2131
242 Ga0453683_0000010 3300044673 Bacteria 470890
243 Ga0453683_0000133 3300044673 Bacteria 108537
244 Ga0453683_0000317 3300044673 Bacteria 59908
245 Ga0453683_0029483 3300044673 Unclassified 3469
246 Ga0453683_0052473 3300044673 Bacteria 2553
247 Ga0453683_0103296 3300044673 Bacteria 1790
248 Ga0453683_0152131 3300044673 Bacteria 1462
249 Ga0453683_0207677 3300044673 Bacteria 1244
250 Ga0453683_0219804 3300044673 Bacteria 1208
251 Ga0453684_0000133 3300044712 Bacteria 329529
252 Ga0453684_0000154 3300044712 Bacteria 305062
253 Ga0453684_0000167 3300044712 Bacteria 290200
254 Ga0453684_0000199 3300044712 Bacteria 264155
255 Ga0453684_0000527 3300044712 Bacteria 146072
256 Ga0453684_0001607 3300044712 Bacteria 62127
257 Ga0453684_0004950 3300044712 Bacteria 27152
258 Ga0453684_0005376 3300044712 Bacteria 25454
259 Ga0453684_0010412 3300044712 Bacteria 15911
260 Ga0453684_0079552 3300044712 Bacteria 4097
261 Ga0453684_0193447 3300044712 Bacteria 2377
262 Ga0453684_0244742 3300044712 Bacteria 2063
263 Ga0453684_0279461 3300044712 Unclassified 1905
264 Ga0453684_0449306 3300044712 Bacteria 1435
265 Ga0451576_0000032 3300045051 Bacteria 397014
266 Ga0451576_0000211 3300045051 Bacteria 146199
267 Ga0451576_0000365 3300045051 Bacteria 108399
268 Ga0451576_0007843 3300045051 Bacteria 12651
269 Ga0451576_0009120 3300045051 Bacteria 11534
270 Ga0451576_0011404 3300045051 Bacteria 10102
271 Ga0451576_0029010 3300045051 Bacteria 5923
272 Ga0451576_0030100 3300045051 Bacteria 5805
273 Ga0451576_0067661 3300045051 Bacteria 3718
274 Ga0451576_0072498 3300045051 Bacteria 3584
275 Ga0451576_0083609 3300045051 Bacteria 3320
276 Ga0451576_0154115 3300045051 Bacteria 2396
277 Ga0495627_001604 3300046453 Bacteria 12649
278 Ga0495638_0000274 3300046460 Bacteria 69822
279 Ga0495641_0126632 3300046461 Bacteria 1140
280 Ga0495650_0001387 3300046471 Bacteria 23825
281 Ga0495664_0018311 3300046477 Bacteria 4011
282 Ga0495583_0000373 3300046506 Bacteria 69685
283 Ga0495610_0000095 3300046512 Bacteria 104629
284 Ga0495616_0000040 3300046513 Bacteria 122596
285 Ga0495616_0028974 3300046513 Bacteria 2927
286 Ga0495628_0057797 3300046516 Bacteria 3051
287 Ga0495632_0000957 3300046519 Bacteria 25235
288 Ga0495632_0005498 3300046519 Bacteria 8363
289 Ga0495637_0001877 3300046520 Bacteria 11992
290 Ga0495643_0000014 3300046522 Bacteria 314632
291 Ga0495643_0002021 3300046522 Bacteria 16911
292 Ga0495648_0000195 3300046524 Bacteria 69940
293 Ga0495648_0004846 3300046524 Bacteria 11359
294 Ga0495663_0000007 3300046525 Bacteria 262438
295 Ga0495633_0000276 3300046558 Bacteria 59784
296 Ga0495633_0010577 3300046558 Bacteria 5028
297 Ga0495633_0010775 3300046558 Bacteria 4971
298 Ga0495633_0035054 3300046558 Bacteria 2411
299 Ga0495634_0007961 3300046642 Bacteria 7907
300 Ga0495625_0002836 3300046660 Bacteria 18211
301 Ga0495671_0000032 3300046692 Bacteria 201185
