F442968

General Info

Members Datasets Scaffolds Average Seq Length
433 187 433 261

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0153782|Ga0530510_0153782_65_916
Length 283
Sequence MRVLVTGAASGIGRATCIRLTQDAKAAGRTAQVAAVDVGPSPGLDSLVAELRGLGAEALPLPGDMGTAEAPARVVAQAVQSFGGLDGLVSNAGINRPGALVEYAVEDWDRLFAVNTRATWLLAKAAHAALCASGGAIVAVGSMSGSHVHAGLGAYGPSKAAVIMLVRVLAQELGPDGIRVNAVSPGMTRTGMTARVYADARVAAERDALVPLGRVATPHDMAAAIAFLLSSDARYVNGHDLVVDGGLIGNHLGRLPGFRRSRAPDEAPTKGDRPCPHDASGSG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 99.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10011846 3300005328 Bacteria 4749
2 Ga0070683_100022063 3300005329 Bacteria 5686
3 Ga0070670_100008416 3300005331 Bacteria 8794
4 Ga0068869_100001527 3300005334 Bacteria 13740
5 Ga0068869_100001976 3300005334 Bacteria 12305
6 Ga0068869_100178475 3300005334 Bacteria 1664
7 Ga0070680_100005694 3300005336 Bacteria 9447
8 Ga0070680_100104807 3300005336 Bacteria 2350
9 Ga0070682_100000189 3300005337 Bacteria 46408
10 Ga0070660_100001257 3300005339 Bacteria 17241
11 Ga0070689_100014654 3300005340 Bacteria 5701
12 Ga0070691_10043405 3300005341 Bacteria 2130
13 Ga0070661_100001900 3300005344 Bacteria 14469
14 Ga0070673_100042049 3300005364 Bacteria 3521
15 Ga0070688_100139100 3300005365 Bacteria 1647
16 Ga0070659_100003162 3300005366 Bacteria 11732
17 Ga0070703_10001030 3300005406 Bacteria 8719
18 Ga0070703_10016681 3300005406 Bacteria 2109
19 Ga0070709_10365927 3300005434 Bacteria 1069
20 Ga0070701_10011313 3300005438 Bacteria 3985
21 Ga0070705_100001265 3300005440 Bacteria 13637
22 Ga0070705_100017997 3300005440 Bacteria 3696
23 Ga0070705_100096026 3300005440 Bacteria 1860
24 Ga0070700_100024917 3300005441 Bacteria 3518
25 Ga0070700_100058496 3300005441 Bacteria 2422
26 Ga0070694_100000709 3300005444 Bacteria 18554
27 Ga0070694_100000771 3300005444 Bacteria 17914
28 Ga0070694_100004956 3300005444 Bacteria 8031
29 Ga0070694_100073281 3300005444 Bacteria 2365
30 Ga0070694_100188608 3300005444 Bacteria 1530
31 Ga0070708_100026704 3300005445 Bacteria 4946
32 Ga0070708_100052189 3300005445 Bacteria 3625
33 Ga0070708_100198272 3300005445 Bacteria 1879
34 Ga0070708_100254965 3300005445 Bacteria 1648
35 Ga0070708_100264048 3300005445 Bacteria 1618
36 Ga0070663_100001979 3300005455 Bacteria 11431
37 Ga0070681_10012177 3300005458 Bacteria 8529
38 Ga0068867_100002214 3300005459 Bacteria 13646
39 Ga0068867_100062387 3300005459 Bacteria 2769
40 Ga0070706_100251899 3300005467 Bacteria 1648
41 Ga0070706_100595084 3300005467 Bacteria 1028
42 Ga0070707_100060085 3300005468 Bacteria 3645
43 Ga0070707_100213567 3300005468 Bacteria 1880
44 Ga0070707_100271627 3300005468 Bacteria 1648
45 Ga0070707_100273459 3300005468 Bacteria 1642
46 Ga0070698_100216499 3300005471 Bacteria 1849
47 Ga0070699_100011444 3300005518 Bacteria 7661
48 Ga0070699_100066445 3300005518 Bacteria 3130
49 Ga0070679_100016369 3300005530 Bacteria 7150
50 Ga0070684_100005008 3300005535 Bacteria 10121
51 Ga0070697_100011316 3300005536 Bacteria 6971
52 Ga0070697_100018482 3300005536 Bacteria 5496
53 Ga0070697_100058970 3300005536 Bacteria 3124
54 Ga0070697_100210206 3300005536 Bacteria 1656
55 Ga0070697_100248899 3300005536 Bacteria 1519
56 Ga0068853_100007406 3300005539 Bacteria 8779
57 Ga0068853_100070864 3300005539 Bacteria 3035
58 Ga0070695_100000540 3300005545 Bacteria 20012
59 Ga0070695_100001076 3300005545 Bacteria 14926
60 Ga0070695_100003284 3300005545 Bacteria 9451
61 Ga0070696_100009359 3300005546 Bacteria 6559
62 Ga0070696_100013743 3300005546 Bacteria 5437
63 Ga0070696_100047596 3300005546 Bacteria 2975
64 Ga0070696_100357845 3300005546 Bacteria 1132
65 Ga0070693_100001198 3300005547 Bacteria 11671
66 Ga0070693_100027745 3300005547 Bacteria 3072
67 Ga0070704_100003421 3300005549 Bacteria 9097
68 Ga0070704_100359472 3300005549 Bacteria 1231
