metagRoot

F442946

General Info

Members	Datasets	Scaffolds	Average Seq Length
433	272	380	243

Family's Representative Sequence

Representative Sequence	3300049593\|Ga0501077_0269871\|Ga0501077_0269871_209_1069
Length	286
Sequence	LRLRVDRVDPATRAHEHDGGLSHDQRGDDAEGQAEPLEHQADDMRVAIASDIHGNKQAFQAVIRAAEADGADELWCLGDLVGYGGEPDACVSLAAAHCTICLAGNHDLAVVDVLSLEDFSRGAALAAQWTREVITEETREYLLSLKPQGSSEGVGLFHASPRDPIWEYVLSALAAELCFDATDHRISFIGHSHVALSFDRPEGEPASGTTRREGVQVDLMAGEWLINPGSAGQPRDGDARAAWLVLDTNDMTATWRRAEYDIAGAQAAIRAANLPDSLAERLQYGQ

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
3	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
4	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
5	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
6	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
7	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
8	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
9	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
10	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
11	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
12	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
13	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
14	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
15	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
16	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
17	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
18	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
19	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
20	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
21	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
22	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
23	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
24	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
25	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
26	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
27	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
28	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
29	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
30	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
31	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
32	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
33	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
34	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
35	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
36	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
37	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
38	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
39	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
40	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
41	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
42	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
43	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
44	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
45	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
46	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
47	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
48	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
49	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
50	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
51	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
52	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
53	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
54	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
55	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
56	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
57	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
58	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
59	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
60	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
61	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
62	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
63	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
64	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
65	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
66	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
67	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
68	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
69	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
70	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
71	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
72	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
73	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
74	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
75	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
76	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
77	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
78	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
79	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
81	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
82	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
83	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
84	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
86	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
87	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
89	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
90	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
91	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
94	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
95	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
96	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
97	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
98	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
99	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
102	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
103	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
104	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
105	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
106	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
149	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
150	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
151	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
152	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
153	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
154	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
155	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
156	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
157	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
158	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
159	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
160	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
161	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
162	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
163	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
164	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
165	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
166	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
167	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
168	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
169	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
170	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
171	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
172	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
173	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
174	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
175	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
176	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
177	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
178	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
179	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
180	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
181	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
182	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
183	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
184	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
185	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
186	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
187	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
188	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
189	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
190	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
191	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
192	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
193	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
194	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
195	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
196	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
197	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
198	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
199	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
200	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
201	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
202	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
203	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
204	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
205	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
206	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
207	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
208	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
209	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
210	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
211	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
227	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
230	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
235	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
238	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
239	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
240	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
241	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
242	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
243	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
244	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
245	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
246	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
247	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
248	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
249	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
250	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
251	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
252	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
253	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
254	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
255	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
256	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
257	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
258	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
259	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
260	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
261	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
262	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
263	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
264	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
265	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
266	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
267	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
268	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
269	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
270	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
271	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
272	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	87.07
Metatranscriptomes	0.69
Isolates	12.24

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.31
Nodule	12.24
Rhizoplane	4.16
Rhizosphere	79.21
Stem	0
Stem Tuber	0
Unclassified	2.08

