F442928

General Info

Members Datasets Scaffolds Average Seq Length
433 284 866 136

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0886208|Ga0495676_0886208_25_474
Length 140
Sequence MNARATLGHDEQTKMPRHSQRQLRVGELIRHEVAEMLSRGDVHDPVIEAHMITVPEVRMSADLRLATIYVMPLGGRKEDVLDALERNKRYMRGEIARRVNLKFAPEIRFRIDERFDEAERIEKLLRTPEVRRDLAGEKDE

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.39
Nodule 0
Rhizoplane 4.39
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0886208 3300047321 Bacteria 572
2 ARSoilYngRDRAFT_c00001 3300000042 Bacteria 59233
3 ARSoilOldRDRAFT_c000001 3300000044 Bacteria 104759
4 ARCol0oldRDRAFT_c00191 3300000045 Bacteria 5607
5 ARCol0yngRDRAFT_1000001 3300000652 Bacteria 73871
6 Ga0055526_1002618 3300003771 Bacteria 12030
7 Ga0055524_1000189 3300003775 Bacteria 68000
8 Ga0065704_10086754 3300005289 Bacteria 3088
9 Ga0065712_10000310 3300005290 Bacteria 17827
10 Ga0065715_10001068 3300005293 Bacteria 20888
11 Ga0065715_10095141 3300005293 Bacteria 4155
12 Ga0070680_100015831 3300005336 Bacteria 5920
13 Ga0070660_101147620 3300005339 Bacteria 658
14 Ga0070689_100087033 3300005340 Bacteria 2457
15 Ga0070691_10007017 3300005341 Bacteria 5162
16 Ga0070691_10014076 3300005341 Bacteria 3668
17 Ga0070661_100069993 3300005344 Bacteria 2580
18 Ga0070668_101466139 3300005347 Bacteria 623
19 Ga0070668_101852438 3300005347 Bacteria 555
20 Ga0070669_100016744 3300005353 Bacteria 5231
21 Ga0070675_100048112 3300005354 Bacteria 3495
22 Ga0070674_100460169 3300005356 Bacteria 1052
23 Ga0070674_100801987 3300005356 Bacteria 813
24 Ga0070673_100203473 3300005364 Bacteria 1706
25 Ga0070688_100009335 3300005365 Bacteria 5360
26 Ga0070659_100011237 3300005366 Bacteria 6615
27 Ga0070659_100710552 3300005366 Bacteria 869
28 Ga0070667_100165181 3300005367 Bacteria 1952
29 Ga0070667_100503854 3300005367 Bacteria 1110
30 Ga0070703_10013587 3300005406 Bacteria 2313
31 Ga0070703_10051765 3300005406 Bacteria 1315
32 Ga0070714_100220539 3300005435 Bacteria 1743
33 Ga0070713_100034057 3300005436 Bacteria 4087
34 Ga0070713_100621197 3300005436 Bacteria 1028
35 Ga0070710_10103160 3300005437 Bacteria 1702
36 Ga0070711_100047666 3300005439 Bacteria 2927
37 Ga0070705_100907517 3300005440 Bacteria 709
38 Ga0070700_100028260 3300005441 Bacteria 3334
39 Ga0070700_100033831 3300005441 Bacteria 3082
40 Ga0070700_101037466 3300005441 Bacteria 676
41 Ga0070694_100013563 3300005444 Bacteria 5092
42 Ga0070694_100015816 3300005444 Bacteria 4746
43 Ga0070694_100514125 3300005444 Bacteria 954
44 Ga0070678_100521845 3300005456 Bacteria 1051
45 Ga0070662_100002736 3300005457 Bacteria 10896
46 Ga0070681_10110775 3300005458 Bacteria 2685
47 Ga0070706_100703478 3300005467 Bacteria 937
48 Ga0070698_100265920 3300005471 Bacteria 1647
49 Ga0070679_100076579 3300005530 Bacteria 3334
50 Ga0070697_100943871 3300005536 Bacteria 766
51 Ga0068853_100056504 3300005539 Bacteria 3384
52 Ga0070672_100183441 3300005543 Bacteria 1745
53 Ga0070686_100009914 3300005544 Bacteria 5356
54 Ga0070695_100011474 3300005545 Bacteria 5299
55 Ga0070696_100071196 3300005546 Bacteria 2447
56 Ga0070696_101203289 3300005546 Bacteria 640
57 Ga0070665_100340401 3300005548 Bacteria 1505
58 Ga0070665_100790256 3300005548 Bacteria 962
59 Ga0070704_100005796 3300005549 Bacteria 7228
60 Ga0068855_100266023 3300005563 Bacteria 1908
61 Ga0068855_100766137 3300005563 Bacteria 1028
62 Ga0068857_100640109 3300005577 Bacteria 1007
63 Ga0068854_100238908 3300005578 Bacteria 1446
64 Ga0070702_100257140 3300005615 Bacteria 1187
65 Ga0068852_100075060 3300005616 Bacteria 2981
66 Ga0068859_100027391 3300005617 Bacteria 5716
67 Ga0068859_101540053 3300005617 Bacteria 734
68 Ga0068864_100488453 3300005618 Bacteria 1183
69 Ga0068861_100028850 3300005719 Bacteria 4052
70 Ga0068861_100226202 3300005719 Bacteria 1584
71 Ga0068861_101007938 3300005719 Bacteria 795
72 Ga0068851_10588343 3300005834 Unclassified 676
73 Ga0068870_10744730 3300005840 Bacteria 680
74 Ga0068863_100254586 3300005841 Bacteria 1696
75 Ga0068858_100375577 3300005842 Bacteria 1364
76 Ga0068858_100579993 3300005842 Bacteria 1087