302 Ga0495671_0000125 3300046692 Bacteria 70115
303 Ga0495674_0003892 3300047319 Bacteria 14497
304 Ga0495680_0057432 3300047322 Bacteria 3010
305 Ga0495673_0000275 3300047469 Bacteria 70004
306 Ga0495686_0018357 3300047472 Bacteria 4696
307 Ga0495686_0058855 3300047472 Bacteria 2394
308 Ga0496101_0118965 3300048904 Bacteria 1996
309 Ga0496104_0021672 3300048907 Bacteria 5901
310 Ga0496105_0138418 3300048908 Bacteria 2004
311 Ga0496108_0019743 3300048911 Bacteria 5536
312 Ga0496109_0149934 3300048912 Bacteria 2183
313 Ga0496110_0045722 3300048913 Bacteria 3828
314 Ga0496110_0065826 3300048913 Bacteria 3204
315 Ga0496113_0022338 3300048916 Bacteria 4473
316 Ga0496114_0000569 3300048917 Bacteria 27315
317 Ga0496114_0002401 3300048917 Bacteria 14271
318 Ga0496114_0014536 3300048917 Bacteria 6323
319 Ga0496115_0011732 3300048918 Bacteria 6580
320 Ga0496116_0000041 3300048919 Bacteria 343299
321 Ga0496117_0008980 3300048920 Bacteria 9407
322 Ga0496117_0107687 3300048920 Bacteria 1745
323 Ga0496118_0045118 3300048921 Bacteria 3445
324 Ga0496119_0040115 3300048922 Bacteria 2999
325 Ga0496121_0006468 3300048924 Bacteria 14526
326 Ga0496121_0016608 3300048924 Bacteria 7587
327 Ga0496121_0192658 3300048924 Bacteria 1460
328 Ga0496123_0101331 3300048926 Bacteria 1674
329 Ga0496124_0043667 3300048927 Bacteria 3852
330 Ga0496125_0000026 3300048928 Bacteria 397380
331 Ga0496125_0000483 3300048928 Bacteria 70302
332 Ga0496125_0011263 3300048928 Bacteria 8963
333 Ga0496125_0014323 3300048928 Bacteria 7727
334 Ga0496126_0003880 3300048929 Bacteria 18417
335 Ga0496126_0027480 3300048929 Bacteria 5433
336 Ga0501034_0000009 3300049571 Bacteria 336590
337 Ga0501036_0212704 3300049572 Bacteria 1624
338 Ga0501043_0008101 3300049579 Bacteria 8293
339 Ga0501043_0161915 3300049579 Bacteria 1748
340 Ga0501046_0004139 3300049580 Bacteria 13215
341 Ga0501047_0000006 3300049581 Bacteria 455727
342 Ga0501048_0021287 3300049582 Bacteria 4748
343 Ga0501067_0000338 3300049583 Bacteria 25522
344 Ga0501067_0082961 3300049583 Bacteria 1778
345 Ga0501069_0009947 3300049585 Bacteria 5029
346 Ga0501069_0021037 3300049585 Bacteria 3538
347 Ga0501070_0000488 3300049586 Bacteria 36056
348 Ga0501070_0001257 3300049586 Bacteria 22719
349 Ga0501072_0000118 3300049588 Bacteria 59270
350 Ga0501073_0000296 3300049589 Bacteria 32778
351 Ga0501073_0013476 3300049589 Bacteria 5946
352 Ga0501073_0038463 3300049589 Bacteria 3393
353 Ga0501073_0060937 3300049589 Bacteria 2633
354 Ga0501073_0061635 3300049589 Bacteria 2617
355 Ga0501074_0004542 3300049590 Bacteria 9935
356 Ga0501074_0072607 3300049590 Bacteria 2472
357 Ga0501211_003031 3300049658 Bacteria 1748
358 Ga0501223_000012 3300049663 Bacteria 75953
359 Ga0501235_006962 3300049669 Bacteria 2459
360 Ga0501235_015539 3300049669 Bacteria 1678
361 Ga0501238_000336 3300049671 Bacteria 6098
362 Ga0501249_000033 3300049679 Bacteria 73096
