F442956

General Info

Members Datasets Scaffolds Average Seq Length
433 279 866 227

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_125767_c1|nmdc:mga05p37_125767_c1_808_1578
Length 256
Sequence MGDRRNTASPIAPYTRMAYDRADSCNHGVRMTYVFEPARQATLPIKGSDKLFPIHRIYCVGRNYDEHTKEMGGDTKDPPFFFQKNADNVATNGKFPYPSQTKNVHFEIEMVVGLKTGGTNIKAEDALKHVFGYAVGIDMTRRDLQDVAKKMARPWEVAKAFEYSAPCTALVPADSIGHPKQGAIWLDVNGERRQTGDLSQMIWDVPSQIAFLSTLFELKPGDLIFSGTPSGVGAIKQGDRMKAHIDGVGDLEVTVV

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
100 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
101 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
102 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
191 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
195 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
196 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
197 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
198 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
199 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
200 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
201 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
202 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
203 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
204 2643221569 Achromobacter sp. Root565 Isolate Unclassified
205 2643221582 Rhizobium sp. Root651 Isolate Unclassified
206 2643221594 Achromobacter sp. Root170 Isolate Unclassified
207 2643221621 Achromobacter sp. Root83 Isolate Unclassified
208 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
209 2738543024 Aminobacter sp. AP02 Isolate Unclassified
210 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
211 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
212 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
213 2773857925 Microvirga vignae BR3299 Isolate Unclassified
214 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
215 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
216 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
217 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
218 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
219 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
220 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
221 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
222 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
223 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
224 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
225 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
226 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
227 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
228 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
229 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
230 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
231 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
232 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
233 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
234 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
235 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
236 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
237 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
238 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
239 2858950400 Achromobacter sp. K91 Isolate Unclassified
240 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
241 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
242 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
243 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
244 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
245 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
246 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
247 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
248 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
249 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
250 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
251 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
252 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
253 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
254 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
255 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
256 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
257 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
258 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
259 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
260 2941479691
261 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