77 Ga0068858_101151505 3300005842 Bacteria 762
78 Ga0068860_100135098 3300005843 Bacteria 2368
79 Ga0068860_100438779 3300005843 Bacteria 1297
80 Ga0068860_101283984 3300005843 Bacteria 753
81 Ga0068860_101737373 3300005843 Bacteria 646
82 Ga0068862_100164949 3300005844 Bacteria 1980
83 Ga0068862_100763442 3300005844 Bacteria 942
84 Ga0081455_10024995 3300005937 Bacteria 5520
85 Ga0081540_1061042 3300005983 Bacteria 1799
86 Ga0075365_10017068 3300006038 Bacteria 4431
87 Ga0075365_10925629 3300006038 Bacteria 614
88 Ga0075368_10003692 3300006042 Bacteria 5140
89 Ga0075368_10011248 3300006042 Bacteria 3253
90 Ga0075363_100054238 3300006048 Bacteria 2144
91 Ga0075363_100354027 3300006048 Bacteria 858
92 Ga0075364_10003204 3300006051 Bacteria 9275
93 Ga0075364_10377519 3300006051 Bacteria 967
94 Ga0075364_10738530 3300006051 Bacteria 671
95 Ga0075432_10168481 3300006058 Bacteria 851
96 Ga0070712_100181377 3300006175 Bacteria 1641
97 Ga0070712_100542901 3300006175 Bacteria 979
98 Ga0070712_100845007 3300006175 Bacteria 787
99 Ga0075367_10010070 3300006178 Bacteria 4956
100 Ga0075367_10969977 3300006178 Bacteria 543
101 Ga0075370_10220792 3300006353 Bacteria 1120
102 Ga0075428_100002338 3300006844 Bacteria 20574
103 Ga0075428_100049452 3300006844 Bacteria 4613
104 Ga0075430_100095400 3300006846 Bacteria 2486
105 Ga0075431_100000560 3300006847 Bacteria 31320
106 Ga0075431_100001098 3300006847 Bacteria 24239
107 Ga0075433_10004581 3300006852 Bacteria 10782
108 Ga0075434_100006114 3300006871 Bacteria 11019
109 Ga0075434_100020343 3300006871 Bacteria 6436
110 Ga0075429_100047543 3300006880 Bacteria 3733
111 Ga0075429_100063069 3300006880 Bacteria 3229
112 Ga0075429_101139312 3300006880 Bacteria 681
113 Ga0068865_101064180 3300006881 Bacteria 711
114 Ga0075436_100035978 3300006914 Bacteria 3416
115 Ga0097620_100027393 3300006931 Bacteria 5716
116 Ga0097620_101540505 3300006931 Bacteria 734
117 Ga0075435_100013908 3300007076 Bacteria 6003
118 Ga0075435_100168092 3300007076 Bacteria 1850
119 Ga0075435_100500684 3300007076 Bacteria 1050
120 Ga0111539_10007160 3300009094 Bacteria 14300
121 Ga0111539_10022555 3300009094 Bacteria 7733
122 Ga0111539_10639929 3300009094 Bacteria 1238
123 Ga0111539_10655905 3300009094 Bacteria 1222
124 Ga0111539_10780888 3300009094 Bacteria 1112
125 Ga0111539_11641210 3300009094 Bacteria 745
126 Ga0114129_10011487 3300009147 Bacteria 12608
127 Ga0114129_10043309 3300009147 Bacteria 6333
128 Ga0114129_10164928 3300009147 Bacteria 3024
129 Ga0114129_10352591 3300009147 Bacteria 1949
130 Ga0114129_11666942 3300009147 Bacteria 779
131 Ga0105242_11847327 3300009176 Bacteria 643
132 Ga0105242_12444456 3300009176 Bacteria 570
133 Ga0105248_10720218 3300009177 Bacteria 1126
134 Ga0105249_10589732 3300009553 Bacteria 1165
135 Ga0105239_11415664 3300010375 Bacteria 803
136 Ga0105239_12185416 3300010375 Bacteria 643
137 Ga0163162_11099955 3300013306 Bacteria 900
138 Ga0157375_10476405 3300013308 Bacteria 1413
139 Ga0157375_11683615 3300013308 Bacteria 751
140 Ga0163163_12168457 3300014325 Bacteria 615
141 Ga0157380_10027361 3300014326 Bacteria 4337
142 Ga0157380_10380076 3300014326 Bacteria 1332
143 Ga0157380_11668444 3300014326 Bacteria 694
144 Ga0157380_12170669 3300014326 Bacteria 619
145 Ga0157377_10852478 3300014745 Bacteria 677
146 Ga0157379_11135248 3300014968 Bacteria 750
147 Ga0213875_10039014 3300021388 Bacteria 2238
148 Ga0224572_1037008 3300024225 Bacteria 923
149 Ga0207666_1003332 3300025271 Bacteria 1971
150 Ga0209675_1003405 3300025291 Bacteria 7577
151 Ga0209676_1050911 3300025292 Bacteria 1089
152 Ga0209025_1000063 3300025294 Bacteria 303962
153 Ga0209564_1000076 3300025295 Bacteria 283602
154 Ga0209256_1000316 3300025299 Bacteria 83704
155 Ga0207697_10012192 3300025315 Bacteria 3613
156 Ga0207653_10007662 3300025885 Bacteria 3369
157 Ga0207642_10446916 3300025899 Bacteria 782
158 Ga0207688_10011190 3300025901 Bacteria 4884
159 Ga0207688_10272411 3300025901 Bacteria 1030
160 Ga0207647_10024817 3300025904 Bacteria 3949
161 Ga0207699_10066710 3300025906 Bacteria 2185
162 Ga0207671_10099859 3300025914 Bacteria 2197