363 Ga0501249_010690 3300049679 Bacteria 1922
364 Ga0501256_001204 3300049685 Bacteria 1862
365 Ga0501225_0000264 3300049705 Bacteria 16586
366 Ga0501225_0022178 3300049705 Bacteria 1753
367 Ga0501225_0038234 3300049705 Bacteria 1322
368 Ga0501079_0000040 3300049741 Bacteria 56270
369 Ga0501080_0168479 3300049742 Bacteria 2021
370 Ga0501080_0184402 3300049742 Bacteria 1919
371 Ga0501080_0330502 3300049742 Bacteria 1378
372 Ga0501083_0001131 3300049744 Bacteria 17867
373 Ga0501083_0001267 3300049744 Bacteria 17113
374 Ga0501264_004556 3300049761 Bacteria 1258
375 Ga0501266_000007 3300049763 Bacteria 291751
376 Ga0501280_000405 3300049776 Bacteria 10361
377 Ga0501035_0064973 3300049822 Bacteria 3242
378 nmdc:mga05p37_378559_c1 3300050507 Bacteria 1659
379 nmdc:mga09592_253366_c1 3300050508 Bacteria 1526
380 Ga0500643_001166 3300053087 Bacteria 15674
381 Ga0500647_0031672 3300053091 Bacteria 2517
382 Ga0500641_0000006 3300053096 Bacteria 223991
383 Ga0500641_0000139 3300053096 Bacteria 26945
384 Ga0500641_0047189 3300053096 Bacteria 1760
385 Ga0500562_002400 3300053108 Bacteria 4702
386 Ga0500618_003031 3300053125 Bacteria 5967
387 Ga0500658_0000013 3300053134 Bacteria 153702
388 Ga0500559_0004827 3300053136 Bacteria 6295
389 Ga0500559_0017794 3300053136 Bacteria 3005
390 Ga0500624_000589 3300053157 Bacteria 9978
391 Ga0500627_0000426 3300053158 Bacteria 11396
392 Ga0500584_004540 3300053726 Bacteria 5710
393 Ga0501084_0000019 3300054114 Bacteria 146907
394 Ga0500661_000193 3300055283 Bacteria 10729
395 Ga0501082_0000385 3300060353 Bacteria 39072
396 Ga0501082_0116355 3300060353 Bacteria 2315
397 2512641952 2512564014 Bacteria 4639632
398 2513235097 2513020052 Bacteria 5120511
399 2520878639 2519899754 Bacteria 5336938
400 2644011588 2643221600 Bacteria 5530138
401 2644369981 2643221667 Bacteria 5627472
402 2644642175 2643221716 Bacteria 4986332
403 2644685399 2643221725 Bacteria 5087956
404 2738737033 2738541279 Bacteria 6149495
405 2738769573 2738541285 Bacteria 6150075
406 2739218615 2738543007 Bacteria 6149845
407 2740000668 2739367857 Bacteria 5433684
408 2740005484 2739367858 Bacteria 5432813
409 2740032424 2739367866 Bacteria 4215900
410 2778124182 2775507255 Bacteria 3945731
411 2802653568 2802428842 Bacteria 4926114
412 2817415668 2816332280 Bacteria 5109718
413 2857614435 2857613821 Bacteria 4917088
414 2857619203 2857618242 Bacteria 5635925
415 2881250778 2881247448 Bacteria 3717788
416 2881362502 2881359912 Bacteria 4935907
417 2903898481 2903895155 Bacteria 5258610
418 2904419722 2904419702 Bacteria 5166287
419 2904556503 2904555929 Bacteria 5218588
420 2910246040 2910245624 Bacteria 6935613
421 2919193096 2919191525 Bacteria 5765973
422 2919512397 2919509842 Bacteria 4104664
423 2919687853 2919683626 Bacteria 5534354
424 2919711550 2919709256 Bacteria 4318106
425 2929152934 2929150217 Bacteria 5462483
426 2958462759 2958458903 Bacteria 5301041