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10010926	3300001979	Bacteria	3471
2	rootH2_10055832	3300003320	Bacteria	2015
3	Ga0070658_10011464	3300005327	Bacteria	7108
4	Ga0070658_10352528	3300005327	Unclassified	1260
5	Ga0070683_100000682	3300005329	Bacteria	24589
6	Ga0070666_10323738	3300005335	Bacteria	1100
7	Ga0070682_100129217	3300005337	Bacteria	1708
8	Ga0070682_100133714	3300005337	Bacteria	1682
9	Ga0068868_100033821	3300005338	Bacteria	3943
10	Ga0068868_100488962	3300005338	Bacteria	1076
11	Ga0070660_100215097	3300005339	Bacteria	1561
12	Ga0070661_100039253	3300005344	Bacteria	3450
13	Ga0070692_10132749	3300005345	Bacteria	1401
14	Ga0070692_10201545	3300005345	Bacteria	1166
15	Ga0070668_100116011	3300005347	Bacteria	2135
16	Ga0070668_100351253	3300005347	Bacteria	1248
17	Ga0070669_100362444	3300005353	Bacteria	1179
18	Ga0070675_100482955	3300005354	Bacteria	1115
19	Ga0070674_100114863	3300005356	Bacteria	1983
20	Ga0070659_100221225	3300005366	Bacteria	1563
21	Ga0070714_100000228	3300005435	Bacteria	44348
22	Ga0070713_100051283	3300005436	Bacteria	3412
23	Ga0070713_100221388	3300005436	Bacteria	1717
24	Ga0070700_100076675	3300005441	Bacteria	2147
25	Ga0070700_100124030	3300005441	Bacteria	1734
26	Ga0070663_100083342	3300005455	Bacteria	2354
27	Ga0070663_100096777	3300005455	Bacteria	2196
28	Ga0070678_100026241	3300005456	Bacteria	3936
29	Ga0070662_100057795	3300005457	Bacteria	2820
30	Ga0070681_10082518	3300005458	Bacteria	3170
31	Ga0068867_100306606	3300005459	Bacteria	1311
32	Ga0070685_10051007	3300005466	Bacteria	2392
33	Ga0070699_100353038	3300005518	Bacteria	1325
34	Ga0070684_100008210	3300005535	Bacteria	8157
35	Ga0070684_100372103	3300005535	Unclassified	1316
36	Ga0070697_100376116	3300005536	Bacteria	1230
37	Ga0068853_100623061	3300005539	Bacteria	1025
38	Ga0070672_100335448	3300005543	Bacteria	1287
39	Ga0070693_100369733	3300005547	Bacteria	986
40	Ga0070665_100006209	3300005548	Bacteria	12225
41	Ga0070665_100181103	3300005548	Bacteria	2108
42	Ga0070704_100262600	3300005549	Bacteria	1423
43	Ga0070664_100374000	3300005564	Bacteria	1299
44	Ga0068854_100000136	3300005578	Bacteria	51080
45	Ga0068854_100231446	3300005578	Bacteria	1467
46	Ga0068856_100000577	3300005614	Bacteria	40018
47	Ga0068856_100076691	3300005614	Bacteria	3311
48	Ga0070702_100105936	3300005615	Bacteria	1734
49	Ga0070702_100134031	3300005615	Bacteria	1569
50	Ga0070702_100289610	3300005615	Bacteria	1128
51	Ga0068852_100126868	3300005616	Bacteria	2345
52	Ga0068852_100224009	3300005616	Bacteria	1790
53	Ga0068864_100196308	3300005618	Bacteria	1852
54	Ga0068861_100062568	3300005719	Bacteria	2859
55	Ga0068861_100368340	3300005719	Bacteria	1265
56	Ga0068851_10113219	3300005834	Bacteria	1451
57	Ga0068860_100676320	3300005843	Bacteria	1041
58	Ga0068862_100102294	3300005844	Bacteria	2508
59	Ga0068862_100326370	3300005844	Bacteria	1418
60	Ga0081455_10228386	3300005937	Bacteria	1375
61	Ga0081538_10055430	3300005981	Bacteria	2334
62	Ga0081538_10073211	3300005981	Bacteria	1874
63	Ga0081539_10003769	3300005985	Bacteria	17944
64	Ga0097621_100373612	3300006237	Bacteria	1272
65	Ga0068871_100387783	3300006358	Bacteria	1242
66	Ga0075428_100259875	3300006844	Bacteria	1870
67	Ga0075428_100333866	3300006844	Bacteria	1628
68	Ga0075430_100033611	3300006846	Bacteria	4352
69	Ga0068865_100349711	3300006881	Bacteria	1197
70	Ga0111539_10485678	3300009094	Bacteria	1439
71	Ga0105245_10001844	3300009098	Bacteria	19294
72	Ga0105245_10016766	3300009098	Bacteria	6397
73	Ga0105245_10114300	3300009098	Bacteria	2514
74	Ga0105245_10199461	3300009098	Bacteria	1921
75	Ga0105247_10000393	3300009101	Bacteria	37140
76	Ga0105247_10060619	3300009101	Bacteria	2345
77	Ga0114129_10178035	3300009147	Bacteria	2895
78	Ga0114129_10493050	3300009147	Bacteria	1601
79	Ga0114129_10557537	3300009147	Bacteria	1489
80	Ga0105243_10162993	3300009148	Bacteria	1924
81	Ga0105243_10167522	3300009148	Bacteria	1900
82	Ga0105242_10019660	3300009176	Bacteria	5293
83	Ga0105248_10425437	3300009177	Bacteria	1495
84	Ga0105248_10511503	3300009177	Bacteria	1354
85	Ga0105237_10687020	3300009545	Bacteria	1030
86	Ga0105249_10410358	3300009553	Bacteria	1386
87	Ga0105249_10521158	3300009553	Bacteria	1236
88	Ga0105246_10704015	3300011119	Unclassified	886
89	Ga0157371_10273370	3300013102	Bacteria	1220
90	Ga0157370_10016596	3300013104	Bacteria	7450
91	Ga0157370_10176945	3300013104	Bacteria	1983
92	Ga0157369_10241588	3300013105	Bacteria	1886
93	Ga0157369_10406153	3300013105	Bacteria	1413
94	Ga0163162_10212147	3300013306	Bacteria	2066
95	Ga0163162_10536845	3300013306	Unclassified	1298
96	Ga0157372_10000129	3300013307	Bacteria	82491
97	Ga0157372_10041943	3300013307	Bacteria	5060
98	Ga0157372_10361772	3300013307	Bacteria	1691
99	Ga0157372_11019167	3300013307	Bacteria	959
100	Ga0157375_10263574	3300013308	Bacteria	1885
101	Ga0157380_10104482	3300014326	Bacteria	2366
102	Ga0157380_10187433	3300014326	Bacteria	1823
103	Ga0157377_10021936	3300014745	Bacteria	3365
104	Ga0157377_10188736	3300014745	Bacteria	1301
105	Ga0206356_10953772	3300020070	Bacteria	2082
106	Ga0206354_10429724	3300020081	Bacteria	1965
107	Ga0206353_11269881	3300020082	Bacteria	1279
108	Ga0213875_10012685	3300021388	Bacteria	4150
109	Ga0207426_1017731	3300025302	Bacteria	2524
110	Ga0207426_1069670	3300025302	Bacteria	985
111	Ga0207656_10058253	3300025321	Bacteria	1687
112	Ga0207642_10062351	3300025899	Bacteria	1738
113	Ga0207710_10000195	3300025900	Bacteria	57216
114	Ga0207688_10106646	3300025901	Bacteria	1623
115	Ga0207699_10139587	3300025906	Bacteria	1591
116	Ga0207643_10104118	3300025908	Bacteria	1666
117	Ga0207705_10032112	3300025909	Bacteria	3751
118	Ga0207707_10092751	3300025912	Bacteria	2639
119	Ga0207671_10486264	3300025914	Bacteria	984
120	Ga0207693_10037443	3300025915	Bacteria	3823
121	Ga0207662_10055744	3300025918	Bacteria	2359
122	Ga0207662_10226095	3300025918	Bacteria	1220
123	Ga0207657_10053408	3300025919	Bacteria	3500
124	Ga0207657_10114947	3300025919	Bacteria	2218
125	Ga0207657_10159596	3300025919	Bacteria	1832
126	Ga0207657_10193260	3300025919	Bacteria	1641
127	Ga0207649_10328681	3300025920	Bacteria	1125
128	Ga0207646_10043068	3300025922	Bacteria	4055
129	Ga0207687_10000985	3300025927	Bacteria	19335
130	Ga0207687_10049097	3300025927	Bacteria	2933
131	Ga0207687_10052117	3300025927	Bacteria	2855
132	Ga0207700_10218734	3300025928	Bacteria	1614
133	Ga0207664_10000060	3300025929	Bacteria	116764
134	Ga0207706_10190756	3300025933	Bacteria	1799
135	Ga0207686_10009391	3300025934	Bacteria	5306
136	Ga0207709_10296295	3300025935	Bacteria	1201
137	Ga0207669_10208730	3300025937	Bacteria	1424
138	Ga0207704_10096952	3300025938	Bacteria	1954
139	Ga0207704_10186586	3300025938	Bacteria	1504
140	Ga0207665_10057648	3300025939	Bacteria	2624
141	Ga0207711_10284291	3300025941	Bacteria	1524
142	Ga0207689_10109821	3300025942	Bacteria	2266
143	Ga0207661_10033486	3300025944	Bacteria	3989
144	Ga0207661_10248896	3300025944	Bacteria	1579
145	Ga0207679_10116942	3300025945	Unclassified	2115
146	Ga0207679_10125075	3300025945	Bacteria	2053
147	Ga0207712_10423320	3300025961	Bacteria	1124
148	Ga0207668_10134004	3300025972	Bacteria	1896
149	Ga0207668_10307823	3300025972	Bacteria	1310
150	Ga0207640_10000015	3300025981	Bacteria	215411
151	Ga0207640_10102801	3300025981	Bacteria	2007
152	Ga0207640_10123994	3300025981	Bacteria	1856