163 Ga0207693_10205948 3300025915 Bacteria 1547
164 Ga0207693_10292708 3300025915 Bacteria 1276
165 Ga0207693_10383721 3300025915 Bacteria 1099
166 Ga0207663_10039425 3300025916 Bacteria 2862
167 Ga0207660_10473735 3300025917 Bacteria 1014
168 Ga0207662_10011520 3300025918 Bacteria 4907
169 Ga0207657_10041174 3300025919 Bacteria 4086
170 Ga0207649_10061721 3300025920 Bacteria 2360
171 Ga0207652_10011322 3300025921 Bacteria 7188
172 Ga0207681_10052637 3300025923 Bacteria 2761
173 Ga0207659_10017500 3300025926 Bacteria 4683
174 Ga0207687_10207399 3300025927 Bacteria 1535
175 Ga0207664_10741021 3300025929 Bacteria 884
176 Ga0207690_10402822 3300025932 Bacteria 1091
177 Ga0207706_10073130 3300025933 Bacteria 3014
178 Ga0207670_10043352 3300025936 Bacteria 2971
179 Ga0207704_10615745 3300025938 Bacteria 891
180 Ga0207691_10160435 3300025940 Bacteria 1973
181 Ga0207711_10126443 3300025941 Bacteria 2287
182 Ga0207711_10197692 3300025941 Bacteria 1834
183 Ga0207667_10370633 3300025949 Bacteria 1459
184 Ga0207668_10044203 3300025972 Bacteria 3029
185 Ga0207668_10129963 3300025972 Bacteria 1922
186 Ga0207668_10250129 3300025972 Bacteria 1439
187 Ga0207668_10304639 3300025972 Bacteria 1316
188 Ga0207668_10683374 3300025972 Bacteria 901
189 Ga0207640_10255962 3300025981 Bacteria 1361
190 Ga0207658_10526992 3300025986 Bacteria 1055
191 Ga0207703_10121169 3300026035 Bacteria 2246
192 Ga0207703_10320117 3300026035 Bacteria 1420
193 Ga0207639_10004886 3300026041 Bacteria 9025
194 Ga0207678_10020530 3300026067 Bacteria 5791
195 Ga0207678_11322588 3300026067 Bacteria 637
196 Ga0207708_10020266 3300026075 Bacteria 5015
197 Ga0207708_10099129 3300026075 Bacteria 2253
198 Ga0207708_10804176 3300026075 Bacteria 809
199 Ga0207702_12398946 3300026078 Bacteria 515
200 Ga0207648_10031316 3300026089 Bacteria 4702
201 Ga0207674_10069451 3300026116 Bacteria 3543
202 Ga0207675_100015073 3300026118 Bacteria 7212
203 Ga0207675_100093763 3300026118 Bacteria 2824
204 Ga0207675_100133703 3300026118 Bacteria 2352
205 Ga0207675_101026038 3300026118 Bacteria 844
206 Ga0207675_101594716 3300026118 Bacteria 673
207 Ga0207683_10297730 3300026121 Bacteria 1476
208 Ga0207683_10372016 3300026121 Bacteria 1313
209 Ga0209968_1019486 3300027526 Bacteria 1092
210 Ga0209999_1005816 3300027543 Bacteria 2218
211 Ga0210002_1044988 3300027617 Bacteria 754
212 Ga0209966_1006448 3300027695 Bacteria 2038
213 Ga0209998_10000630 3300027717 Bacteria 9445
214 Ga0209813_10000706 3300027866 Bacteria 7639
215 Ga0209813_10015947 3300027866 Bacteria 2043
216 Ga0209813_10248842 3300027866 Bacteria 675
217 Ga0209974_10039003 3300027876 Bacteria 1580
218 Ga0209974_10137624 3300027876 Bacteria 874
219 Ga0207428_10053498 3300027907 Bacteria 3219
220 Ga0207428_10385882 3300027907 Bacteria 1027
221 Ga0268266_10629048 3300028379 Bacteria 1032
222 Ga0268265_10027638 3300028380 Bacteria 4051
223 Ga0268265_11180279 3300028380 Bacteria 762
224 Ga0268264_10710932 3300028381 Bacteria 998
225 Ga0268264_10854147 3300028381 Bacteria 912
226 Ga0265316_10894051 3300031344 Bacteria 620
227 Ga0265314_10103548 3300031711 Bacteria 1824
228 Ga0307412_10497107 3300031911 Bacteria 1015
229 Ga0373930_0169706 3300034816 Bacteria 555
230 Ga0373959_0050020 3300034820 Bacteria 900
231 Ga0373938_0119853 3300034957 Bacteria 677
232 Ga0373928_0019886 3300035084 Bacteria 1404
233 Ga0373929_0218368 3300035085 Bacteria 541
234 Ga0373940_0003481 3300035088 Bacteria 3219
235 Ga0373940_0004403 3300035088 Bacteria 2972
236 Ga0373949_0064362 3300035090 Bacteria 950
237 Ga0373952_0012404 3300035092 Bacteria 1676
238 Ga0373923_0035392 3300035111 Bacteria 2033
239 Ga0373932_0008898 3300035112 Bacteria 2405
240 Ga0373939_0048230 3300035114 Bacteria 1311
241 Ga0373941_0009250 3300035115 Bacteria 2475
242 Ga0373957_0105556 3300035120 Bacteria 1131
243 Ga0373960_0053223 3300035121 Bacteria 1207
244 Ga0373943_0157437 3300035170 Bacteria 1234
245 Ga0373946_0440298 3300035171 Bacteria 662
246 Ga0373955_0609933 3300035172 Bacteria 668
247 Ga0373942_0096866 3300035207 Bacteria 897
248 Ga0373961_0068184 3300035241 Bacteria 1095