262 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
263 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
264 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
265 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
266 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
267 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
268 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
269 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
270 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
271 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
272 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
273 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
274 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
275 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
276 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
277 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
278 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
279 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.45
Metatranscriptomes 0.69
Isolates 19.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.92
Bulb 0
Endosphere 12.24
Nodule 7.16
Rhizoplane 3.46
Rhizosphere 53.35
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_125767_c1 3300050507 Bacteria 3148
2 JGI25162J39368_1000019 3300002737 Bacteria 262053
3 JGI25157J39369_1002710 3300002741 Bacteria 4101
4 JGI25157J39369_1007157 3300002741 Bacteria 1631
5 rootH1_10084387 3300003316 Bacteria 3818
6 JGI25404J52841_10023507 3300003659 Bacteria 1329
7 Ga0055529_1001004 3300003763 Bacteria 13670
8 Ga0055529_1013198 3300003763 Bacteria 1052
9 Ga0055528_1010866 3300003790 Bacteria 3662
10 Ga0055531_10031283 3300003794 Bacteria 1765
11 Ga0058692_1000350 3300003856 Bacteria 22460
12 Ga0058692_1006447 3300003856 Bacteria 3219
13 Ga0065704_10071062 3300005289 Bacteria 13440
14 Ga0070658_10127059 3300005327 Bacteria 2123
15 Ga0070676_10246985 3300005328 Bacteria 1189
16 Ga0070683_100051406 3300005329 Bacteria 3816
17 Ga0070692_10376855 3300005345 Bacteria 889
18 Ga0070668_100024914 3300005347 Bacteria 4535
19 Ga0070668_100639059 3300005347 Bacteria 934
20 Ga0070669_100011235 3300005353 Bacteria 6358
21 Ga0070671_100263132 3300005355 Bacteria 1466
22 Ga0070700_100233950 3300005441 Bacteria 1309
23 Ga0070694_100038292 3300005444 Bacteria 3186
24 Ga0070663_100003367 3300005455 Bacteria 9224
25 Ga0070663_100075645 3300005455 Bacteria 2461
26 Ga0070695_100011253 3300005545 Bacteria 5351
27 Ga0070696_100167240 3300005546 Bacteria 1623
28 Ga0070665_100059285 3300005548 Bacteria 3837
29 Ga0070665_100129882 3300005548 Bacteria 2522
30 Ga0070704_100897325 3300005549 Bacteria 797
31 Ga0068855_100038563 3300005563 Bacteria 5677
32 Ga0068856_100000524 3300005614 Bacteria 42396
33 Ga0070702_100343036 3300005615 Bacteria 1049
34 Ga0068863_100196537 3300005841 Bacteria 1939
35 Ga0068860_100497605 3300005843 Bacteria 1217
36 Ga0081538_10067796 3300005981 Bacteria 1989
37 Ga0081540_1000066 3300005983 Bacteria 115420
38 Ga0081540_1094987 3300005983 Bacteria 1301
39 Ga0075365_10018161 3300006038 Bacteria 4318
40 Ga0075365_10156603 3300006038 Bacteria 1586
41 Ga0075368_10012399 3300006042 Bacteria 3116
42 Ga0075363_100015974 3300006048 Bacteria 3701
43 Ga0075364_10001362 3300006051 Bacteria 13187
44 Ga0075364_10005038 3300006051 Bacteria 7660
45 Ga0075364_10012484 3300006051 Bacteria 5199
46 Ga0075364_10044721 3300006051 Bacteria 2880
47 Ga0075362_10017042 3300006177 Bacteria 2987
48 Ga0075362_10193348 3300006177 Bacteria 989
49 Ga0075367_10000551 3300006178 Bacteria 14212
50 Ga0075367_10008221 3300006178 Bacteria 5393
51 Ga0075367_10045500 3300006178 Bacteria 2575
52 Ga0075369_10037361 3300006186 Bacteria 2068
53 Ga0075428_100019260 3300006844 Bacteria 7551
54 Ga0075428_100059669 3300006844 Bacteria 4177
55 Ga0075428_100350393 3300006844 Bacteria 1585
56 Ga0075430_100037311 3300006846 Bacteria 4120
57 Ga0075430_100221784 3300006846 Bacteria 1569
58 Ga0075431_100028783 3300006847 Bacteria 5713
59 Ga0075431_100226246 3300006847 Bacteria 1907
60 Ga0075433_10103093 3300006852 Bacteria 2527
61 Ga0075433_10330085 3300006852 Bacteria 1349
62 Ga0075429_100123047 3300006880 Bacteria 2268
63 Ga0099826_10012274 3300006948 Bacteria 6455
64 Ga0105240_10094462 3300009093 Bacteria 3647
65 Ga0105240_10450785 3300009093 Bacteria 1440
66 Ga0111539_10000244 3300009094 Bacteria 65141
67 Ga0111539_10006919 3300009094 Bacteria 14564
68 Ga0111539_10308889 3300009094 Bacteria 1840
69 Ga0111539_11078543 3300009094 Bacteria 933
70 Ga0114129_10026945 3300009147 Bacteria 8136