153	Ga0207677_10148437	3300026023	Bacteria	1805
154	Ga0207639_10093805	3300026041	Bacteria	2408
155	Ga0207678_10064834	3300026067	Bacteria	3139
156	Ga0207678_10128017	3300026067	Bacteria	2166
157	Ga0207708_10001594	3300026075	Bacteria	16904
158	Ga0207708_10010204	3300026075	Bacteria	6972
159	Ga0207708_10071726	3300026075	Bacteria	2654
160	Ga0207702_10000060	3300026078	Bacteria	125473
161	Ga0207702_10085323	3300026078	Bacteria	2751
162	Ga0207702_10352354	3300026078	Bacteria	1409
163	Ga0207702_10559381	3300026078	Bacteria	1119
164	Ga0207648_10363821	3300026089	Bacteria	1305
165	Ga0207676_10204748	3300026095	Bacteria	1746
166	Ga0207675_100025908	3300026118	Bacteria	5457
167	Ga0207675_100399319	3300026118	Archaea	1354
168	Ga0207683_10163985	3300026121	Bacteria	2010
169	Ga0207683_10192235	3300026121	Bacteria	1853
170	Ga0207698_10337189	3300026142	Bacteria	1419
171	Ga0207698_10489564	3300026142	Bacteria	1195
172	Ga0268266_10014029	3300028379	Bacteria	6898
173	Ga0268266_10434340	3300028379	Bacteria	1246
174	Ga0265319_1000025	3300028563	Bacteria	142639
175	Ga0265319_1001581	3300028563	Bacteria	13345
176	Ga0265319_1013408	3300028563	Bacteria	3261
177	Ga0265318_10001571	3300028577	Bacteria	13227
178	Ga0265338_10000473	3300028800	Bacteria	71777
179	Ga0265338_10117844	3300028800	Bacteria	2123
180	Ga0265338_10161710	3300028800	Bacteria	1729
181	Ga0265320_10013971	3300031240	Bacteria	4598
182	Ga0265320_10081755	3300031240	Bacteria	1507
183	Ga0307408_100470737	3300031548	Bacteria	1094
184	Ga0265313_10082460	3300031595	Bacteria	1457
185	Ga0307405_10039101	3300031731	Bacteria	2865
186	Ga0307413_10031091	3300031824	Bacteria	3008
187	Ga0307413_10177115	3300031824	Bacteria	1516
188	Ga0307413_10533821	3300031824	Bacteria	948
189	Ga0307406_10020199	3300031901	Bacteria	3919
190	Ga0307406_10032284	3300031901	Bacteria	3196
191	Ga0307406_10124343	3300031901	Bacteria	1799
192	Ga0307406_10214298	3300031901	Bacteria	1427
193	Ga0307407_10079562	3300031903	Bacteria	1978
194	Ga0307407_10131523	3300031903	Bacteria	1602
195	Ga0307412_10428381	3300031911	Bacteria	1084
196	Ga0307409_100142195	3300031995	Bacteria	2069
197	Ga0307409_100361697	3300031995	Bacteria	1373
198	Ga0307409_100675529	3300031995	Bacteria	1029
199	Ga0307416_100004052	3300032002	Bacteria	8756
200	Ga0307416_100286897	3300032002	Bacteria	1627
201	Ga0307416_100294295	3300032002	Bacteria	1609
202	Ga0307416_100799603	3300032002	Bacteria	1039
203	Ga0307414_10208513	3300032004	Bacteria	1595
204	Ga0307414_10596461	3300032004	Bacteria	990
205	Ga0307411_10041925	3300032005	Bacteria	2917
206	Ga0307415_100003888	3300032126	Bacteria	7674
207	Ga0307415_100060400	3300032126	Bacteria	2619
208	Ga0307415_100106488	3300032126	Bacteria	2070
209	Ga0307415_100143742	3300032126	Bacteria	1826
210	Ga0307415_100363497	3300032126	Bacteria	1223
211	Ga0307415_100486979	3300032126	Bacteria	1075
212	Ga0395898_0058664	3300037466	Bacteria	3746
213	Ga0395898_0315305	3300037466	Bacteria	1492
214	Ga0395905_0902031	3300037471	Bacteria	787
215	Ga0436364_0125472	3300037853	Bacteria	13181
216	Ga0395901_0080159	3300038443	Bacteria	3408
217	Ga0395901_1037357	3300038443	Bacteria	794
218	Ga0436365_1276606	3300039437	Bacteria	1945
219	Ga0436365_1438651	3300039437	Bacteria	1326
220	Ga0436363_1483349	3300039450	Bacteria	1621
221	Ga0436362_0826062	3300039453	Bacteria	2975
222	Ga0451791_0898074	3300041451	Bacteria	1144
223	Ga0451807_2761604	3300041486	Bacteria	1200
224	Ga0451833_0586035	3300041491	Bacteria	1060
225	Ga0439454_015775	3300042011	Bacteria	1061
226	Ga0450900_010668	3300042136	Bacteria	1181
227	Ga0439435_0010464	3300042436	Bacteria	2203
228	Ga0439440_0044599	3300042993	Bacteria	1091
229	Ga0466969_0034844	3300044656	Bacteria	2549
230	Ga0466965_0114666	3300044683	Bacteria	1387
231	Ga0466966_0037047	3300044684	Bacteria	3147
232	Ga0466966_0092544	3300044684	Bacteria	1876
233	Ga0466966_0099221	3300044684	Unclassified	1802
234	Ga0466966_0154236	3300044684	Bacteria	1400
235	Ga0466961_0001354	3300044693	Bacteria	15106
236	Ga0466961_0007269	3300044693	Bacteria	7045
237	Ga0466961_0428851	3300044693	Bacteria	801
238	Ga0466963_0000273	3300044694	Bacteria	22985
239	Ga0466963_0001512	3300044694	Bacteria	12575
240	Ga0466963_0010607	3300044694	Bacteria	5585
241	Ga0466963_0021787	3300044694	Bacteria	4048
242	Ga0466963_0024565	3300044694	Bacteria	3837
243	Ga0466963_0026646	3300044694	Bacteria	3697
244	Ga0466963_0164254	3300044694	Bacteria	1546
245	Ga0466963_0566151	3300044694	Bacteria	802
246	Ga0466964_0201889	3300044706	Bacteria	955
247	Ga0466964_0269862	3300044706	Bacteria	846
248	Ga0466971_0001423	3300044719	Bacteria	10052
249	Ga0466971_0028101	3300044719	Bacteria	2518
250	Ga0466971_0039776	3300044719	Bacteria	2111
251	Ga0466971_0052844	3300044719	Bacteria	1830
252	Ga0466971_0239428	3300044719	Unclassified	863
253	Ga0466970_0030181	3300044765	Bacteria	2858
254	Ga0466957_0023879	3300044842	Bacteria	3617
255	Ga0466957_0028303	3300044842	Bacteria	3336
256	Ga0466957_0060681	3300044842	Bacteria	2319
257	Ga0466957_0062748	3300044842	Bacteria	2283
258	Ga0466957_0085310	3300044842	Bacteria	1972
259	Ga0466957_0453768	3300044842	Bacteria	884
260	Ga0466957_0593315	3300044842	Bacteria	775
261	Ga0466960_0103611	3300044901	Unclassified	1469
262	Ga0466959_0008059	3300045049	Bacteria	7426
263	Ga0466959_0016350	3300045049	Bacteria	5420
264	Ga0466959_0020414	3300045049	Bacteria	4881
265	Ga0466959_0023017	3300045049	Bacteria	4608
266	Ga0466959_0080618	3300045049	Bacteria	2346
267	Ga0466959_0341258	3300045049	Bacteria	1022
268	Ga0451576_0446741	3300045051	Bacteria	1357
269	Ga0466958_0002323	3300045836	Bacteria	9488
270	Ga0466958_0055103	3300045836	Bacteria	2412
271	Ga0466958_0157799	3300045836	Bacteria	1432
272	Ga0466958_0233663	3300045836	Unclassified	1174
273	Ga0466967_0019491	3300045976	Bacteria	5455
274	Ga0466967_0023308	3300045976	Bacteria	5069
275	Ga0466967_0057065	3300045976	Bacteria	3445
276	Ga0466967_0101965	3300045976	Bacteria	2624
277	Ga0466967_0102400	3300045976	Bacteria	2619
278	Ga0466967_0160863	3300045976	Bacteria	2107
279	Ga0466967_0215877	3300045976	Unclassified	1821
280	Ga0466967_0255597	3300045976	Bacteria	1675
281	Ga0466967_0262219	3300045976	Bacteria	1653
282	Ga0466967_0316219	3300045976	Bacteria	1505
283	Ga0466967_0925054	3300045976	Bacteria	867
284	Ga0466967_0947894	3300045976	Bacteria	856
285	Ga0495585_0078714	3300046492	Bacteria	1788
286	Ga0495630_0068318	3300046517	Bacteria	2672
287	Ga0495637_0096649	3300046520	Bacteria	1159
288	Ga0495643_0091693	3300046522	Bacteria	1567
289	Ga0495652_0048094	3300046529	Bacteria	3657
290	Ga0495587_0030601	3300046536	Bacteria	3264
291	Ga0495611_0094711	3300046648	Bacteria	1382
292	Ga0496103_0202339	3300048906	Bacteria	1277
293	Ga0496104_0000001	3300048907	Bacteria	711867
294	Ga0496104_0000004	3300048907	Bacteria	641830
295	Ga0496104_0277217	3300048907	Bacteria	1590
296	Ga0496105_0000001	3300048908	Bacteria	1328178
297	Ga0496106_0042266	3300048909	Bacteria	3418
298	Ga0496106_0325218	3300048909	Bacteria	1234
299	Ga0496107_0322460	3300048910	Bacteria	1150
300	Ga0496108_0299662	3300048911	Bacteria	1400
301	Ga0496108_0385135	3300048911	Bacteria	1224
302	Ga0496108_0608726	3300048911	Bacteria	952
303	Ga0496109_0381250	3300048912	Bacteria	1332
304	Ga0496110_0000039	3300048913	Bacteria	63169
305	Ga0496110_0493666	3300048913	Bacteria	1115
306	Ga0496111_0000066	3300048914	Bacteria	42994