427 2958513222 2958512119 Bacteria 4528530
428 2965323315 2965320100 Bacteria 3975600
429 2977269601 2977268062 Bacteria 5243061
430 8054308333 8054307821 Bacteria 5212224
431 8055421367 8055419101 Bacteria 5289643
432 8055594165 8055592153 Bacteria 5961247
433 8056443900 8056440228 Bacteria 4946504
434 Ga0451576_0000012
435 SwRhRL2b_contig_1919535
436 SwRhRL2b_contig_211656
437 SwRhRL2b_contig_3776203
438 JGI24736J21556_1005152
439 JGI24741J21665_1000011
440 JGI24740J21852_10002185
441 JGI24737J22298_10003301
442 JGI24735J21928_10002310
443 Ga0065714_10074642
444 Ga0065714_10095507
445 Ga0065704_10072307
446 Ga0065704_10094789
447 Ga0065704_10124164
448 Ga0065715_10122570
449 Ga0070676_10020262
450 Ga0070683_100003945
451 Ga0070683_100179128
452 Ga0070690_100002980
453 Ga0068868_100037545
454 Ga0070660_100120376
455 Ga0070689_100012137
456 Ga0070661_100009696
457 Ga0070692_10011480
458 Ga0070668_100005056
459 Ga0070669_100010713
460 Ga0070671_100158903
461 Ga0070674_100009050
462 Ga0070673_100006401
463 Ga0070673_100115730
464 Ga0070673_100180481
465 Ga0070659_100045684
466 Ga0070659_100059702
467 Ga0070667_100000062
468 Ga0070667_100268789
469 Ga0070709_10273419
470 Ga0070701_10082750
471 Ga0070700_100019878
472 Ga0070663_100036643
473 Ga0070678_100130170
474 Ga0070662_100106144
475 Ga0068867_100158222
476 Ga0070684_100007676
477 Ga0068853_100128883
478 Ga0070672_100045395
479 Ga0070672_100083527
480 Ga0070686_100015343
481 Ga0070686_100068078
482 Ga0070665_100176169
483 Ga0068855_100020173
484 Ga0070664_100008957
485 Ga0068856_100061277
486 Ga0068856_100209853
487 Ga0068859_100171159
488 Ga0068859_100196292
489 Ga0068864_100192402
490 Ga0068866_10143702
491 Ga0068861_100001813
492 Ga0068851_10023367
493 Ga0068863_100000054
494 Ga0068863_100140272
495 Ga0068858_100062527
496 Ga0068860_100007815
497 Ga0068860_100016315
498 Ga0068862_100070159
499 Ga0081455_10129839
500 Ga0070717_10503549
501 Ga0075370_10106639
502 Ga0068871_100001400
503 Ga0075429_100260821
504 Ga0097620_100171172
505 Ga0097620_100196287
506 Ga0099824_1004056
507 Ga0079104_1000061
508 Ga0099826_10035207
509 Ga0105251_10040416
510 Ga0105244_10000278
511 Ga0111539_10007333
512 Ga0114129_10264675
513 Ga0105241_10007612
514 Ga0105237_10015295
515 Ga0105249_10002016
516 Ga0105148_100258
517 Ga0157373_10000014
518 Ga0157371_10004357
519 Ga0157371_10054078
520 Ga0157370_10000393
521 Ga0157370_10002621
522 Ga0157370_10005927
523 Ga0157370_10030786
524 Ga0157370_10041849
525 Ga0157369_10007299
526 Ga0157369_10091168
527 Ga0157369_10112164
528 Ga0163162_10017317
529 Ga0163162_10091861
530 Ga0157372_10057886
531 Ga0157372_10103678
532 Ga0157375_10110721
533 Ga0157377_10162926
534 Ga0182006_1010486
535 Ga0163161_10000176
536 Ga0163161_10021136
537 Ga0163161_10070961
538 Ga0163161_10253069
539 Ga0209147_101181
540 Ga0209455_1005601
541 Ga0207655_1000008