71 Ga0114129_10077437 3300009147 Bacteria 4626
72 Ga0114129_10174680 3300009147 Bacteria 2926
73 Ga0114129_10631542 3300009147 Bacteria 1384
74 Ga0105243_10023405 3300009148 Bacteria 4704
75 Ga0105237_10000036 3300009545 Bacteria 191142
76 Ga0105238_10124704 3300009551 Bacteria 2555
77 Ga0105249_10150529 3300009553 Bacteria 2240
78 Ga0105239_10880500 3300010375 Bacteria 1027
79 Ga0157373_10007245 3300013100 Bacteria 8273
80 Ga0157373_10238870 3300013100 Bacteria 1284
81 Ga0157371_10000015 3300013102 Bacteria 339838
82 Ga0157370_10000402 3300013104 Bacteria 54601
83 Ga0157370_10087654 3300013104 Bacteria 2924
84 Ga0157369_10132542 3300013105 Bacteria 2640
85 Ga0163163_10855553 3300014325 Bacteria 973
86 Ga0157380_10091574 3300014326 Bacteria 2510
87 Ga0157379_10432710 3300014968 Bacteria 1213
88 Ga0163161_10122628 3300017792 Bacteria 1954
89 Ga0197907_10193616 3300020069 Bacteria 1098
90 Ga0206353_10203357 3300020082 Bacteria 2590
91 Ga0209646_1003100 3300025246 Bacteria 3375
92 Ga0209026_1005347 3300025250 Bacteria 3477
93 Ga0209759_1015258 3300025256 Bacteria 1989
94 Ga0209759_1020865 3300025256 Bacteria 1508
95 Ga0209455_1000318 3300025272 Bacteria 47836
96 Ga0209455_1000561 3300025272 Bacteria 24982
97 Ga0209025_1000094 3300025294 Bacteria 241080
98 Ga0209050_1003228 3300025298 Bacteria 12305
99 Ga0209050_1009469 3300025298 Bacteria 4981
100 Ga0207426_1056788 3300025302 Bacteria 1142
101 Ga0209257_1000453 3300025304 Bacteria 76813
102 Ga0207688_10044907 3300025901 Bacteria 2463
103 Ga0207695_10031281 3300025913 Bacteria 5840
104 Ga0207695_10063644 3300025913 Bacteria 3802
105 Ga0207695_10143660 3300025913 Bacteria 2332
106 Ga0207695_10320139 3300025913 Bacteria 1440
107 Ga0207671_10001404 3300025914 Bacteria 28043
108 Ga0207671_10394876 3300025914 Unclassified 1100
109 Ga0207694_10083495 3300025924 Bacteria 2512
110 Ga0207667_10477858 3300025949 Bacteria 1265
111 Ga0207712_10124228 3300025961 Bacteria 1957
112 Ga0207678_10000643 3300026067 Bacteria 32112
113 Ga0207708_10275909 3300026075 Bacteria 1361
114 Ga0207702_10000717 3300026078 Bacteria 35600
115 Ga0207641_10220771 3300026088 Bacteria 1757
116 Ga0207675_100023189 3300026118 Bacteria 5772
117 Ga0207675_100327099 3300026118 Bacteria 1498
118 Ga0209371_1000021 3300027312 Bacteria 555864
119 Ga0209371_1000229 3300027312 Bacteria 71827
120 Ga0209813_10003005 3300027866 Bacteria 3912
121 Ga0209813_10005503 3300027866 Bacteria 3077
122 Ga0207428_10005087 3300027907 Bacteria 12351
123 Ga0207428_10160534 3300027907 Bacteria 1707
124 Ga0207428_10265728 3300027907 Bacteria 1277
125 Ga0268265_10158903 3300028380 Bacteria 1917
126 Ga0268264_10150539 3300028381 Bacteria 2085
127 Ga0307515_10000008 3300028794 Bacteria 663660
128 Ga0310981_1037741 3300029285 Bacteria 1003
129 Ga0268256_1000020 3300030500 Bacteria 557873
130 Ga0268256_1000373 3300030500 Bacteria 42542
131 Ga0265327_10244546 3300031251 Bacteria 801
132 Ga0307513_10082621 3300031456 Bacteria 3307
133 Ga0307405_10367191 3300031731 Bacteria 1116
134 Ga0307410_10312223 3300031852 Bacteria 1244
135 Ga0307406_10084669 3300031901 Bacteria 2118
136 Ga0307412_10002393 3300031911 Bacteria 10421
137 Ga0307414_10124105 3300032004 Bacteria 1991
138 Ga0307414_10224580 3300032004 Bacteria 1544
139 Ga0373930_0009641 3300034816 Bacteria 1712
140 Ga0373934_0008395 3300035086 Bacteria 3849
141 Ga0373940_0005389 3300035088 Bacteria 2769
142 Ga0373952_0023838 3300035092 Bacteria 1310
143 Ga0373939_0003117 3300035114 Bacteria 3896
144 Ga0373939_0003492 3300035114 Bacteria 3692
145 Ga0373941_0007641 3300035115 Bacteria 2653
146 Ga0373953_0140598 3300035117 Bacteria 1032
147 Ga0373956_0037654 3300035119 Bacteria 2138
148 Ga0373960_0003086 3300035121 Bacteria 3762
149 Ga0373942_0019298 3300035207 Bacteria 1700
150 Ga0373961_0024495 3300035241 Bacteria 1633
151 Ga0316574_0142019 3300035398 Bacteria 1547
152 Ga0373924_0010786 3300035410 Bacteria 3381
153 Ga0373924_0195999 3300035410 Bacteria 890
154 Ga0373931_0001400 3300035691 Bacteria 10327
155 Ga0373931_0175518 3300035691 Bacteria 1265
156 Ga0373933_0001123 3300035724 Bacteria 15927
157 Ga0373937_0203218 3300036401 Bacteria 1862
158 Ga0373925_0624226 3300037068 Bacteria 888
159 Ga0395899_0118458 3300037312 Bacteria 1898
160 Ga0395900_0017017 3300037418 Bacteria 7421
161 Ga0395905_0000281 3300037471 Bacteria 75241
162 Ga0395905_0007151 3300037471 Bacteria 11155
163 Ga0439466_0011212 3300041411 Bacteria 3318
164 Ga0439465_0017875 3300041413 Bacteria 2215
165 Ga0439465_0045354 3300041413 Bacteria 1429
166 Ga0439431_0010450 3300041997 Bacteria 2107