307	Ga0496112_0352469	3300048915	Bacteria	1414
308	Ga0496116_0071736	3300048919	Bacteria	2192
309	Ga0496121_0002905	3300048924	Bacteria	25149
310	Ga0501031_0158359	3300049568	Bacteria	1480
311	Ga0501031_0267119	3300049568	Bacteria	1111
312	Ga0501034_0004589	3300049571	Bacteria	15299
313	Ga0501034_0321847	3300049571	Bacteria	1479
314	Ga0501036_0034674	3300049572	Bacteria	4269
315	Ga0501036_0038817	3300049572	Bacteria	4031
316	Ga0501036_0275214	3300049572	Unclassified	1409
317	Ga0501038_0177481	3300049574	Bacteria	1721
318	Ga0501038_0273288	3300049574	Bacteria	1332
319	Ga0501039_0016450	3300049575	Bacteria	5666
320	Ga0501040_0087568	3300049576	Bacteria	2162
321	Ga0501040_0097472	3300049576	Bacteria	2049
322	Ga0501041_0007935	3300049577	Bacteria	6241
323	Ga0501041_0022140	3300049577	Bacteria	3806
324	Ga0501042_0006520	3300049578	Bacteria	7582
325	Ga0501042_0057434	3300049578	Bacteria	2777
326	Ga0501042_0061084	3300049578	Unclassified	2692
327	Ga0501042_0200417	3300049578	Archaea	1439
328	Ga0501046_0064104	3300049580	Bacteria	2869
329	Ga0501046_0155394	3300049580	Bacteria	1724
330	Ga0501047_0056520	3300049581	Bacteria	3795
331	Ga0501047_0471041	3300049581	Bacteria	1084
332	Ga0501048_0074845	3300049582	Bacteria	2389
333	Ga0501048_0232400	3300049582	Bacteria	1308
334	Ga0501067_0063321	3300049583	Bacteria	2048
335	Ga0501068_0335593	3300049584	Bacteria	970
336	Ga0501070_0025291	3300049586	Bacteria	4978
337	Ga0501071_0024375	3300049587	Bacteria	4232
338	Ga0501071_0148005	3300049587	Unclassified	1750
339	Ga0501072_0019166	3300049588	Bacteria	5285
340	Ga0501072_0028293	3300049588	Bacteria	4376
341	Ga0501072_0063673	3300049588	Bacteria	2909
342	Ga0501072_0271411	3300049588	Bacteria	1349
343	Ga0501072_0431838	3300049588	Bacteria	1044
344	Ga0501073_0332584	3300049589	Bacteria	1049
345	Ga0501074_0017998	3300049590	Bacteria	5133
346	Ga0501074_0216951	3300049590	Bacteria	1362
347	Ga0501075_0071915	3300049591	Bacteria	2614
348	Ga0501076_0024186	3300049592	Bacteria	4692
349	Ga0501077_0269871	3300049593	Bacteria	1082
350	Ga0501079_0067232	3300049741	Bacteria	2766
351	Ga0501079_0107810	3300049741	Bacteria	2162
352	Ga0501080_0000535	3300049742	Bacteria	29918
353	Ga0501080_0201208	3300049742	Bacteria	1829
354	Ga0501081_0291215	3300049743	Unclassified	1197
355	Ga0501044_0472922	3300049823	Bacteria	1157
356	Ga0501045_0178629	3300049824	Bacteria	1581
357	nmdc:mga0yw44_50263_c1	3300050492	Bacteria	2520
358	nmdc:mga06z11_18398_c1	3300050494	Bacteria	3191
359	nmdc:mga05p37_50311_c1	3300050507	Bacteria	5124
360	nmdc:mga09592_77833_c1	3300050508	Bacteria	2821
361	nmdc:mga08y16_167408_c1	3300050511	Bacteria	2283
362	nmdc:mga08y16_52169_c1	3300050511	Bacteria	4279
363	nmdc:mga08y16_565548_c1	3300050511	Bacteria	1149
364	nmdc:mga08y16_82880_c1	3300050511	Bacteria	3343
365	nmdc:mga0a205_448409_c1	3300050515	Bacteria	1150
366	Ga0500647_0034605	3300053091	Bacteria	2412
367	Ga0500557_000109	3300053105	Bacteria	24675
368	Ga0500597_061225	3300053120	Bacteria	1618
369	Ga0500642_0000063	3300053130	Bacteria	58680
370	Ga0500568_0075399	3300053139	Unclassified	1286
371	Ga0500601_014788	3300053737	Bacteria	886
372	Ga0501084_0126872	3300054114	Bacteria	2147
373	Ga0501082_0113313	3300060353	Unclassified	2348
374	Ga0501082_0150046	3300060353	Bacteria	2024
375	Ga0501082_0589761	3300060353	Bacteria	972
376	Ga0466962_0022656	3300061719	Bacteria	3019
377	Ga0466962_0030756	3300061719	Bacteria	2571
378	Ga0530510_0023703	3300061734	Bacteria	4376
379	Ga0530510_0042277	3300061734	Bacteria	3292
380	Ga0530510_0087617	3300061734	Unclassified	2268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005614	Ga0068856_100000577	Ga0068856_10000057743	210
2	3300026078	Ga0207702_10000060	Ga0207702_1000006060	210
3	3300048919	Ga0496116_0071736	Ga0496116_0071736_14_673	213
4	3300050494	nmdc:mga06z11_18398_c1	nmdc:mga06z11_18398_c1_24_683	213
5	3300032126	Ga0307415_100143742	Ga0307415_1001437421	226
6	3300044694	Ga0466963_0164254	Ga0466963_0164254_86_817	229
7	3300013307	Ga0157372_10041943	Ga0157372_100419433	232
8	3300026089	Ga0207648_10363821	Ga0207648_103638212	232
9	3300045976	Ga0466967_0255597	Ga0466967_0255597_682_1413	233
10	3300003320	rootH2_10055832	rootH2_100558322	236
11	3300005329	Ga0070683_100000682	Ga0070683_10000068214	236
12	3300005458	Ga0070681_10082518	Ga0070681_100825183	236
13	3300005535	Ga0070684_100008210	Ga0070684_1000082105	236
14	3300013105	Ga0157369_10241588	Ga0157369_102415882	236
15	3300020081	Ga0206354_10429724	Ga0206354_104297242	236
16	3300020082	Ga0206353_11269881	Ga0206353_112698812	236
17	3300025912	Ga0207707_10092751	Ga0207707_100927513	236
18	3300045976	Ga0466967_0215877	Ga0466967_0215877_1044_1754	236
19	3300050511	nmdc:mga08y16_52169_c1	nmdc:mga08y16_52169_c1_3342_4070	236
20	iso_pu_bacteria	2507262055	2507510054	236
21	iso_pu_bacteria	2508501009	2508544056	236
22	iso_pu_bacteria	2508501042	2508698009	236
23	iso_pu_bacteria	2515154112	2515629441	236
24	iso_pu_bacteria	2874590934	2874596801	236
25	iso_pu_bacteria	2874645413	2874652969	236
26	iso_pu_bacteria	2876771140	2876776903	236
27	iso_pu_bacteria	2876818435	2876825347	236
28	iso_pu_bacteria	2879074833	2879081040	236
29	iso_pu_bacteria	2879127579	2879130778	236
30	iso_pu_bacteria	2879142872	2879147633	236
31	iso_pu_bacteria	2935608549	2935611040	236
32	iso_pu_bacteria	2935648319	2935648476	236
33	iso_pu_bacteria	2935656913	2935657536	236
34	iso_pu_bacteria	2935769743	2935771454	236
35	iso_pu_bacteria	2935785616	2935788347	236
36	iso_pu_bacteria	2935793552	2935800884	236
37	iso_pu_bacteria	2935819856	2935820525	236
38	iso_pu_bacteria	2935847175	2935849466	236
39	iso_pu_bacteria	2935908558	2935911760	236
40	iso_pu_bacteria	2935916978	2935919415	236
41	iso_pu_bacteria	2935926038	2935928789	236
42	iso_pu_bacteria	2935934488	2935938434	236
43	iso_pu_bacteria	2935942939	2935945674	236
44	iso_pu_bacteria	2935951376	2935954719	236
45	iso_pu_bacteria	2935967501	2935970606	236
46	iso_pu_bacteria	2935975950	2935979157	236
47	iso_pu_bacteria	2935984226	2935987832	236
48	iso_pu_bacteria	2936011229	2936011386	236
49	iso_pu_bacteria	2936019824	2936019981	236
50	iso_pu_bacteria	2936028420	2936028577	236
51	iso_pu_bacteria	2936046547	2936046704	236
52	iso_pu_bacteria	2936055302	2936063087	236
53	iso_pu_bacteria	8016522445	8016522928	236
54	iso_pu_bacteria	8016530956	8016536390	236
55	iso_pu_bacteria	8016539877	8016540668	236
56	iso_pu_bacteria	8016548790	8016552575	236
57	iso_pu_bacteria	8016557553	8016560954	236
58	iso_pu_bacteria	8016566248	8016574753	236
59	iso_pu_bacteria	8016575299	8016578829	236
60	iso_pu_bacteria	8016595262	8016598819	236
61	iso_pu_bacteria	8016603502	8016612259	236
62	iso_pu_bacteria	8016613128	8016621546	236
63	iso_pu_bacteria	8016622563	8016628412	236
64	iso_pu_bacteria	8019538911	8019543359	236
65	iso_pu_bacteria	8019547302	8019555496	236
66	iso_pu_bacteria	8019619141	8019626482	236
67	iso_pu_bacteria	8019629233	8019636007	236
68	iso_pu_bacteria	8019638758	8019643657	236
69	iso_pu_bacteria	8019659431	8019663771	236
70	iso_pu_bacteria	8019668869	8019673403	236
71	iso_pu_bacteria	8019678201	8019682724	236
72	iso_pu_bacteria	8019687851	8019688411	236
73	3300025922	Ga0207646_10043068	Ga0207646_100430685	237
74	3300025944	Ga0207661_10033486	Ga0207661_100334864	237
75	3300049571	Ga0501034_0004589	Ga0501034_0004589_7380_8096	237