249 Ga0373962_0008484 3300035242 Bacteria 2529
250 Ga0373924_0008133 3300035410 Bacteria 3800
251 Ga0373931_0003950 3300035691 Bacteria 6711
252 Ga0373931_0020742 3300035691 Bacteria 3290
253 Ga0373935_0099652 3300035692 Bacteria 1913
254 Ga0373927_0082739 3300035695 Bacteria 2081
255 Ga0373927_0286731 3300035695 Bacteria 1083
256 Ga0373933_0049252 3300035724 Bacteria 2511
257 Ga0373947_0734577 3300035725 Bacteria 673
258 Ga0373937_0256900 3300036401 Bacteria 1647
259 Ga0373925_0288765 3300037068 Bacteria 1322
260 Ga0436364_0216860 3300037853 Bacteria 3107
261 Ga0436364_1348904 3300037853 Bacteria 1632
262 Ga0436365_0850190 3300039437 Bacteria 844
263 Ga0436365_1063132 3300039437 Bacteria 1223
264 Ga0439464_0242072 3300042439 Bacteria 582
265 Ga0466966_0267274 3300044684 Bacteria 1029
266 Ga0495592_0016075 3300046454 Bacteria 5678
267 Ga0495629_0067407 3300046459 Bacteria 2497
268 Ga0495651_0066364 3300046462 Bacteria 2754
269 Ga0495651_0137159 3300046462 Bacteria 1778
270 Ga0495582_0108037 3300046473 Bacteria 1562
271 Ga0495664_0024569 3300046477 Bacteria 3504
272 Ga0495584_0115739 3300046491 Bacteria 1357
273 Ga0495618_0061376 3300046514 Bacteria 2384
274 Ga0495630_0586885 3300046517 Bacteria 854
275 Ga0495652_0495817 3300046529 Bacteria 847
276 Ga0495640_0242248 3300046533 Bacteria 1131
277 Ga0495645_0184362 3300046543 Bacteria 1427
278 Ga0495667_0374313 3300046559 Bacteria 898
279 Ga0495634_0022061 3300046642 Bacteria 4488
280 Ga0495635_0067183 3300046663 Bacteria 2459
281 Ga0495657_0255737 3300046675 Bacteria 1053
282 Ga0495599_0288547 3300046678 Bacteria 992
283 Ga0495623_0197719 3300046679 Bacteria 1157
284 Ga0495646_0023655 3300046680 Bacteria 3867
285 Ga0495647_0079280 3300046681 Bacteria 1329
286 Ga0495658_0024869 3300046683 Bacteria 3195
287 Ga0495613_0035070 3300046689 Bacteria 3724
288 Ga0495600_0034884 3300046809 Bacteria 3266
289 Ga0495581_0193700 3300047315 Bacteria 1189
290 Ga0495604_0024263 3300047317 Bacteria 4839
291 Ga0495674_0394160 3300047319 Bacteria 1118
292 Ga0495675_0113601 3300047444 Bacteria 1689
293 Ga0495593_0269324 3300047673 Bacteria 852
294 Ga0495602_0011196 3300048088 Bacteria 9274
295 Ga0495602_1054705 3300048088 Bacteria 534
296 Ga0495614_0120766 3300048089 Bacteria 1155
297 Ga0496100_0315899 3300048903 Bacteria 1172
298 Ga0496101_0947223 3300048904 Bacteria 677
299 Ga0496104_0012172 3300048907 Bacteria 7727
300 Ga0496106_0119911 3300048909 Bacteria 2055
301 Ga0496107_0559344 3300048910 Bacteria 847
302 Ga0496108_0118709 3300048911 Bacteria 2267
303 Ga0496108_0993343 3300048911 Bacteria 717
304 Ga0496109_0105296 3300048912 Bacteria 2620
305 Ga0496109_0140814 3300048912 Bacteria 2255
306 Ga0496110_0155901 3300048913 Bacteria 2069
307 Ga0496110_1085140 3300048913 Bacteria 708
308 Ga0496111_0416240 3300048914 Bacteria 993
309 Ga0496112_0233403 3300048915 Bacteria 1794
310 Ga0496112_0281634 3300048915 Bacteria 1610
311 Ga0496113_0827886 3300048916 Bacteria 734
312 Ga0496114_0412906 3300048917 Bacteria 1195
313 Ga0496115_0095527 3300048918 Bacteria 2433
314 Ga0496115_0391488 3300048918 Bacteria 1129
315 Ga0496115_0712421 3300048918 Bacteria 788
316 Ga0496117_0086673 3300048920 Bacteria 2033
317 Ga0496118_0132216 3300048921 Bacteria 1600
318 Ga0496122_0145628 3300048925 Bacteria 1472
319 Ga0496123_0084579 3300048926 Bacteria 1912
320 Ga0496125_0093020 3300048928 Bacteria 2252
321 Ga0496126_0057164 3300048929 Bacteria 3523
322 Ga0496126_0150523 3300048929 Bacteria 1995
323 Ga0496126_0846920 3300048929 Bacteria 698
324 Ga0496126_1234505 3300048929 Bacteria 548
325 Ga0501033_0417759 3300049570 Bacteria 934
326 Ga0501033_0653329 3300049570 Bacteria 718
327 Ga0501034_0019428 3300049571 Bacteria 6949
328 Ga0501036_0017561 3300049572 Bacteria 5983
329 Ga0501037_0009184 3300049573 Bacteria 7247
330 Ga0501038_0022007 3300049574 Bacteria 5717
331 Ga0501039_0083327 3300049575 Bacteria 2490
332 Ga0501039_0641696 3300049575 Bacteria 831
333 Ga0501040_0211396 3300049576 Bacteria 1379
334 Ga0501040_0946573 3300049576 Bacteria 624
335 Ga0501041_0036376 3300049577 Bacteria 2983
336 Ga0501042_0259277 3300049578 Bacteria 1255