167 Ga0439434_0056421 3300042435 Bacteria 1223
168 Ga0451577_0014815 3300042876 Bacteria 7264
169 Ga0451576_0000056 3300045051 Bacteria 303398
170 Ga0495584_0057715 3300046491 Bacteria 1953
171 Ga0495594_0064289 3300046499 Bacteria 2034
172 Ga0495654_0000090 3300046530 Bacteria 101947
173 Ga0495640_0370005 3300046533 Bacteria 883
174 Ga0495633_0015993 3300046558 Bacteria 3881
175 Ga0495588_0004086 3300046674 Bacteria 6424
176 Ga0495658_0051201 3300046683 Bacteria 2339
177 Ga0495681_0005741 3300047470 Bacteria 8255
178 Ga0495615_0072419 3300048090 Bacteria 931
179 Ga0496102_0127705 3300048905 Bacteria 2378
180 Ga0496104_0002143 3300048907 Bacteria 17132
181 Ga0496105_0002738 3300048908 Bacteria 12861
182 Ga0496108_0038940 3300048911 Bacteria 3962
183 Ga0496109_0025195 3300048912 Bacteria 5298
184 Ga0496110_0008034 3300048913 Bacteria 8460
185 Ga0496110_0498209 3300048913 Bacteria 1109
186 Ga0496111_0001186 3300048914 Bacteria 14513
187 Ga0496113_0000416 3300048916 Bacteria 20662
188 Ga0496116_0021651 3300048919 Bacteria 4841
189 Ga0496116_0044286 3300048919 Bacteria 3024
190 Ga0496116_0096964 3300048919 Bacteria 1774
191 Ga0496116_0102036 3300048919 Bacteria 1711
192 Ga0496116_0252486 3300048919 Bacteria 876
193 Ga0496117_0000002 3300048920 Bacteria 2483758
194 Ga0496117_0015528 3300048920 Bacteria 6485
195 Ga0496117_0109036 3300048920 Bacteria 1730
196 Ga0496118_0000355 3300048921 Bacteria 77500
197 Ga0496118_0134539 3300048921 Bacteria 1580
198 Ga0496118_0152194 3300048921 Bacteria 1446
199 Ga0496119_0008222 3300048922 Bacteria 9225
200 Ga0496119_0129061 3300048922 Bacteria 1379
201 Ga0496119_0133074 3300048922 Bacteria 1352
202 Ga0496119_0229921 3300048922 Bacteria 945
203 Ga0496120_0000941 3300048923 Bacteria 40051
204 Ga0496120_0011173 3300048923 Bacteria 6197
205 Ga0496120_0026602 3300048923 Bacteria 3570
206 Ga0496121_0000001 3300048924 Bacteria 1830318
207 Ga0496121_0000127 3300048924 Bacteria 168545
208 Ga0496121_0010623 3300048924 Bacteria 10341
209 Ga0496121_0043945 3300048924 Bacteria 3862
210 Ga0496122_0000001 3300048925 Bacteria 1827766
211 Ga0496122_0005045 3300048925 Bacteria 15955
212 Ga0496122_0012553 3300048925 Bacteria 8413
213 Ga0496122_0041338 3300048925 Bacteria 3647
214 Ga0496122_0135590 3300048925 Bacteria 1552
215 Ga0496122_0160148 3300048925 Bacteria 1374
216 Ga0496123_0000001 3300048926 Bacteria 1831497
217 Ga0496123_0003857 3300048926 Bacteria 16311
218 Ga0496123_0018230 3300048926 Bacteria 5595
219 Ga0496123_0059497 3300048926 Bacteria 2469
220 Ga0496123_0068886 3300048926 Bacteria 2225
221 Ga0496123_0093440 3300048926 Bacteria 1776
222 Ga0496124_0000350 3300048927 Bacteria 84078
223 Ga0496124_0001936 3300048927 Bacteria 28381
224 Ga0496124_0008053 3300048927 Bacteria 11083
225 Ga0496124_0029563 3300048927 Bacteria 4879
226 Ga0496124_0075919 3300048927 Bacteria 2776
227 Ga0496124_0077485 3300048927 Bacteria 2742
228 Ga0496124_0084405 3300048927 Bacteria 2604
229 Ga0496124_0189634 3300048927 Bacteria 1574
230 Ga0496124_0260599 3300048927 Bacteria 1276
231 Ga0496124_0367320 3300048927 Bacteria 1011
232 Ga0496125_0000011 3300048928 Bacteria 655895
233 Ga0496125_0000155 3300048928 Bacteria 151541
234 Ga0496125_0001827 3300048928 Bacteria 29379
235 Ga0496125_0012037 3300048928 Bacteria 8612
236 Ga0496125_0024477 3300048928 Bacteria 5551
237 Ga0496125_0188400 3300048928 Bacteria 1365
238 Ga0496125_0225179 3300048928 Bacteria 1204
239 Ga0496126_0007762 3300048929 Bacteria 11694
240 Ga0496126_0073037 3300048929 Bacteria 3050
241 Ga0496126_0090960 3300048929 Bacteria 2684
242 Ga0496126_0111426 3300048929 Bacteria 2383
243 Ga0496126_0134550 3300048929 Bacteria 2133
244 Ga0501031_0000018 3300049568 Bacteria 106734
245 Ga0501031_0170461 3300049568 Bacteria 1422
246 Ga0501032_0000003 3300049569 Bacteria 317700
247 Ga0501032_0015743 3300049569 Bacteria 5332
248 Ga0501033_0000076 3300049570 Bacteria 93921
249 Ga0501033_0000132 3300049570 Bacteria 72558
250 Ga0501033_0001111 3300049570 Bacteria 24415
251 Ga0501033_0003112 3300049570 Bacteria 13773
252 Ga0501033_0197023 3300049570 Bacteria 1440
253 Ga0501034_0000005 3300049571 Bacteria 367512
254 Ga0501034_0000408 3300049571 Bacteria 72244
255 Ga0501034_0031597 3300049571 Bacteria 5379
256 Ga0501034_0123639 3300049571 Bacteria 2573
257 Ga0501034_0257793 3300049571 Bacteria 1687
258 Ga0501034_0271171 3300049571 Bacteria 1638
259 Ga0501034_0416089 3300049571 Bacteria 1266
260 Ga0501036_0000005 3300049572 Bacteria 246420
261 Ga0501036_0000732 3300049572 Bacteria 24258
262 Ga0501036_0146017 3300049572 Bacteria 1995
263 Ga0501037_0000045 3300049573 Bacteria 117148