76	3300049583	Ga0501067_0063321	Ga0501067_0063321_791_1507	237
77	3300049586	Ga0501070_0025291	Ga0501070_0025291_512_1228	237
78	3300049590	Ga0501074_0017998	Ga0501074_0017998_1068_1784	237
79	3300049742	Ga0501080_0000535	Ga0501080_0000535_1730_2446	237
80	3300038443	Ga0395901_1037357	Ga0395901_1037357_61_780	239
81	3300005327	Ga0070658_10011464	Ga0070658_100114645	240
82	3300005337	Ga0070682_100133714	Ga0070682_1001337142	240
83	3300005344	Ga0070661_100039253	Ga0070661_1000392532	240
84	3300005354	Ga0070675_100482955	Ga0070675_1004829552	240
85	3300005436	Ga0070713_100221388	Ga0070713_1002213882	240
86	3300005455	Ga0070663_100083342	Ga0070663_1000833423	240
87	3300005539	Ga0068853_100623061	Ga0068853_1006230611	240
88	3300005614	Ga0068856_100076691	Ga0068856_1000766914	240
89	3300005616	Ga0068852_100126868	Ga0068852_1001268683	240
90	3300005834	Ga0068851_10113219	Ga0068851_101132192	240
91	3300006844	Ga0075428_100259875	Ga0075428_1002598752	240
92	3300009094	Ga0111539_10485678	Ga0111539_104856782	240
93	3300013104	Ga0157370_10176945	Ga0157370_101769452	240
94	3300025909	Ga0207705_10032112	Ga0207705_100321121	240
95	3300025919	Ga0207657_10053408	Ga0207657_100534086	240
96	3300025928	Ga0207700_10218734	Ga0207700_102187342	240
97	3300025935	Ga0207709_10296295	Ga0207709_102962952	240
98	3300025961	Ga0207712_10423320	Ga0207712_104233202	240
99	3300026041	Ga0207639_10093805	Ga0207639_100938052	240
100	3300026078	Ga0207702_10352354	Ga0207702_103523542	240
101	3300026142	Ga0207698_10337189	Ga0207698_103371892	240
102	3300039437	Ga0436365_1276606	Ga0436365_1276606_724_1464	240
103	3300042436	Ga0439435_0010464	Ga0439435_0010464_212_952	240
104	3300042993	Ga0439440_0044599	Ga0439440_0044599_25_765	240
105	3300046492	Ga0495585_0078714	Ga0495585_0078714_803_1543	240
106	3300046648	Ga0495611_0094711	Ga0495611_0094711_190_930	240
107	3300048911	Ga0496108_0299662	Ga0496108_0299662_407_1147	240
108	3300049589	Ga0501073_0332584	Ga0501073_0332584_128_868	240
109	3300050492	nmdc:mga0yw44_50263_c1	nmdc:mga0yw44_50263_c1_202_942	240
110	3300050511	nmdc:mga08y16_565548_c1	nmdc:mga08y16_565548_c1_30_770	240
111	3300053091	Ga0500647_0034605	Ga0500647_0034605_1661_2401	240
112	3300053105	Ga0500557_000109	Ga0500557_000109_19443_20183	240
113	3300053120	Ga0500597_061225	Ga0500597_061225_742_1482	240
114	3300053130	Ga0500642_0000063	Ga0500642_0000063_28883_29623	240
115	3300053737	Ga0500601_014788	Ga0500601_014788_64_804	240
116	3300005347	Ga0070668_100116011	Ga0070668_1001160112	241
117	3300009553	Ga0105249_10410358	Ga0105249_104103582	241
118	3300025972	Ga0207668_10134004	Ga0207668_101340043	241
119	3300049580	Ga0501046_0155394	Ga0501046_0155394_819_1544	241
120	3300005335	Ga0070666_10323738	Ga0070666_103237381	242
121	3300005347	Ga0070668_100351253	Ga0070668_1003512532	242
122	3300005353	Ga0070669_100362444	Ga0070669_1003624442	242
123	3300005844	Ga0068862_100326370	Ga0068862_1003263701	242
124	3300006846	Ga0075430_100033611	Ga0075430_1000336113	242
125	3300009147	Ga0114129_10493050	Ga0114129_104930502	242
126	3300009147	Ga0114129_10557537	Ga0114129_105575372	242
127	3300025972	Ga0207668_10307823	Ga0207668_103078232	242
128	3300026075	Ga0207708_10071726	Ga0207708_100717263	242
129	3300045051	Ga0451576_0446741	Ga0451576_0446741_232_972	242
130	3300046520	Ga0495637_0096649	Ga0495637_0096649_43_795	242
131	3300046522	Ga0495643_0091693	Ga0495643_0091693_402_1154	242
132	3300005327	Ga0070658_10352528	Ga0070658_103525282	243
133	3300005337	Ga0070682_100129217	Ga0070682_1001292172	243
134	3300005338	Ga0068868_100033821	Ga0068868_1000338213	243
135	3300005338	Ga0068868_100488962	Ga0068868_1004889621	243
136	3300005339	Ga0070660_100215097	Ga0070660_1002150972	243
137	3300005345	Ga0070692_10132749	Ga0070692_101327492	243
138	3300005345	Ga0070692_10201545	Ga0070692_102015452	243
139	3300005356	Ga0070674_100114863	Ga0070674_1001148632	243
140	3300005366	Ga0070659_100221225	Ga0070659_1002212253	243
141	3300005435	Ga0070714_100000228	Ga0070714_1000002286	243
142	3300005441	Ga0070700_100076675	Ga0070700_1000766752	243
143	3300005441	Ga0070700_100124030	Ga0070700_1001240302	243
144	3300005455	Ga0070663_100096777	Ga0070663_1000967772	243
145	3300005456	Ga0070678_100026241	Ga0070678_1000262414	243
146	3300005457	Ga0070662_100057795	Ga0070662_1000577952	243
147	3300005459	Ga0068867_100306606	Ga0068867_1003066061	243
148	3300005466	Ga0070685_10051007	Ga0070685_100510073	243
149	3300005518	Ga0070699_100353038	Ga0070699_1003530381	243
150	3300005535	Ga0070684_100372103	Ga0070684_1003721031	243
151	3300005536	Ga0070697_100376116	Ga0070697_1003761162	243
152	3300005543	Ga0070672_100335448	Ga0070672_1003354482	243
153	3300005547	Ga0070693_100369733	Ga0070693_1003697331	243
154	3300005548	Ga0070665_100006209	Ga0070665_10000620914	243
155	3300005548	Ga0070665_100181103	Ga0070665_1001811032	243
156	3300005549	Ga0070704_100262600	Ga0070704_1002626002	243
157	3300005564	Ga0070664_100374000	Ga0070664_1003740002	243
158	3300005578	Ga0068854_100231446	Ga0068854_1002314462	243
159	3300005615	Ga0070702_100105936	Ga0070702_1001059362	243
160	3300005615	Ga0070702_100134031	Ga0070702_1001340312	243
161	3300005615	Ga0070702_100289610	Ga0070702_1002896102	243
162	3300005616	Ga0068852_100224009	Ga0068852_1002240092	243
163	3300005618	Ga0068864_100196308	Ga0068864_1001963082	243
164	3300005719	Ga0068861_100062568	Ga0068861_1000625684	243
165	3300005719	Ga0068861_100368340	Ga0068861_1003683402	243
166	3300005843	Ga0068860_100676320	Ga0068860_1006763202	243
167	3300005844	Ga0068862_100102294	Ga0068862_1001022942	243
168	3300005937	Ga0081455_10228386	Ga0081455_102283862	243
169	3300005981	Ga0081538_10055430	Ga0081538_100554303	243
170	3300005981	Ga0081538_10073211	Ga0081538_100732112	243
171	3300005985	Ga0081539_10003769	Ga0081539_1000376922	243
172	3300006237	Ga0097621_100373612	Ga0097621_1003736122	243
173	3300006358	Ga0068871_100387783	Ga0068871_1003877832	243
174	3300006844	Ga0075428_100333866	Ga0075428_1003338662	243
175	3300006881	Ga0068865_100349711	Ga0068865_1003497112	243
176	3300009098	Ga0105245_10016766	Ga0105245_100167666	243
177	3300009098	Ga0105245_10114300	Ga0105245_101143002	243
178	3300009098	Ga0105245_10199461	Ga0105245_101994613	243
179	3300009101	Ga0105247_10060619	Ga0105247_100606192	243
180	3300009147	Ga0114129_10178035	Ga0114129_101780353	243
181	3300009148	Ga0105243_10162993	Ga0105243_101629932	243
182	3300009148	Ga0105243_10167522	Ga0105243_101675222	243
183	3300009177	Ga0105248_10425437	Ga0105248_104254372	243
184	3300009177	Ga0105248_10511503	Ga0105248_105115032	243
185	3300009545	Ga0105237_10687020	Ga0105237_106870201	243
186	3300009553	Ga0105249_10521158	Ga0105249_105211582	243
187	3300011119	Ga0105246_10704015	Ga0105246_107040151	243
188	3300013102	Ga0157371_10273370	Ga0157371_102733701	243
189	3300013105	Ga0157369_10406153	Ga0157369_104061532	243
190	3300013306	Ga0163162_10212147	Ga0163162_102121472	243
191	3300013306	Ga0163162_10536845	Ga0163162_105368451	243
192	3300013307	Ga0157372_10361772	Ga0157372_103617722	243
193	3300013307	Ga0157372_11019167	Ga0157372_110191671	243
194	3300013308	Ga0157375_10263574	Ga0157375_102635742	243
195	3300014326	Ga0157380_10104482	Ga0157380_101044823	243
196	3300014326	Ga0157380_10187433	Ga0157380_101874331	243
197	3300014745	Ga0157377_10021936	Ga0157377_100219362	243
198	3300014745	Ga0157377_10188736	Ga0157377_101887362	243