337 Ga0501042_0450797 3300049578 Bacteria 933
338 Ga0501043_0015469 3300049579 Bacteria 5976
339 Ga0501043_1024165 3300049579 Bacteria 587
340 Ga0501046_0196460 3300049580 Bacteria 1502
341 Ga0501048_0086227 3300049582 Bacteria 2215
342 Ga0501048_0258894 3300049582 Bacteria 1236
343 Ga0501068_0204974 3300049584 Bacteria 1251
344 Ga0501068_0777284 3300049584 Bacteria 628
345 Ga0501069_0286336 3300049585 Bacteria 965
346 Ga0501070_0112108 3300049586 Bacteria 2254
347 Ga0501070_0236846 3300049586 Bacteria 1495
348 Ga0501070_0910077 3300049586 Bacteria 686
349 Ga0501071_0031619 3300049587 Bacteria 3754
350 Ga0501071_0550476 3300049587 Bacteria 886
351 Ga0501071_1001214 3300049587 Bacteria 645
352 Ga0501071_1063238 3300049587 Bacteria 625
353 Ga0501072_0369007 3300049588 Bacteria 1139
354 Ga0501073_0144121 3300049589 Bacteria 1651
355 Ga0501073_0702279 3300049589 Bacteria 698
356 Ga0501074_0063730 3300049590 Bacteria 2655
357 Ga0501075_0087433 3300049591 Bacteria 2362
358 Ga0501075_0246343 3300049591 Bacteria 1362
359 Ga0501076_0012239 3300049592 Bacteria 6414
360 Ga0501076_0202548 3300049592 Bacteria 1621
361 Ga0501077_0060416 3300049593 Bacteria 2405
362 Ga0501079_0013717 3300049741 Bacteria 6181
363 Ga0501079_0015930 3300049741 Bacteria 5745
364 Ga0501079_0227438 3300049741 Bacteria 1457
365 Ga0501079_0721479 3300049741 Bacteria 785
366 Ga0501079_1509805 3300049741 Bacteria 528
367 Ga0501080_0019089 3300049742 Bacteria 6347
368 Ga0501080_0038671 3300049742 Bacteria 4454
369 Ga0501081_0068746 3300049743 Bacteria 2466
370 Ga0501083_0091987 3300049744 Bacteria 2002
371 Ga0501083_0335781 3300049744 Bacteria 983
372 Ga0501035_0010864 3300049822 Bacteria 8432
373 Ga0501035_0327134 3300049822 Bacteria 1287
374 Ga0501044_0119504 3300049823 Bacteria 2637
375 Ga0501045_0144899 3300049824 Bacteria 1767
376 Ga0501045_0293702 3300049824 Bacteria 1209
377 nmdc:mga03n38_127678_c1 3300050490 Bacteria 1257
378 nmdc:mga03n38_216989_c1 3300050490 Bacteria 997
379 nmdc:mga00v17_234175_c1 3300050491 Bacteria 1190
380 nmdc:mga00v17_60343_c1 3300050491 Bacteria 2329
381 nmdc:mga00v17_7284_c1 3300050491 Bacteria 5896
382 nmdc:mga00v17_733080_c1 3300050491 Bacteria 632
383 nmdc:mga0yw44_21331_c1 3300050492 Bacteria 3612
384 nmdc:mga0yw44_536340_c1 3300050492 Bacteria 794
385 nmdc:mga0yw44_61416_c1 3300050492 Bacteria 2306
386 nmdc:mga0yw44_6229_c1 3300050492 Bacteria 5742
387 nmdc:mga06z11_19927_c1 3300050494 Bacteria 3093
388 nmdc:mga06z11_21441_c1 3300050494 Bacteria 3003
389 nmdc:mga06z11_218994_c1 3300050494 Bacteria 1112
390 nmdc:mga06z11_37619_c1 3300050494 Bacteria 2398
391 nmdc:mga04h51_1368_c1 3300050495 Bacteria 5609
392 nmdc:mga04h51_15317_c1 3300050495 Bacteria 2207
393 nmdc:mga04h51_280438_c1 3300050495 Bacteria 675
394 nmdc:mga04h51_8042_c1 3300050495 Bacteria 2810
395 nmdc:mga07m45_201490_c1 3300050496 Bacteria 1158
396 nmdc:mga07m45_582635_c1 3300050496 Bacteria 646
397 nmdc:mga05p37_24547_c1 3300050507 Bacteria 7327
398 nmdc:mga05p37_58068_c1 3300050507 Bacteria 4765
399 nmdc:mga05p37_776645_c1 3300050507 Bacteria 1052
400 nmdc:mga09592_1216317_c1 3300050508 Bacteria 622
401 nmdc:mga09592_193733_c1 3300050508 Bacteria 1759
402 nmdc:mga09592_274269_c1 3300050508 Bacteria 1463
403 nmdc:mga0qj67_46869_c1 3300050509 Bacteria 3413
404 nmdc:mga06r32_14779_c1 3300050510 Bacteria 7084
405 nmdc:mga06r32_1596505_c1 3300050510 Bacteria 591
406 nmdc:mga08y16_11176_c1 3300050511 Bacteria 9428
407 nmdc:mga08y16_115554_c1 3300050511 Bacteria 2794
408 nmdc:mga08y16_271065_c1 3300050511 Bacteria 1752
409 nmdc:mga08y16_461504_c1 3300050511 Bacteria 1294
410 nmdc:mga0n895_106130_c1 3300050512 Bacteria 2822
411 nmdc:mga0n895_1341825_c1 3300050512 Bacteria 685
412 nmdc:mga0n895_87445_c1 3300050512 Bacteria 3114
413 nmdc:mga0rr50_10248_c1 3300050513 Bacteria 5938
414 nmdc:mga0rr50_37107_c1 3300050513 Bacteria 3515
415 nmdc:mga08x19_201472_c1 3300050514 Bacteria 1364
416 nmdc:mga0a205_2816_c1 3300050515 Bacteria 15383
417 Ga0495601_0130487 3300053077 Bacteria 1636
418 Ga0495612_0157785 3300053078 Bacteria 989
419 Ga0495595_0104747 3300053084 Bacteria 1367