264 Ga0501037_0001237 3300049573 Bacteria 18816
265 Ga0501037_0039291 3300049573 Bacteria 3484
266 Ga0501038_0000001 3300049574 Bacteria 375481
267 Ga0501038_0000327 3300049574 Bacteria 40996
268 Ga0501038_0715145 3300049574 Bacteria 749
269 Ga0501039_0000007 3300049575 Bacteria 277831
270 Ga0501039_0000038 3300049575 Bacteria 119484
271 Ga0501039_0221120 3300049575 Bacteria 1489
272 Ga0501040_0429336 3300049576 Bacteria 950
273 Ga0501041_0287210 3300049577 Bacteria 1036
274 Ga0501042_0109620 3300049578 Bacteria 1988
275 Ga0501043_0000043 3300049579 Bacteria 115410
276 Ga0501043_0000333 3300049579 Bacteria 42740
277 Ga0501046_0326239 3300049580 Bacteria 1118
278 Ga0501047_0012601 3300049581 Bacteria 8011
279 Ga0501047_0013933 3300049581 Bacteria 7639
280 Ga0501047_0041578 3300049581 Bacteria 4441
281 Ga0501047_0050638 3300049581 Bacteria 4010
282 Ga0501047_0330793 3300049581 Bacteria 1362
283 Ga0501048_0003495 3300049582 Bacteria 11944
284 Ga0501070_0322405 3300049586 Bacteria 1256
285 Ga0501073_0105818 3300049589 Bacteria 1952
286 Ga0501073_0205596 3300049589 Bacteria 1361
287 Ga0501074_0054859 3300049590 Bacteria 2874
288 Ga0501077_0087053 3300049593 Bacteria 1980
289 Ga0501077_0314210 3300049593 Bacteria 999
290 Ga0501080_0134207 3300049742 Bacteria 2291
291 Ga0501080_0215846 3300049742 Bacteria 1757
292 Ga0501083_0059951 3300049744 Bacteria 2544
293 Ga0501271_010846 3300049768 Bacteria 968
294 Ga0501035_0000008 3300049822 Bacteria 313425
295 Ga0501035_0000297 3300049822 Bacteria 58749
296 Ga0501035_0011268 3300049822 Bacteria 8284
297 Ga0501035_0011392 3300049822 Bacteria 8243
298 Ga0501035_0035061 3300049822 Bacteria 4556
299 Ga0501035_0084365 3300049822 Bacteria 2802
300 Ga0501035_0121020 3300049822 Bacteria 2288
301 Ga0501035_0726058 3300049822 Bacteria 799
302 Ga0501044_0000001 3300049823 Bacteria 418087
303 Ga0501044_0000048 3300049823 Bacteria 145067
304 Ga0501044_0005318 3300049823 Bacteria 14320
305 Ga0501044_0008906 3300049823 Bacteria 10968
306 Ga0501044_0082677 3300049823 Bacteria 3248
307 Ga0501044_0134348 3300049823 Bacteria 2466
308 Ga0501044_0196742 3300049823 Bacteria 1975
309 Ga0501044_0294837 3300049823 Bacteria 1552
310 nmdc:mga03683_10605_c1 3300050489 Bacteria 3310
311 nmdc:mga03n38_42648_c1 3300050490 Bacteria 1984
312 nmdc:mga00v17_103233_c1 3300050491 Bacteria 1802
313 nmdc:mga00v17_35459_c1 3300050491 Bacteria 2969
314 nmdc:mga00v17_356867_c1 3300050491 Bacteria 950
315 nmdc:mga00v17_40082_c1 3300050491 Bacteria 2808
316 nmdc:mga00v17_41870_c1 3300050491 Bacteria 2752
317 nmdc:mga00v17_523_c1 3300050491 Bacteria 21540
318 nmdc:mga0yw44_146898_c1 3300050492 Bacteria 1536
319 nmdc:mga0yw44_32954_c1 3300050492 Bacteria 3023
320 nmdc:mga06z11_1807_c1 3300050494 Bacteria 8059
321 nmdc:mga06z11_18270_c1 3300050494 Bacteria 3200
322 nmdc:mga04h51_3295_c1 3300050495 Bacteria 3912
323 nmdc:mga04h51_6269_c1 3300050495 Bacteria 3075
324 nmdc:mga07m45_198004_c1 3300050496 Bacteria 1168
325 nmdc:mga05p37_46807_c1 3300050507 Bacteria 5318
326 nmdc:mga05p37_61887_c1 3300050507 Bacteria 4607
327 nmdc:mga05p37_74192_c1 3300050507 Bacteria 4187
328 nmdc:mga0qj67_125921_c1 3300050509 Bacteria 2073
329 nmdc:mga0qj67_176815_c1 3300050509 Bacteria 1733
330 nmdc:mga06r32_102036_c1 3300050510 Bacteria 2816
331 nmdc:mga06r32_173619_c1 3300050510 Bacteria 2139
332 nmdc:mga06r32_63783_c1 3300050510 Bacteria 3552
333 nmdc:mga08y16_222362_c1 3300050511 Bacteria 1954
334 nmdc:mga08y16_48542_c1 3300050511 Bacteria 4443
335 nmdc:mga08y16_54773_c1 3300050511 Bacteria 4168
336 nmdc:mga08y16_56_c1 3300050511 Bacteria 99587
337 nmdc:mga0sz30_219640_c1 3300050516 Bacteria 845
338 Ga0495619_0054227 3300053085 Bacteria 2653
339 Ga0500578_0101804 3300053086 Bacteria 1817
340 Ga0500643_062368 3300053087 Bacteria 1045
341 Ga0500651_0000463 3300053093 Bacteria 21449
342 Ga0500560_006454 3300053107 Bacteria 2685
343 Ga0500561_0114617 3300053137 Bacteria 818
344 Ga0500568_0000799 3300053139 Bacteria 22209
345 Ga0500616_0009282 3300053153 Bacteria 5994
346 Ga0500616_0035541 3300053153 Bacteria 2709
347 Ga0500634_0013508 3300053161 Bacteria 4284
348 2509075636 2508501114 Bacteria 7082538
349 2509141001 2508501127 Bacteria 7037543
350 2537877731 2537561587 Bacteria 5425293
351 2538833567 2537561836 Bacteria 3910579
352 2597815708 2597489875 Bacteria 7010078
353 2599604004 2599185210 Bacteria 5624189
354 2599720969 2599185236 Bacteria 6875203
355 2599906193 2599185292 Bacteria 6290804
356 2643829208 2643221562 Bacteria 4048635
357 2643861975 2643221569 Bacteria 6064337
358 2643919227 2643221582 Bacteria 5804683