199	3300020070	Ga0206356_10953772	Ga0206356_109537723	243
200	3300021388	Ga0213875_10012685	Ga0213875_100126854	243
201	3300025302	Ga0207426_1017731	Ga0207426_10177312	243
202	3300025302	Ga0207426_1069670	Ga0207426_10696702	243
203	3300025321	Ga0207656_10058253	Ga0207656_100582532	243
204	3300025899	Ga0207642_10062351	Ga0207642_100623512	243
205	3300025901	Ga0207688_10106646	Ga0207688_101066462	243
206	3300025906	Ga0207699_10139587	Ga0207699_101395871	243
207	3300025908	Ga0207643_10104118	Ga0207643_101041182	243
208	3300025914	Ga0207671_10486264	Ga0207671_104862642	243
209	3300025915	Ga0207693_10037443	Ga0207693_100374433	243
210	3300025918	Ga0207662_10055744	Ga0207662_100557442	243
211	3300025918	Ga0207662_10226095	Ga0207662_102260952	243
212	3300025919	Ga0207657_10114947	Ga0207657_101149473	243
213	3300025919	Ga0207657_10159596	Ga0207657_101595962	243
214	3300025919	Ga0207657_10193260	Ga0207657_101932602	243
215	3300025920	Ga0207649_10328681	Ga0207649_103286812	243
216	3300025927	Ga0207687_10049097	Ga0207687_100490973	243
217	3300025927	Ga0207687_10052117	Ga0207687_100521173	243
218	3300025929	Ga0207664_10000060	Ga0207664_100000606	243
219	3300025933	Ga0207706_10190756	Ga0207706_101907562	243
220	3300025937	Ga0207669_10208730	Ga0207669_102087302	243
221	3300025938	Ga0207704_10096952	Ga0207704_100969523	243
222	3300025938	Ga0207704_10186586	Ga0207704_101865862	243
223	3300025939	Ga0207665_10057648	Ga0207665_100576482	243
224	3300025941	Ga0207711_10284291	Ga0207711_102842912	243
225	3300025942	Ga0207689_10109821	Ga0207689_101098213	243
226	3300025944	Ga0207661_10248896	Ga0207661_102488962	243
227	3300025945	Ga0207679_10116942	Ga0207679_101169422	243
228	3300025945	Ga0207679_10125075	Ga0207679_101250753	243
229	3300025981	Ga0207640_10102801	Ga0207640_101028012	243
230	3300025981	Ga0207640_10123994	Ga0207640_101239942	243
231	3300026023	Ga0207677_10148437	Ga0207677_101484371	243
232	3300026067	Ga0207678_10064834	Ga0207678_100648343	243
233	3300026067	Ga0207678_10128017	Ga0207678_101280172	243
234	3300026075	Ga0207708_10001594	Ga0207708_1000159410	243
235	3300026075	Ga0207708_10010204	Ga0207708_100102048	243
236	3300026078	Ga0207702_10085323	Ga0207702_100853233	243
237	3300026078	Ga0207702_10559381	Ga0207702_105593812	243
238	3300026095	Ga0207676_10204748	Ga0207676_102047482	243
239	3300026118	Ga0207675_100025908	Ga0207675_1000259083	243
240	3300026118	Ga0207675_100399319	Ga0207675_1003993192	243
241	3300026121	Ga0207683_10163985	Ga0207683_101639852	243
242	3300026121	Ga0207683_10192235	Ga0207683_101922352	243
243	3300026142	Ga0207698_10489564	Ga0207698_104895642	243
244	3300028379	Ga0268266_10014029	Ga0268266_100140297	243
245	3300028379	Ga0268266_10434340	Ga0268266_104343402	243
246	3300028563	Ga0265319_1001581	Ga0265319_10015814	243
247	3300028563	Ga0265319_1013408	Ga0265319_10134082	243
248	3300028577	Ga0265318_10001571	Ga0265318_100015716	243
249	3300028800	Ga0265338_10117844	Ga0265338_101178442	243
250	3300028800	Ga0265338_10161710	Ga0265338_101617101	243
251	3300031240	Ga0265320_10013971	Ga0265320_100139712	243
252	3300031240	Ga0265320_10081755	Ga0265320_100817552	243
253	3300031548	Ga0307408_100470737	Ga0307408_1004707372	243
254	3300031595	Ga0265313_10082460	Ga0265313_100824602	243
255	3300031731	Ga0307405_10039101	Ga0307405_100391012	243
256	3300031824	Ga0307413_10031091	Ga0307413_100310911	243
257	3300031824	Ga0307413_10177115	Ga0307413_101771151	243
258	3300031824	Ga0307413_10533821	Ga0307413_105338212	243
259	3300031901	Ga0307406_10020199	Ga0307406_100201992	243
260	3300031901	Ga0307406_10032284	Ga0307406_100322843	243
261	3300031901	Ga0307406_10124343	Ga0307406_101243432	243
262	3300031901	Ga0307406_10214298	Ga0307406_102142981	243
263	3300031903	Ga0307407_10079562	Ga0307407_100795622	243
264	3300031903	Ga0307407_10131523	Ga0307407_101315232	243
265	3300031911	Ga0307412_10428381	Ga0307412_104283812	243
266	3300031995	Ga0307409_100142195	Ga0307409_1001421952	243
267	3300031995	Ga0307409_100361697	Ga0307409_1003616972	243
268	3300031995	Ga0307409_100675529	Ga0307409_1006755291	243
269	3300032002	Ga0307416_100004052	Ga0307416_1000040523	243
270	3300032002	Ga0307416_100286897	Ga0307416_1002868972	243
271	3300032002	Ga0307416_100294295	Ga0307416_1002942953	243
272	3300032002	Ga0307416_100799603	Ga0307416_1007996031	243
273	3300032004	Ga0307414_10208513	Ga0307414_102085132	243
274	3300032004	Ga0307414_10596461	Ga0307414_105964612	243
275	3300032005	Ga0307411_10041925	Ga0307411_100419253	243
276	3300032126	Ga0307415_100003888	Ga0307415_1000038882	243
277	3300032126	Ga0307415_100060400	Ga0307415_1000604004	243
278	3300032126	Ga0307415_100106488	Ga0307415_1001064882	243
279	3300032126	Ga0307415_100363497	Ga0307415_1003634971	243
280	3300032126	Ga0307415_100486979	Ga0307415_1004869792	243
281	3300037466	Ga0395898_0058664	Ga0395898_0058664_1845_2576	243
282	3300037466	Ga0395898_0315305	Ga0395898_0315305_263_994	243
283	3300037471	Ga0395905_0902031	Ga0395905_0902031_24_755	243
284	3300037853	Ga0436364_0125472	Ga0436364_0125472_5608_6339	243
285	3300038443	Ga0395901_0080159	Ga0395901_0080159_508_1239	243
286	3300039437	Ga0436365_1438651	Ga0436365_1438651_127_858	243
287	3300039450	Ga0436363_1483349	Ga0436363_1483349_572_1303	243
288	3300039453	Ga0436362_0826062	Ga0436362_0826062_2005_2736	243
289	3300041451	Ga0451791_0898074	Ga0451791_0898074_272_1003	243
290	3300041486	Ga0451807_2761604	Ga0451807_2761604_249_980	243
291	3300042011	Ga0439454_015775	Ga0439454_015775_131_862	243
292	3300042136	Ga0450900_010668	Ga0450900_010668_144_875	243
293	3300044656	Ga0466969_0034844	Ga0466969_0034844_1630_2361	243
294	3300044683	Ga0466965_0114666	Ga0466965_0114666_304_1035	243
295	3300044684	Ga0466966_0037047	Ga0466966_0037047_833_1564	243
296	3300044684	Ga0466966_0092544	Ga0466966_0092544_956_1687	243
297	3300044684	Ga0466966_0099221	Ga0466966_0099221_233_964	243
298	3300044684	Ga0466966_0154236	Ga0466966_0154236_505_1239	243
299	3300044693	Ga0466961_0001354	Ga0466961_0001354_9491_10222	243
300	3300044693	Ga0466961_0007269	Ga0466961_0007269_3600_4331	243
301	3300044693	Ga0466961_0428851	Ga0466961_0428851_54_785	243
302	3300044694	Ga0466963_0000273	Ga0466963_0000273_8498_9229	243
303	3300044694	Ga0466963_0001512	Ga0466963_0001512_8086_8817	243
304	3300044694	Ga0466963_0010607	Ga0466963_0010607_4085_4816	243
305	3300044694	Ga0466963_0021787	Ga0466963_0021787_606_1337	243
306	3300044694	Ga0466963_0024565	Ga0466963_0024565_1181_1912	243
307	3300044694	Ga0466963_0026646	Ga0466963_0026646_554_1285	243
308	3300044694	Ga0466963_0566151	Ga0466963_0566151_11_745	243
309	3300044706	Ga0466964_0201889	Ga0466964_0201889_17_748	243
310	3300044706	Ga0466964_0269862	Ga0466964_0269862_30_761	243
311	3300044719	Ga0466971_0001423	Ga0466971_0001423_9215_9946	243
312	3300044719	Ga0466971_0028101	Ga0466971_0028101_1443_2174	243
313	3300044719	Ga0466971_0039776	Ga0466971_0039776_128_859	243
314	3300044719	Ga0466971_0052844	Ga0466971_0052844_868_1599	243
315	3300044719	Ga0466971_0239428	Ga0466971_0239428_23_754	243
316	3300044765	Ga0466970_0030181	Ga0466970_0030181_1914_2645	243
317	3300044842	Ga0466957_0023879	Ga0466957_0023879_817_1548	243
318	3300044842	Ga0466957_0028303	Ga0466957_0028303_1837_2568	243
319	3300044842	Ga0466957_0060681	Ga0466957_0060681_1290_2021	243
320	3300044842	Ga0466957_0062748	Ga0466957_0062748_1207_1938	243