542 Ga0207642_10113121
543 Ga0207647_10018423
544 Ga0207645_10006785
545 Ga0207707_10313107
546 Ga0207695_10128835
547 Ga0207649_10130964
548 Ga0207681_10001474
549 Ga0207681_10051669
550 Ga0207694_10034586
551 Ga0207659_10208251
552 Ga0207644_10032286
553 Ga0207690_10046505
554 Ga0207706_10123415
555 Ga0207670_10036284
556 Ga0207669_10001928
557 Ga0207704_10003164
558 Ga0207689_10034633
559 Ga0207689_10051347
560 Ga0207661_10016980
561 Ga0207661_10346769
562 Ga0207667_10097395
563 Ga0207651_10004122
564 Ga0207651_10012569
565 Ga0207651_10054050
566 Ga0207668_10001375
567 Ga0207668_10043765
568 Ga0207668_10044141
569 Ga0207658_10000039
570 Ga0207658_10142962
571 Ga0207658_10180845
572 Ga0207639_10002664
573 Ga0207678_10004956
574 Ga0207702_10008432
575 Ga0207702_10175039
576 Ga0207641_10000095
577 Ga0207641_10098429
578 Ga0207648_10020917
579 Ga0207676_10171859
580 Ga0207674_10062979
581 Ga0207675_100042508
582 Ga0207698_10005940
583 Ga0209281_1000561
584 Ga0209282_1029634
585 Ga0268264_10003143
586 Ga0268264_10003566
587 Ga0265334_10014646
588 Ga0265318_10037504
589 Ga0265336_10009898
590 Ga0265338_10001492
591 Ga0265338_10017243
592 Ga0265332_10000865
593 Ga0265332_10015551
594 Ga0265320_10000954
595 Ga0265320_10006836
596 Ga0265320_10030345
597 Ga0265329_10000316
598 Ga0265339_10004144
599 Ga0265339_10020388
600 Ga0265327_10002375
601 Ga0265327_10038776
602 Ga0265316_10024119
603 Ga0265316_10072647
604 Ga0307408_100005466
605 Ga0307408_100047158
606 Ga0316575_10018167
607 Ga0265314_10014319
608 Ga0265314_10032349
609 Ga0265314_10065613
610 Ga0265342_10000539
611 Ga0265342_10002567
612 Ga0265342_10013105
613 Ga0265342_10045829
614 Ga0316578_10008185
615 Ga0316578_10014622
616 Ga0307405_10000101
617 Ga0307405_10083888
618 Ga0316577_10045469
619 Ga0316577_10081581
620 Ga0307413_10000058
621 Ga0307410_10000351
622 Ga0307406_10000322
623 Ga0307406_10066395
624 Ga0307407_10003153
625 Ga0307412_10060626
626 Ga0307416_100001260
627 Ga0307414_10000001
628 Ga0307414_10034283
629 Ga0307414_10078817
630 Ga0307414_10085288
631 Ga0307411_10000005
632 Ga0307411_10122748
633 Ga0373950_0000004
634 Ga0373950_0000032
635 Ga0373956_0013653
636 Ga0373956_0047246
637 Ga0373957_0026033
638 Ga0373957_0039434
639 Ga0373955_0006962
640 Ga0373955_0018591
641 Ga0373955_0128131
642 Ga0316574_0093650
643 Ga0316574_0170774
644 Ga0316574_0194020
645 Ga0373933_0007173
646 Ga0373947_0231253
647 Ga0373937_0005185
648 Ga0373937_0012484
649 Ga0373937_0269613
650 Ga0373937_0271552
651 Ga0316582_0004727
652 Ga0316584_0056077
653 Ga0316584_0098483
654 Ga0373925_0121885
655 Ga0395905_0365773
656 Ga0395901_0052276
657 Ga0400490_50830
658 Ga0436365_1194866
659 Ga0439447_002357
660 Ga0439466_0021613
661 Ga0439466_0041800
662 Ga0451855_0509811
663 Ga0451577_0000027
664 Ga0451577_0000043
665 Ga0451577_0000715
666 Ga0451577_0025597
667 Ga0451577_0030628
668 Ga0451577_0061838