359 2643980981 2643221594 Bacteria 5811388
360 2644122445 2643221621 Bacteria 6212786
361 2644635425 2643221715 Bacteria 6671032
362 2739309243 2738543024 Bacteria 5603683
363 2739613086 2739367655 Bacteria 4051151
364 2765464984 2765235802 Bacteria 5618596
365 2770199614 2767802442 Bacteria 5747986
366 2770199640 2767802442 Bacteria 5747986
367 2774874289 2773857925 Bacteria 6472445
368 2776262494 2775506901 Bacteria 9631051
369 2808985491 2808606387 Bacteria 5697198
370 2809031693 2808606395 Bacteria 6020352
371 2819559968 2818991439 Bacteria 6907412
372 2835319772 2835312727 Bacteria 7413381
373 2838676339 2838675328 Bacteria 4909118
374 2838715222 2838714209 Bacteria 5525906
375 2838720978 2838719591 Bacteria 5523910
376 2838725980 2838724970 Bacteria 4908691
377 2840767765 2840764183 Bacteria 6358399
378 2841735178 2841734538 Bacteria 6784580
379 2841847936 2841846520 Bacteria 5345850
380 2841859512 2841859092 Bacteria 5436171
381 2842126034 2842124991 Bacteria 5346824
382 2842131233 2842130223 Bacteria 4909145
383 2842153597 2842152218 Bacteria 4908957
384 2842171465 2842170452 Bacteria 5525737
385 2842177217 2842175837 Bacteria 4908771
386 2842188330 2842187318 Bacteria 5524014
387 2842212641 2842211629 Bacteria 5523832
388 2842225740 2842224351 Bacteria 5524473
389 2842516297 2842515876 Bacteria 5436280
390 2856349374 2856342000 Bacteria 7176905
391 2857540765 2857537821 Bacteria 5248181
392 2857545488 2857542790 Bacteria 5326616
393 2858956515 2858950400 Bacteria 6783797
394 2871481382 2871474448 Bacteria 6806570
395 2881414100 2881412998 Bacteria 6492157
396 2881930977 2881927736 Bacteria 3993927
397 2882462099 2882456835 Bacteria 6863978
398 2883358276 2883354860 Bacteria 5865246
399 2887378659 2887375801 Bacteria 5334027
400 2888349197 2888343758 Bacteria 6611049
401 2894237801 2894232714 Bacteria 8834183
402 2899796309 2899792073 Bacteria 4926588
403 2899849475 2899845264 Bacteria 5672268
404 2902811672 2902810491 Bacteria 6794147
405 2904580971 2904578770 Bacteria 5302906
406 2919115314 2919114240 Bacteria 5700270
407 2919121310 2919119836 Bacteria 5208557
408 2924756314 2924754689 Bacteria 6774424
409 2926756360 2926754445 Bacteria 5964435
410 2926760582 2926760298 Bacteria 5505990
411 2929140438 2929138655 Bacteria 5810547
412 2933008240 2933006813 Bacteria 4912075
413 2933013061 2933011516 Bacteria 5439334
414 2941482303
415 2958075821 2958071322 Bacteria 6815895
416 2970529003 2970524798 Bacteria 6840927
417 2970541735 2970540015 Bacteria 6977556
418 2979094138 2979089926 Bacteria 5670289
419 2979098481 2979095461 Bacteria 5669583
420 2979106098 2979100975 Bacteria 5423623
421 2984512113 2984509177 Bacteria 5274802
422 2984521526 2984518228 Bacteria 5277463
423 2984540820 2984537506 Bacteria 5277481
424 2984603088 2984601300 Bacteria 5455244
425 650739990 650716007 Bacteria 5573770
426 8002394590 8002392321 Bacteria 4159911
427 8003570989 8003570095 Bacteria 5747666
428 8004402815 8004395343 Bacteria 6620908
429 8004637903 8004633249 Bacteria 6723080
430 8048748285 8048746797 Bacteria 3557226
431 8054462319 8054460903 Bacteria 4872905
432 8055228822 8055225921 Bacteria 3341787
433 8055623614 8055617313 Bacteria 7548464
434 nmdc:mga05p37_125767_c1
435 JGI25162J39368_1000019
436 JGI25157J39369_1002710
437 JGI25157J39369_1007157
438 rootH1_10084387
439 JGI25404J52841_10023507
440 Ga0055529_1001004
441 Ga0055529_1013198
442 Ga0055528_1010866
443 Ga0055531_10031283
444 Ga0058692_1000350
445 Ga0058692_1006447
446 Ga0065704_10071062
447 Ga0070658_10127059
448 Ga0070676_10246985
449 Ga0070683_100051406
450 Ga0070692_10376855
451 Ga0070668_100024914
452 Ga0070668_100639059
453 Ga0070669_100011235
454 Ga0070671_100263132
455 Ga0070700_100233950
456 Ga0070694_100038292
457 Ga0070663_100003367
458 Ga0070663_100075645
459 Ga0070695_100011253
460 Ga0070696_100167240
461 Ga0070665_100059285
462 Ga0070665_100129882
463 Ga0070704_100897325
464 Ga0068855_100038563
465 Ga0068856_100000524
466 Ga0070702_100343036
467 Ga0068863_100196537
468 Ga0068860_100497605
469 Ga0081538_10067796
470 Ga0081540_1000066
471 Ga0081540_1094987
472 Ga0075365_10018161
473 Ga0075365_10156603
474 Ga0075368_10012399
475 Ga0075363_100015974
476 Ga0075364_10001362
477 Ga0075364_10005038
478 Ga0075364_10012484
479 Ga0075364_10044721
480 Ga0075362_10017042
481 Ga0075362_10193348
482 Ga0075367_10000551
483 Ga0075367_10008221
484 Ga0075367_10045500
485 Ga0075369_10037361
486 Ga0075428_100019260
487 Ga0075428_100059669
488 Ga0075428_100350393
489 Ga0075430_100037311
490 Ga0075430_100221784
491 Ga0075431_100028783
492 Ga0075431_100226246