321	3300044842	Ga0466957_0085310	Ga0466957_0085310_310_1044	243
322	3300044842	Ga0466957_0453768	Ga0466957_0453768_58_789	243
323	3300044842	Ga0466957_0593315	Ga0466957_0593315_18_749	243
324	3300044901	Ga0466960_0103611	Ga0466960_0103611_540_1271	243
325	3300045049	Ga0466959_0008059	Ga0466959_0008059_4853_5584	243
326	3300045049	Ga0466959_0016350	Ga0466959_0016350_991_1722	243
327	3300045049	Ga0466959_0020414	Ga0466959_0020414_2628_3359	243
328	3300045049	Ga0466959_0023017	Ga0466959_0023017_3179_3910	243
329	3300045049	Ga0466959_0080618	Ga0466959_0080618_372_1103	243
330	3300045049	Ga0466959_0341258	Ga0466959_0341258_40_771	243
331	3300045836	Ga0466958_0002323	Ga0466958_0002323_2506_3237	243
332	3300045836	Ga0466958_0055103	Ga0466958_0055103_1550_2281	243
333	3300045836	Ga0466958_0157799	Ga0466958_0157799_260_991	243
334	3300045836	Ga0466958_0233663	Ga0466958_0233663_209_940	243
335	3300045976	Ga0466967_0019491	Ga0466967_0019491_3956_4687	243
336	3300045976	Ga0466967_0023308	Ga0466967_0023308_1752_2483	243
337	3300045976	Ga0466967_0057065	Ga0466967_0057065_1245_1976	243
338	3300045976	Ga0466967_0101965	Ga0466967_0101965_1568_2299	243
339	3300045976	Ga0466967_0102400	Ga0466967_0102400_336_1067	243
340	3300045976	Ga0466967_0160863	Ga0466967_0160863_834_1565	243
341	3300045976	Ga0466967_0262219	Ga0466967_0262219_757_1488	243
342	3300045976	Ga0466967_0316219	Ga0466967_0316219_232_963	243
343	3300045976	Ga0466967_0925054	Ga0466967_0925054_74_805	243
344	3300045976	Ga0466967_0947894	Ga0466967_0947894_97_828	243
345	3300046529	Ga0495652_0048094	Ga0495652_0048094_568_1299	243
346	3300048906	Ga0496103_0202339	Ga0496103_0202339_345_1076	243
347	3300048907	Ga0496104_0000001	Ga0496104_0000001_646734_647465	243
348	3300048907	Ga0496104_0277217	Ga0496104_0277217_407_1138	243
349	3300048909	Ga0496106_0042266	Ga0496106_0042266_1551_2282	243
350	3300048909	Ga0496106_0325218	Ga0496106_0325218_101_832	243
351	3300048910	Ga0496107_0322460	Ga0496107_0322460_243_974	243
352	3300048911	Ga0496108_0385135	Ga0496108_0385135_439_1170	243
353	3300048911	Ga0496108_0608726	Ga0496108_0608726_78_809	243
354	3300048912	Ga0496109_0381250	Ga0496109_0381250_332_1063	243
355	3300048913	Ga0496110_0000039	Ga0496110_0000039_40047_40778	243
356	3300048913	Ga0496110_0493666	Ga0496110_0493666_319_1050	243
357	3300048914	Ga0496111_0000066	Ga0496111_0000066_2240_2971	243
358	3300048915	Ga0496112_0352469	Ga0496112_0352469_210_941	243
359	3300048924	Ga0496121_0002905	Ga0496121_0002905_19756_20487	243
360	3300049568	Ga0501031_0158359	Ga0501031_0158359_175_906	243
361	3300049568	Ga0501031_0267119	Ga0501031_0267119_115_846	243
362	3300049572	Ga0501036_0034674	Ga0501036_0034674_2815_3546	243
363	3300049572	Ga0501036_0038817	Ga0501036_0038817_524_1255	243
364	3300049572	Ga0501036_0275214	Ga0501036_0275214_157_888	243
365	3300049574	Ga0501038_0177481	Ga0501038_0177481_616_1347	243
366	3300049575	Ga0501039_0016450	Ga0501039_0016450_1275_2006	243
367	3300049576	Ga0501040_0087568	Ga0501040_0087568_494_1225	243
368	3300049576	Ga0501040_0097472	Ga0501040_0097472_181_912	243
369	3300049577	Ga0501041_0007935	Ga0501041_0007935_2090_2821	243
370	3300049577	Ga0501041_0022140	Ga0501041_0022140_2389_3120	243
371	3300049578	Ga0501042_0006520	Ga0501042_0006520_3959_4690	243
372	3300049578	Ga0501042_0057434	Ga0501042_0057434_1221_1952	243
373	3300049578	Ga0501042_0061084	Ga0501042_0061084_705_1436	243
374	3300049580	Ga0501046_0064104	Ga0501046_0064104_1178_1909	243
375	3300049581	Ga0501047_0056520	Ga0501047_0056520_1316_2047	243
376	3300049582	Ga0501048_0074845	Ga0501048_0074845_655_1386	243
377	3300049582	Ga0501048_0232400	Ga0501048_0232400_33_764	243
378	3300049584	Ga0501068_0335593	Ga0501068_0335593_188_919	243
379	3300049587	Ga0501071_0024375	Ga0501071_0024375_2507_3238	243
380	3300049587	Ga0501071_0148005	Ga0501071_0148005_656_1387	243
381	3300049588	Ga0501072_0019166	Ga0501072_0019166_4458_5189	243
382	3300049588	Ga0501072_0063673	Ga0501072_0063673_1041_1772	243
383	3300049588	Ga0501072_0271411	Ga0501072_0271411_522_1253	243
384	3300049588	Ga0501072_0431838	Ga0501072_0431838_99_830	243
385	3300049590	Ga0501074_0216951	Ga0501074_0216951_91_822	243
386	3300049591	Ga0501075_0071915	Ga0501075_0071915_1186_1917	243
387	3300049592	Ga0501076_0024186	Ga0501076_0024186_3091_3822	243
388	3300049593	Ga0501077_0269871	Ga0501077_0269871_209_1069	243
389	3300049741	Ga0501079_0067232	Ga0501079_0067232_1904_2635	243
390	3300049741	Ga0501079_0107810	Ga0501079_0107810_377_1108	243
391	3300049742	Ga0501080_0201208	Ga0501080_0201208_668_1399	243
392	3300049743	Ga0501081_0291215	Ga0501081_0291215_99_830	243
393	3300049823	Ga0501044_0472922	Ga0501044_0472922_131_862	243
394	3300049824	Ga0501045_0178629	Ga0501045_0178629_525_1256	243
395	3300050507	nmdc:mga05p37_50311_c1	nmdc:mga05p37_50311_c1_3090_3821	243
396	3300050508	nmdc:mga09592_77833_c1	nmdc:mga09592_77833_c1_288_1019	243
397	3300050511	nmdc:mga08y16_167408_c1	nmdc:mga08y16_167408_c1_1086_1817	243
398	3300050511	nmdc:mga08y16_82880_c1	nmdc:mga08y16_82880_c1_2480_3211	243
399	3300050515	nmdc:mga0a205_448409_c1	nmdc:mga0a205_448409_c1_287_1018	243
400	3300053139	Ga0500568_0075399	Ga0500568_0075399_238_969	243
401	3300054114	Ga0501084_0126872	Ga0501084_0126872_1085_1816	243
402	3300060353	Ga0501082_0113313	Ga0501082_0113313_705_1436	243
403	3300060353	Ga0501082_0150046	Ga0501082_0150046_285_1016	243
404	3300060353	Ga0501082_0589761	Ga0501082_0589761_35_766	243
405	3300061719	Ga0466962_0022656	Ga0466962_0022656_655_1386	243
406	3300061719	Ga0466962_0030756	Ga0466962_0030756_618_1349	243
407	3300061734	Ga0530510_0023703	Ga0530510_0023703_1880_2611	243
408	3300061734	Ga0530510_0042277	Ga0530510_0042277_1786_2517	243
409	3300061734	Ga0530510_0087617	Ga0530510_0087617_1237_1968	243
410	3300041491	Ga0451833_0586035	Ga0451833_0586035_10_792	244
411	3300049571	Ga0501034_0321847	Ga0501034_0321847_228_965	244
412	3300049574	Ga0501038_0273288	Ga0501038_0273288_360_1097	244
413	3300049581	Ga0501047_0471041	Ga0501047_0471041_70_807	244
414	3300009101	Ga0105247_10000393	Ga0105247_1000039332	245
415	3300025900	Ga0207710_10000195	Ga0207710_1000019516	245
416	3300049578	Ga0501042_0200417	Ga0501042_0200417_326_1063	245
417	3300049588	Ga0501072_0028293	Ga0501072_0028293_602_1339	245
418	3300001979	JGI24740J21852_10010926	JGI24740J21852_100109262	246
419	3300005436	Ga0070713_100051283	Ga0070713_1000512832	246
420	3300005578	Ga0068854_100000136	Ga0068854_10000013640	246
421	3300009098	Ga0105245_10001844	Ga0105245_100018442	246
422	3300009176	Ga0105242_10019660	Ga0105242_100196606	246
423	3300013104	Ga0157370_10016596	Ga0157370_100165966	246
424	3300013307	Ga0157372_10000129	Ga0157372_1000012955	246
425	3300025927	Ga0207687_10000985	Ga0207687_100009852	246
426	3300025934	Ga0207686_10009391	Ga0207686_100093916	246
427	3300025981	Ga0207640_10000015	Ga0207640_1000001539	246
428	3300028563	Ga0265319_1000025	Ga0265319_100002527	246
429	3300028800	Ga0265338_10000473	Ga0265338_1000047350	246
430	3300046517	Ga0495630_0068318	Ga0495630_0068318_1014_1817	246
431	3300046536	Ga0495587_0030601	Ga0495587_0030601_1386_2150	246
432	3300048907	Ga0496104_0000004	Ga0496104_0000004_156494_157234	246
433	3300048908	Ga0496105_0000001	Ga0496105_0000001_484597_485337	246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