420 Ga0495619_0226707 3300053085 Bacteria 1294
421 Ga0500642_0045189 3300053130 Bacteria 1921
422 Ga0500642_0205800 3300053130 Bacteria 915
423 Ga0500616_0193651 3300053153 Bacteria 906
424 Ga0501084_0008653 3300054114 Bacteria 8411
425 Ga0501084_0161973 3300054114 Bacteria 1887
426 Ga0501084_1738779 3300054114 Bacteria 521
427 Ga0587101_054285 3300059623 Bacteria 699
428 Ga0501082_0020564 3300060353 Bacteria 5689
429 Ga0501082_0110295 3300060353 Bacteria 2382
430 Ga0501082_0254636 3300060353 Bacteria 1527
431 Ga0501082_0264310 3300060353 Bacteria 1497
432 Ga0501082_0440871 3300060353 Bacteria 1138
433 Ga0530510_0040804 3300061734 Bacteria 3350
434 Ga0495676_0886208
435 ARSoilYngRDRAFT_c00001
436 ARSoilOldRDRAFT_c000001
437 ARCol0oldRDRAFT_c00191
438 ARCol0yngRDRAFT_1000001
439 Ga0055526_1002618
440 Ga0055524_1000189
441 Ga0065704_10086754
442 Ga0065712_10000310
443 Ga0065715_10001068
444 Ga0065715_10095141
445 Ga0070680_100015831
446 Ga0070660_101147620
447 Ga0070689_100087033
448 Ga0070691_10007017
449 Ga0070691_10014076
450 Ga0070661_100069993
451 Ga0070668_101466139
452 Ga0070668_101852438
453 Ga0070669_100016744
454 Ga0070675_100048112
455 Ga0070674_100460169
456 Ga0070674_100801987
457 Ga0070673_100203473
458 Ga0070688_100009335
459 Ga0070659_100011237
460 Ga0070659_100710552
461 Ga0070667_100165181
462 Ga0070667_100503854
463 Ga0070703_10013587
464 Ga0070703_10051765
465 Ga0070714_100220539
466 Ga0070713_100034057
467 Ga0070713_100621197
468 Ga0070710_10103160
469 Ga0070711_100047666
470 Ga0070705_100907517
471 Ga0070700_100028260
472 Ga0070700_100033831
473 Ga0070700_101037466
474 Ga0070694_100013563
475 Ga0070694_100015816
476 Ga0070694_100514125
477 Ga0070678_100521845
478 Ga0070662_100002736
479 Ga0070681_10110775
480 Ga0070706_100703478
481 Ga0070698_100265920
482 Ga0070679_100076579
483 Ga0070697_100943871
484 Ga0068853_100056504
485 Ga0070672_100183441
486 Ga0070686_100009914
487 Ga0070695_100011474
488 Ga0070696_100071196
489 Ga0070696_101203289
490 Ga0070665_100340401
491 Ga0070665_100790256
492 Ga0070704_100005796
493 Ga0068855_100266023
494 Ga0068855_100766137
495 Ga0068857_100640109
496 Ga0068854_100238908
497 Ga0070702_100257140
498 Ga0068852_100075060
499 Ga0068859_100027391
500 Ga0068859_101540053
501 Ga0068864_100488453
502 Ga0068861_100028850
503 Ga0068861_100226202
504 Ga0068861_101007938
505 Ga0068851_10588343
506 Ga0068870_10744730
507 Ga0068863_100254586
508 Ga0068858_100375577
509 Ga0068858_100579993
510 Ga0068858_101151505
511 Ga0068860_100135098
512 Ga0068860_100438779
513 Ga0068860_101283984
514 Ga0068860_101737373
515 Ga0068862_100164949
516 Ga0068862_100763442
517 Ga0081455_10024995
518 Ga0081540_1061042
519 Ga0075365_10017068
520 Ga0075365_10925629
521 Ga0075368_10003692
522 Ga0075368_10011248
523 Ga0075363_100054238
524 Ga0075363_100354027
525 Ga0075364_10003204
526 Ga0075364_10377519
527 Ga0075364_10738530
528 Ga0075432_10168481
529 Ga0070712_100181377
530 Ga0070712_100542901
531 Ga0070712_100845007
532 Ga0075367_10010070
533 Ga0075367_10969977
534 Ga0075370_10220792
535 Ga0075428_100002338
536 Ga0075428_100049452
537 Ga0075430_100095400
538 Ga0075431_100000560
539 Ga0075431_100001098
540 Ga0075433_10004581
541 Ga0075434_100006114
542 Ga0075434_100020343
543 Ga0075429_100047543
544 Ga0075429_100063069
545 Ga0075429_101139312
546 Ga0068865_101064180
547 Ga0075436_100035978
548 Ga0097620_100027393
549 Ga0097620_101540505
550 Ga0075435_100013908
551 Ga0075435_100168092
552 Ga0075435_100500684
553 Ga0111539_10007160
554 Ga0111539_10022555
555 Ga0111539_10639929
556 Ga0111539_10655905
557 Ga0111539_10780888
558 Ga0111539_11641210
559 Ga0114129_10011487
560 Ga0114129_10043309
561 Ga0114129_10164928
562 Ga0114129_10352591
563 Ga0114129_11666942
564 Ga0105242_11847327
565 Ga0105242_12444456
566 Ga0105248_10720218
567 Ga0105249_10589732
568 Ga0105239_11415664
569 Ga0105239_12185416
570 Ga0163162_11099955
571 Ga0157375_10476405
572 Ga0157375_11683615
573 Ga0163163_12168457
574 Ga0157380_10027361
575 Ga0157380_10380076
576 Ga0157380_11668444
577 Ga0157380_12170669
578 Ga0157377_10852478