493 Ga0075433_10103093
494 Ga0075433_10330085
495 Ga0075429_100123047
496 Ga0099826_10012274
497 Ga0105240_10094462
498 Ga0105240_10450785
499 Ga0111539_10000244
500 Ga0111539_10006919
501 Ga0111539_10308889
502 Ga0111539_11078543
503 Ga0114129_10026945
504 Ga0114129_10077437
505 Ga0114129_10174680
506 Ga0114129_10631542
507 Ga0105243_10023405
508 Ga0105237_10000036
509 Ga0105238_10124704
510 Ga0105249_10150529
511 Ga0105239_10880500
512 Ga0157373_10007245
513 Ga0157373_10238870
514 Ga0157371_10000015
515 Ga0157370_10000402
516 Ga0157370_10087654
517 Ga0157369_10132542
518 Ga0163163_10855553
519 Ga0157380_10091574
520 Ga0157379_10432710
521 Ga0163161_10122628
522 Ga0197907_10193616
523 Ga0206353_10203357
524 Ga0209646_1003100
525 Ga0209026_1005347
526 Ga0209759_1015258
527 Ga0209759_1020865
528 Ga0209455_1000318
529 Ga0209455_1000561
530 Ga0209025_1000094
531 Ga0209050_1003228
532 Ga0209050_1009469
533 Ga0207426_1056788
534 Ga0209257_1000453
535 Ga0207688_10044907
536 Ga0207695_10031281
537 Ga0207695_10063644
538 Ga0207695_10143660
539 Ga0207695_10320139
540 Ga0207671_10001404
541 Ga0207671_10394876
542 Ga0207694_10083495
543 Ga0207667_10477858
544 Ga0207712_10124228
545 Ga0207678_10000643
546 Ga0207708_10275909
547 Ga0207702_10000717
548 Ga0207641_10220771
549 Ga0207675_100023189
550 Ga0207675_100327099
551 Ga0209371_1000021
552 Ga0209371_1000229
553 Ga0209813_10003005
554 Ga0209813_10005503
555 Ga0207428_10005087
556 Ga0207428_10160534
557 Ga0207428_10265728
558 Ga0268265_10158903
559 Ga0268264_10150539
560 Ga0307515_10000008
561 Ga0310981_1037741
562 Ga0268256_1000020
563 Ga0268256_1000373
564 Ga0265327_10244546
565 Ga0307513_10082621
566 Ga0307405_10367191
567 Ga0307410_10312223
568 Ga0307406_10084669
569 Ga0307412_10002393
570 Ga0307414_10124105
571 Ga0307414_10224580
572 Ga0373930_0009641
573 Ga0373934_0008395
574 Ga0373940_0005389
575 Ga0373952_0023838
576 Ga0373939_0003117
577 Ga0373939_0003492
578 Ga0373941_0007641
579 Ga0373953_0140598
580 Ga0373956_0037654
581 Ga0373960_0003086
582 Ga0373942_0019298
583 Ga0373961_0024495
584 Ga0316574_0142019
585 Ga0373924_0010786
586 Ga0373924_0195999
587 Ga0373931_0001400
588 Ga0373931_0175518
589 Ga0373933_0001123
590 Ga0373937_0203218
591 Ga0373925_0624226
592 Ga0395899_0118458
593 Ga0395900_0017017
594 Ga0395905_0000281
595 Ga0395905_0007151
596 Ga0439466_0011212
597 Ga0439465_0017875
598 Ga0439465_0045354
599 Ga0439431_0010450
600 Ga0439434_0056421
601 Ga0451577_0014815
602 Ga0451576_0000056
603 Ga0495584_0057715
604 Ga0495594_0064289
605 Ga0495654_0000090
606 Ga0495640_0370005
607 Ga0495633_0015993
608 Ga0495588_0004086
609 Ga0495658_0051201
610 Ga0495681_0005741
611 Ga0495615_0072419
612 Ga0496102_0127705
613 Ga0496104_0002143
614 Ga0496105_0002738
615 Ga0496108_0038940
616 Ga0496109_0025195
617 Ga0496110_0008034
618 Ga0496110_0498209
619 Ga0496111_0001186
620 Ga0496113_0000416
621 Ga0496116_0021651
622 Ga0496116_0044286
623 Ga0496116_0096964
624 Ga0496116_0102036
625 Ga0496116_0252486
626 Ga0496117_0000002
627 Ga0496117_0015528
628 Ga0496117_0109036
629 Ga0496118_0000355
630 Ga0496118_0134539
631 Ga0496118_0152194
632 Ga0496119_0008222
633 Ga0496119_0129061
634 Ga0496119_0133074
635 Ga0496119_0229921
636 Ga0496120_0000941
637 Ga0496120_0011173
638 Ga0496120_0026602
639 Ga0496121_0000001
640 Ga0496121_0000127
641 Ga0496121_0010623
642 Ga0496121_0043945
643 Ga0496122_0000001
644 Ga0496122_0005045
645 Ga0496122_0012553
646 Ga0496122_0041338
647 Ga0496122_0135590
648 Ga0496122_0160148
649 Ga0496123_0000001
650 Ga0496123_0003857
651 Ga0496123_0018230
652 Ga0496123_0059497
653 Ga0496123_0068886
654 Ga0496123_0093440
655 Ga0496124_0000350
656 Ga0496124_0001936
657 Ga0496124_0008053
658 Ga0496124_0029563
659 Ga0496124_0075919
660 Ga0496124_0077485
661 Ga0496124_0084405
662 Ga0496124_0189634
663 Ga0496124_0260599
664 Ga0496124_0367320
665 Ga0496125_0000011
666 Ga0496125_0000155
667 Ga0496125_0001827
668 Ga0496125_0012037
669 Ga0496125_0024477
670 Ga0496125_0188400
671 Ga0496125_0225179
672 Ga0496126_0007762
673 Ga0496126_0073037
674 Ga0496126_0090960
675 Ga0496126_0111426
676 Ga0496126_0134550
677 Ga0501031_0000018
678 Ga0501031_0170461
679 Ga0501032_0000003
680 Ga0501032_0015743
681 Ga0501033_0000076
682 Ga0501033_0000132
683 Ga0501033_0001111
684 Ga0501033_0003112
685 Ga0501033_0197023
686 Ga0501034_0000005
687 Ga0501034_0000408
688 Ga0501034_0031597
689 Ga0501034_0123639
690 Ga0501034_0257793
691 Ga0501034_0271171
692 Ga0501034_0416089
693 Ga0501036_0000005
694 Ga0501036_0000732
695 Ga0501036_0146017
696 Ga0501037_0000045
697 Ga0501037_0001237