44

195

0.81 PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

44

251

0.74 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3rqz-assembly2.cif.gz_B	crystal structure of metallophosphoesterase from sphaerobacter thermophilus	0.9056	1	246
3rqz-assembly2.cif.gz_B	crystal structure of metallophosphoesterase from sphaerobacter thermophilus	0.9019	1	246
3rqz-assembly1.cif.gz_A	crystal structure of metallophosphoesterase from sphaerobacter thermophilus	0.9006	2	246
3rqz-assembly3.cif.gz_C	crystal structure of metallophosphoesterase from sphaerobacter thermophilus	0.8952	1	246
3rqz-assembly1.cif.gz_A	crystal structure of metallophosphoesterase from sphaerobacter thermophilus	0.8862	2	246

ID	Description	Score	Start	End	Superfamily
af_Q58322_5_243_3.60.21.10	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9118	3	246	3.60.21.10
af_Q58322_5_243_3.60.21.10	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9044	3	246	3.60.21.10
3rqzB00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.8972	3	246	3.60.21.10
3rqzB00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.8897	3	246	3.60.21.10
2gjuC00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.795	2	246	3.60.21.10

ID	Description	Score	Start	End	GO Terms
AF-A0A538EEK7-F1-model_v4	Metallophosphoesterase family protein	0.9937	2	246	GO:0005737 GO:0016791
AF-A0A2W6BGG5-F1-model_v4	Metallophosphoesterase	0.9935	1	246	GO:0005737 GO:0016791
AF-A0A7K0QM00-F1-model_v4	Metallophosphoesterase	0.993	1	246	GO:0005737 GO:0016791
AF-A0A350MUS2-F1-model_v4	Metallophosphoesterase	0.9923	1	102	GO:0005737 GO:0016791
AF-A0A7W0LJN6-F1-model_v4	Metallophosphoesterase family protein	0.9922	2	246	GO:0005737 GO:0016791

Feature Viewer

pLDDT	pTM	Quality
97.12	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442946

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00149

Metallophos

Calcineurin-like phosphoesterase

44

195

0.81

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

44

251

0.74

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map