579 Ga0157379_11135248
580 Ga0213875_10039014
581 Ga0224572_1037008
582 Ga0207666_1003332
583 Ga0209675_1003405
584 Ga0209676_1050911
585 Ga0209025_1000063
586 Ga0209564_1000076
587 Ga0209256_1000316
588 Ga0207697_10012192
589 Ga0207653_10007662
590 Ga0207642_10446916
591 Ga0207688_10011190
592 Ga0207688_10272411
593 Ga0207647_10024817
594 Ga0207699_10066710
595 Ga0207671_10099859
596 Ga0207693_10205948
597 Ga0207693_10292708
598 Ga0207693_10383721
599 Ga0207663_10039425
600 Ga0207660_10473735
601 Ga0207662_10011520
602 Ga0207657_10041174
603 Ga0207649_10061721
604 Ga0207652_10011322
605 Ga0207681_10052637
606 Ga0207659_10017500
607 Ga0207687_10207399
608 Ga0207664_10741021
609 Ga0207690_10402822
610 Ga0207706_10073130
611 Ga0207670_10043352
612 Ga0207704_10615745
613 Ga0207691_10160435
614 Ga0207711_10126443
615 Ga0207711_10197692
616 Ga0207667_10370633
617 Ga0207668_10044203
618 Ga0207668_10129963
619 Ga0207668_10250129
620 Ga0207668_10304639
621 Ga0207668_10683374
622 Ga0207640_10255962
623 Ga0207658_10526992
624 Ga0207703_10121169
625 Ga0207703_10320117
626 Ga0207639_10004886
627 Ga0207678_10020530
628 Ga0207678_11322588
629 Ga0207708_10020266
630 Ga0207708_10099129
631 Ga0207708_10804176
632 Ga0207702_12398946
633 Ga0207648_10031316
634 Ga0207674_10069451
635 Ga0207675_100015073
636 Ga0207675_100093763
637 Ga0207675_100133703
638 Ga0207675_101026038
639 Ga0207675_101594716
640 Ga0207683_10297730
641 Ga0207683_10372016
642 Ga0209968_1019486
643 Ga0209999_1005816
644 Ga0210002_1044988
645 Ga0209966_1006448
646 Ga0209998_10000630
647 Ga0209813_10000706
648 Ga0209813_10015947
649 Ga0209813_10248842
650 Ga0209974_10039003
651 Ga0209974_10137624
652 Ga0207428_10053498
653 Ga0207428_10385882
654 Ga0268266_10629048
655 Ga0268265_10027638
656 Ga0268265_11180279
657 Ga0268264_10710932
658 Ga0268264_10854147
659 Ga0265316_10894051
660 Ga0265314_10103548
661 Ga0307412_10497107
662 Ga0373930_0169706
663 Ga0373959_0050020
664 Ga0373938_0119853
665 Ga0373928_0019886
666 Ga0373929_0218368
667 Ga0373940_0003481
668 Ga0373940_0004403
669 Ga0373949_0064362
670 Ga0373952_0012404
671 Ga0373923_0035392
672 Ga0373932_0008898
673 Ga0373939_0048230
674 Ga0373941_0009250
675 Ga0373957_0105556
676 Ga0373960_0053223
677 Ga0373943_0157437
678 Ga0373946_0440298
679 Ga0373955_0609933
680 Ga0373942_0096866
681 Ga0373961_0068184
682 Ga0373962_0008484
683 Ga0373924_0008133
684 Ga0373931_0003950
685 Ga0373931_0020742
686 Ga0373935_0099652
687 Ga0373927_0082739
688 Ga0373927_0286731
689 Ga0373933_0049252
690 Ga0373947_0734577
691 Ga0373937_0256900
692 Ga0373925_0288765
693 Ga0436364_0216860
694 Ga0436364_1348904
695 Ga0436365_0850190
696 Ga0436365_1063132
697 Ga0439464_0242072
698 Ga0466966_0267274
699 Ga0495592_0016075
700 Ga0495629_0067407
701 Ga0495651_0066364
702 Ga0495651_0137159
703 Ga0495582_0108037
704 Ga0495664_0024569
705 Ga0495584_0115739
706 Ga0495618_0061376
707 Ga0495630_0586885
708 Ga0495652_0495817
709 Ga0495640_0242248
710 Ga0495645_0184362
711 Ga0495667_0374313
712 Ga0495634_0022061
713 Ga0495635_0067183
714 Ga0495657_0255737
715 Ga0495599_0288547
716 Ga0495623_0197719
717 Ga0495646_0023655
718 Ga0495647_0079280
719 Ga0495658_0024869
720 Ga0495613_0035070
721 Ga0495600_0034884
722 Ga0495581_0193700
723 Ga0495604_0024263
724 Ga0495674_0394160
725 Ga0495675_0113601
726 Ga0495593_0269324
727 Ga0495602_0011196
728 Ga0495602_1054705
729 Ga0495614_0120766
730 Ga0496100_0315899
731 Ga0496101_0947223
732 Ga0496104_0012172
733 Ga0496106_0119911
734 Ga0496107_0559344
735 Ga0496108_0118709
736 Ga0496108_0993343
737 Ga0496109_0105296
738 Ga0496109_0140814
739 Ga0496110_0155901
740 Ga0496110_1085140
741 Ga0496111_0416240
742 Ga0496112_0233403
743 Ga0496112_0281634
744 Ga0496113_0827886
745 Ga0496114_0412906
746 Ga0496115_0095527
747 Ga0496115_0391488
748 Ga0496115_0712421
749 Ga0496117_0086673
750 Ga0496118_0132216
751 Ga0496122_0145628
752 Ga0496123_0084579
753 Ga0496125_0093020
754 Ga0496126_0057164
755 Ga0496126_0150523
756 Ga0496126_0846920
757 Ga0496126_1234505
758 Ga0501033_0417759
759 Ga0501033_0653329
760 Ga0501034_0019428