669 Ga0451577_0073931
670 Ga0451577_0129344
671 Ga0451577_0147089
672 Ga0451577_0163182
673 Ga0451577_0523208
674 Ga0466972_0045374
675 Ga0453683_0000010
676 Ga0453683_0000133
677 Ga0453683_0000317
678 Ga0453683_0029483
679 Ga0453683_0052473
680 Ga0453683_0103296
681 Ga0453683_0152131
682 Ga0453683_0207677
683 Ga0453683_0219804
684 Ga0453684_0000133
685 Ga0453684_0000154
686 Ga0453684_0000167
687 Ga0453684_0000199
688 Ga0453684_0000527
689 Ga0453684_0001607
690 Ga0453684_0004950
691 Ga0453684_0005376
692 Ga0453684_0010412
693 Ga0453684_0079552
694 Ga0453684_0193447
695 Ga0453684_0244742
696 Ga0453684_0279461
697 Ga0453684_0449306
698 Ga0451576_0000032
699 Ga0451576_0000211
700 Ga0451576_0000365
701 Ga0451576_0007843
702 Ga0451576_0009120
703 Ga0451576_0011404
704 Ga0451576_0029010
705 Ga0451576_0030100
706 Ga0451576_0067661
707 Ga0451576_0072498
708 Ga0451576_0083609
709 Ga0451576_0154115
710 Ga0495627_001604
711 Ga0495638_0000274
712 Ga0495641_0126632
713 Ga0495650_0001387
714 Ga0495664_0018311
715 Ga0495583_0000373
716 Ga0495610_0000095
717 Ga0495616_0000040
718 Ga0495616_0028974
719 Ga0495628_0057797
720 Ga0495632_0000957
721 Ga0495632_0005498
722 Ga0495637_0001877
723 Ga0495643_0000014
724 Ga0495643_0002021
725 Ga0495648_0000195
726 Ga0495648_0004846
727 Ga0495663_0000007
728 Ga0495633_0000276
729 Ga0495633_0010577
730 Ga0495633_0010775
731 Ga0495633_0035054
732 Ga0495634_0007961
733 Ga0495625_0002836
734 Ga0495671_0000032
735 Ga0495671_0000125
736 Ga0495674_0003892
737 Ga0495680_0057432
738 Ga0495673_0000275
739 Ga0495686_0018357
740 Ga0495686_0058855
741 Ga0496101_0118965
742 Ga0496104_0021672
743 Ga0496105_0138418
744 Ga0496108_0019743
745 Ga0496109_0149934
746 Ga0496110_0045722
747 Ga0496110_0065826
748 Ga0496113_0022338
749 Ga0496114_0000569
750 Ga0496114_0002401
751 Ga0496114_0014536
752 Ga0496115_0011732
753 Ga0496116_0000041
754 Ga0496117_0008980
755 Ga0496117_0107687
756 Ga0496118_0045118
757 Ga0496119_0040115
758 Ga0496121_0006468
759 Ga0496121_0016608
760 Ga0496121_0192658
761 Ga0496123_0101331
762 Ga0496124_0043667
763 Ga0496125_0000026
764 Ga0496125_0000483
765 Ga0496125_0011263
766 Ga0496125_0014323
767 Ga0496126_0003880
768 Ga0496126_0027480
769 Ga0501034_0000009
770 Ga0501036_0212704
771 Ga0501043_0008101
772 Ga0501043_0161915
773 Ga0501046_0004139
774 Ga0501047_0000006
775 Ga0501048_0021287
776 Ga0501067_0000338
777 Ga0501067_0082961
778 Ga0501069_0009947
779 Ga0501069_0021037
780 Ga0501070_0000488
781 Ga0501070_0001257
782 Ga0501072_0000118
783 Ga0501073_0000296
784 Ga0501073_0013476
785 Ga0501073_0038463
786 Ga0501073_0060937
787 Ga0501073_0061635
788 Ga0501074_0004542
789 Ga0501074_0072607
790 Ga0501211_003031
791 Ga0501223_000012
792 Ga0501235_006962
793 Ga0501235_015539
794 Ga0501238_000336
795 Ga0501249_000033
796 Ga0501249_010690
797 Ga0501256_001204
798 Ga0501225_0000264
799 Ga0501225_0022178
800 Ga0501225_0038234