698 Ga0501037_0039291
699 Ga0501038_0000001
700 Ga0501038_0000327
701 Ga0501038_0715145
702 Ga0501039_0000007
703 Ga0501039_0000038
704 Ga0501039_0221120
705 Ga0501040_0429336
706 Ga0501041_0287210
707 Ga0501042_0109620
708 Ga0501043_0000043
709 Ga0501043_0000333
710 Ga0501046_0326239
711 Ga0501047_0012601
712 Ga0501047_0013933
713 Ga0501047_0041578
714 Ga0501047_0050638
715 Ga0501047_0330793
716 Ga0501048_0003495
717 Ga0501070_0322405
718 Ga0501073_0105818
719 Ga0501073_0205596
720 Ga0501074_0054859
721 Ga0501077_0087053
722 Ga0501077_0314210
723 Ga0501080_0134207
724 Ga0501080_0215846
725 Ga0501083_0059951
726 Ga0501271_010846
727 Ga0501035_0000008
728 Ga0501035_0000297
729 Ga0501035_0011268
730 Ga0501035_0011392
731 Ga0501035_0035061
732 Ga0501035_0084365
733 Ga0501035_0121020
734 Ga0501035_0726058
735 Ga0501044_0000001
736 Ga0501044_0000048
737 Ga0501044_0005318
738 Ga0501044_0008906
739 Ga0501044_0082677
740 Ga0501044_0134348
741 Ga0501044_0196742
742 Ga0501044_0294837
743 nmdc:mga03683_10605_c1
744 nmdc:mga03n38_42648_c1
745 nmdc:mga00v17_103233_c1
746 nmdc:mga00v17_35459_c1
747 nmdc:mga00v17_356867_c1
748 nmdc:mga00v17_40082_c1
749 nmdc:mga00v17_41870_c1
750 nmdc:mga00v17_523_c1
751 nmdc:mga0yw44_146898_c1
752 nmdc:mga0yw44_32954_c1
753 nmdc:mga06z11_1807_c1
754 nmdc:mga06z11_18270_c1
755 nmdc:mga04h51_3295_c1
756 nmdc:mga04h51_6269_c1
757 nmdc:mga07m45_198004_c1
758 nmdc:mga05p37_46807_c1
759 nmdc:mga05p37_61887_c1
760 nmdc:mga05p37_74192_c1
761 nmdc:mga0qj67_125921_c1
762 nmdc:mga0qj67_176815_c1
763 nmdc:mga06r32_102036_c1
764 nmdc:mga06r32_173619_c1
765 nmdc:mga06r32_63783_c1
766 nmdc:mga08y16_222362_c1
767 nmdc:mga08y16_48542_c1
768 nmdc:mga08y16_54773_c1
769 nmdc:mga08y16_56_c1
770 nmdc:mga0sz30_219640_c1
771 Ga0495619_0054227
772 Ga0500578_0101804
773 Ga0500643_062368
774 Ga0500651_0000463
775 Ga0500560_006454
776 Ga0500561_0114617
777 Ga0500568_0000799
778 Ga0500616_0009282
779 Ga0500616_0035541
780 Ga0500634_0013508
781 2509075636
782 2509141001
783 2537877731
784 2538833567
785 2597815708
786 2599604004
787 2599720969
788 2599906193
789 2643829208
790 2643861975
791 2643919227
792 2643980981
793 2644122445
794 2644635425
795 2739309243
796 2739613086
797 2765464984
798 2770199614
799 2770199640
800 2774874289
801 2776262494
802 2808985491
803 2809031693
804 2819559968
805 2835319772
806 2838676339
807 2838715222
808 2838720978
809 2838725980
810 2840767765
811 2841735178
812 2841847936
813 2841859512
814 2842126034
815 2842131233
816 2842153597
817 2842171465
818 2842177217
819 2842188330
820 2842212641
821 2842225740
822 2842516297
823 2856349374
824 2857540765
825 2857545488
826 2858956515
827 2871481382
828 2881414100
829 2881930977
830 2882462099
831 2883358276
832 2887378659
833 2888349197
834 2894237801
835 2899796309
836 2899849475
837 2902811672
838 2904580971
839 2919115314
840 2919121310
841 2924756314
842 2926756360
843 2926760582
844 2929140438
845 2933008240
846 2933013061
847 2941482303
848 2958075821
849 2970529003
850 2970541735
851 2979094138
852 2979098481
853 2979106098
854 2984512113
855 2984521526
856 2984540820
857 2984603088
858 650739990
859 8002394590
860 8003570989
861 8004402815
862 8004637903
863 8048748285
864 8054462319
865 8055228822
866 8055623614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

56

256

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4maq-assembly1.cif.gz_B crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9774 1 228
4maq-assembly1.cif.gz_A crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9752 2 228
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9595 25 228
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9575 26 228
1nr9-assembly2.cif.gz_C crystal structure of escherichia coli 1262 (apc5008), putative isomerase 0.9542 23 229
ID Description Score Start End Superfamily
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9752 2 228 3.90.850.10
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9538 2 228 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9458 25 228 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9216 25 228 3.90.850.10
af_A4IBF4_2_274_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9211 3 229 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A226WXR6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9823 84 227 GO:0018773
GO:0046872
AF-W9T2P7-F1-model_v4 Putative fumarylpyruvate hydrolase 0.9792 113 228 GO:0018773
GO:0046872
AF-A0A435SEY7-F1-model_v4 deleted 0.9787 69 227
AF-A0A812IQ58-F1-model_v4 deleted 0.9711 42 229
AF-A0A6I6QJK9-F1-model_v4 deleted 0.9708 1 228

Map