761 Ga0501036_0017561
762 Ga0501037_0009184
763 Ga0501038_0022007
764 Ga0501039_0083327
765 Ga0501039_0641696
766 Ga0501040_0211396
767 Ga0501040_0946573
768 Ga0501041_0036376
769 Ga0501042_0259277
770 Ga0501042_0450797
771 Ga0501043_0015469
772 Ga0501043_1024165
773 Ga0501046_0196460
774 Ga0501048_0086227
775 Ga0501048_0258894
776 Ga0501068_0204974
777 Ga0501068_0777284
778 Ga0501069_0286336
779 Ga0501070_0112108
780 Ga0501070_0236846
781 Ga0501070_0910077
782 Ga0501071_0031619
783 Ga0501071_0550476
784 Ga0501071_1001214
785 Ga0501071_1063238
786 Ga0501072_0369007
787 Ga0501073_0144121
788 Ga0501073_0702279
789 Ga0501074_0063730
790 Ga0501075_0087433
791 Ga0501075_0246343
792 Ga0501076_0012239
793 Ga0501076_0202548
794 Ga0501077_0060416
795 Ga0501079_0013717
796 Ga0501079_0015930
797 Ga0501079_0227438
798 Ga0501079_0721479
799 Ga0501079_1509805
800 Ga0501080_0019089
801 Ga0501080_0038671
802 Ga0501081_0068746
803 Ga0501083_0091987
804 Ga0501083_0335781
805 Ga0501035_0010864
806 Ga0501035_0327134
807 Ga0501044_0119504
808 Ga0501045_0144899
809 Ga0501045_0293702
810 nmdc:mga03n38_127678_c1
811 nmdc:mga03n38_216989_c1
812 nmdc:mga00v17_234175_c1
813 nmdc:mga00v17_60343_c1
814 nmdc:mga00v17_7284_c1
815 nmdc:mga00v17_733080_c1
816 nmdc:mga0yw44_21331_c1
817 nmdc:mga0yw44_536340_c1
818 nmdc:mga0yw44_61416_c1
819 nmdc:mga0yw44_6229_c1
820 nmdc:mga06z11_19927_c1
821 nmdc:mga06z11_21441_c1
822 nmdc:mga06z11_218994_c1
823 nmdc:mga06z11_37619_c1
824 nmdc:mga04h51_1368_c1
825 nmdc:mga04h51_15317_c1
826 nmdc:mga04h51_280438_c1
827 nmdc:mga04h51_8042_c1
828 nmdc:mga07m45_201490_c1
829 nmdc:mga07m45_582635_c1
830 nmdc:mga05p37_24547_c1
831 nmdc:mga05p37_58068_c1
832 nmdc:mga05p37_776645_c1
833 nmdc:mga09592_1216317_c1
834 nmdc:mga09592_193733_c1
835 nmdc:mga09592_274269_c1
836 nmdc:mga0qj67_46869_c1
837 nmdc:mga06r32_14779_c1
838 nmdc:mga06r32_1596505_c1
839 nmdc:mga08y16_11176_c1
840 nmdc:mga08y16_115554_c1
841 nmdc:mga08y16_271065_c1
842 nmdc:mga08y16_461504_c1
843 nmdc:mga0n895_106130_c1
844 nmdc:mga0n895_1341825_c1
845 nmdc:mga0n895_87445_c1
846 nmdc:mga0rr50_10248_c1
847 nmdc:mga0rr50_37107_c1
848 nmdc:mga08x19_201472_c1
849 nmdc:mga0a205_2816_c1
850 Ga0495601_0130487
851 Ga0495612_0157785
852 Ga0495595_0104747
853 Ga0495619_0226707
854 Ga0500642_0045189
855 Ga0500642_0205800
856 Ga0500616_0193651
857 Ga0501084_0008653
858 Ga0501084_0161973
859 Ga0501084_1738779
860 Ga0587101_054285
861 Ga0501082_0020564
862 Ga0501082_0110295
863 Ga0501082_0254636
864 Ga0501082_0264310
865 Ga0501082_0440871
866 Ga0530510_0040804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

21

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.9154 19 105
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.8914 19 105
8bxa-assembly1.cif.gz_A crystal structure of ribosome binding factor a (rbfa) from s. aureus 0.8645 15 108
2r1c-assembly1.cif.gz_A coordinates of the thermus thermophilus ribosome binding factor a (rbfa) homology model as fitted into the cryo-em map of a 30s-rbfa complex 0.8526 24 106
7nav-assembly1.cif.gz_V bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) 0.8475 18 105
ID Description Score Start End Superfamily
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8914 19 105 3.30.300.20
af_Q8SXX0_83_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8547 17 106 3.30.300.20
af_Q9V9P5_95_443_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.8529 49 71 2.130.10.120
af_A0A0G2K1B0_81_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8373 18 105 3.30.300.20
af_Q8I516_410_512_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8171 17 106 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A257LQE8-F1-model_v4 Ribosome-binding factor A 0.977 18 106 GO:0005829
GO:0006364
GO:0043024
AF-A0A554IUA9-F1-model_v4 Ribosome-binding factor A 0.9172 16 105 GO:0006364
AF-A0A662EV71-F1-model_v4 Ribosome-binding factor A 0.9119 17 106 GO:0005829
GO:0030490
GO:0043024
AF-A0A1F8WFE5-F1-model_v4 Ribosome-binding factor A 0.9116 18 106 GO:0005829
GO:0030490
GO:0043024
AF-A0A2E2SSR2-F1-model_v4 Ribosome-binding factor A 0.9087 16 105 GO:0006364

Map