801 Ga0501079_0000040
802 Ga0501080_0168479
803 Ga0501080_0184402
804 Ga0501080_0330502
805 Ga0501083_0001131
806 Ga0501083_0001267
807 Ga0501264_004556
808 Ga0501266_000007
809 Ga0501280_000405
810 Ga0501035_0064973
811 nmdc:mga05p37_378559_c1
812 nmdc:mga09592_253366_c1
813 Ga0500643_001166
814 Ga0500647_0031672
815 Ga0500641_0000006
816 Ga0500641_0000139
817 Ga0500641_0047189
818 Ga0500562_002400
819 Ga0500618_003031
820 Ga0500658_0000013
821 Ga0500559_0004827
822 Ga0500559_0017794
823 Ga0500624_000589
824 Ga0500627_0000426
825 Ga0500584_004540
826 Ga0501084_0000019
827 Ga0500661_000193
828 Ga0501082_0000385
829 Ga0501082_0116355
830 2512641952
831 2513235097
832 2520878639
833 2644011588
834 2644369981
835 2644642175
836 2644685399
837 2738737033
838 2738769573
839 2739218615
840 2740000668
841 2740005484
842 2740032424
843 2778124182
844 2802653568
845 2817415668
846 2857614435
847 2857619203
848 2881250778
849 2881362502
850 2903898481
851 2904419722
852 2904556503
853 2910246040
854 2919193096
855 2919512397
856 2919687853
857 2919711550
858 2929152934
859 2958462759
860 2958513222
861 2965323315
862 2977269601
863 8054308333
864 8055421367
865 8055594165
866 8056443900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

48

94

0.97

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

122

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dm9-assembly1.cif.gz_A heat shock protein 15 kd 0.8881 18 59
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.8675 17 59
1xpi-assembly1.cif.gz_A crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc 0.8554 125 301
2i82-assembly2.cif.gz_B crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure 0.8525 86 289
1xpi-assembly2.cif.gz_B crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc 0.84 88 301
ID Description Score Start End Superfamily
af_Q2FZ78_82_304_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9314 88 301 3.30.2350.10
af_I1JSZ4_206_438_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9046 122 302 3.30.2350.10
2istA01 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9009 6 73 3.10.290.10
1dm9A00 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.8881 18 59 3.10.290.10
af_P9WHQ3_81_307_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8742 86 301 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A4Q2Y2J7-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9496 99 296 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A7X6YVV1-F1-model_v4 RluA family pseudouridine synthase 0.948 124 301 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A521JLY1-F1-model_v4 RluA family pseudouridine synthase 0.9427 127 301 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A654IN86-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9405 127 301 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A7V8KME2-F1-model_v4 deleted 0.9396 76 303

Map