69 Ga0068855_100000315 3300005563 Bacteria 60189
70 Ga0070664_100001078 3300005564 Bacteria 21493
71 Ga0068857_100006547 3300005577 Bacteria 9993
72 Ga0068857_100019705 3300005577 Bacteria 5926
73 Ga0068854_100001899 3300005578 Bacteria 12731
74 Ga0068856_100001193 3300005614 Bacteria 27374
75 Ga0068859_100007963 3300005617 Bacteria 10752
76 Ga0068864_100225335 3300005618 Bacteria 1731
77 Ga0068866_10058493 3300005718 Bacteria 1991
78 Ga0068861_100005299 3300005719 Bacteria 8705
79 Ga0068870_10001408 3300005840 Bacteria 9705
80 Ga0068860_100188402 3300005843 Bacteria 1996
81 Ga0068860_100246240 3300005843 Bacteria 1740
82 Ga0068860_100374028 3300005843 Bacteria 1406
83 Ga0068860_100611297 3300005843 Bacteria 1096
84 Ga0068862_100005205 3300005844 Bacteria 10927
85 Ga0068862_100008936 3300005844 Bacteria 8295
86 Ga0068862_100306462 3300005844 Bacteria 1462
87 Ga0081455_10007944 3300005937 Bacteria 11100
88 Ga0081538_10005367 3300005981 Bacteria 11521
89 Ga0081540_1021420 3300005983 Bacteria 3849
90 Ga0081539_10000020 3300005985 Bacteria 366549
91 Ga0075428_100000622 3300006844 Bacteria 36242
92 Ga0075428_100024097 3300006844 Bacteria 6734
93 Ga0075428_100030836 3300006844 Bacteria 5928
94 Ga0075428_100078574 3300006844 Bacteria 3602
95 Ga0075428_100168433 3300006844 Bacteria 2376
96 Ga0075430_100000084 3300006846 Bacteria 53212
97 Ga0075430_100004388 3300006846 Bacteria 11908
98 Ga0075430_100012282 3300006846 Bacteria 7289
99 Ga0075430_100025516 3300006846 Bacteria 5028
100 Ga0075430_100033865 3300006846 Bacteria 4335
101 Ga0075430_100161591 3300006846 Bacteria 1864
102 Ga0075430_100590895 3300006846 Bacteria 916
103 Ga0075431_100000641 3300006847 Bacteria 29614
104 Ga0075431_100000732 3300006847 Bacteria 28297
105 Ga0075431_100005985 3300006847 Bacteria 12050
106 Ga0075431_100020914 3300006847 Bacteria 6687
107 Ga0075431_100049328 3300006847 Bacteria 4341
108 Ga0075431_100082644 3300006847 Bacteria 3316
109 Ga0075431_100089456 3300006847 Bacteria 3178
110 Ga0075431_100328437 3300006847 Bacteria 1541
111 Ga0075433_10031303 3300006852 Bacteria 4547
112 Ga0075433_10040131 3300006852 Bacteria 4050
113 Ga0075434_100073082 3300006871 Bacteria 3421
114 Ga0075434_100074559 3300006871 Bacteria 3386
115 Ga0075434_100101023 3300006871 Bacteria 2890
116 Ga0075434_100280264 3300006871 Bacteria 1686
117 Ga0075434_100281345 3300006871 Bacteria 1683
118 Ga0075434_100301245 3300006871 Bacteria 1623
119 Ga0075429_100000177 3300006880 Bacteria 41340
120 Ga0075429_100008950 3300006880 Bacteria 8697
121 Ga0075429_100010352 3300006880 Bacteria 8069
122 Ga0075429_100012386 3300006880 Bacteria 7398
123 Ga0075429_100047000 3300006880 Bacteria 3755
124 Ga0075436_100116991 3300006914 Bacteria 1863
125 Ga0097620_100007963 3300006931 Bacteria 10752
126 Ga0097620_101027591 3300006931 Bacteria 905
127 Ga0075435_100058980 3300007076 Bacteria 3110
128 Ga0075435_100113924 3300007076 Bacteria 2251
129 Ga0075435_100198332 3300007076 Bacteria 1700
130 Ga0099794_10039204 3300007265 Bacteria 2247
131 Ga0099794_10114555 3300007265 Bacteria 1353
132 Ga0111539_10001204 3300009094 Bacteria 34439
133 Ga0111539_10220193 3300009094 Bacteria 2211
134 Ga0111539_10402057 3300009094 Bacteria 1595
135 Ga0105245_10249576 3300009098 Bacteria 1723
136 Ga0114129_10001612 3300009147 Bacteria 30630
137 Ga0114129_10013466 3300009147 Bacteria 11653
138 Ga0114129_10017502 3300009147 Bacteria 10204
139 Ga0114129_10031997 3300009147 Bacteria 7436
140 Ga0114129_10057438 3300009147 Bacteria 5445
141 Ga0114129_10058387 3300009147 Bacteria 5396
142 Ga0114129_10134062 3300009147 Bacteria 3400
143 Ga0114129_10266189 3300009147 Bacteria 2295
144 Ga0114129_10885016 3300009147 Bacteria 1133
145 Ga0105243_10025385 3300009148 Bacteria 4528
146 Ga0105241_10038687 3300009174 Bacteria 3596
147 Ga0105242_10003823 3300009176 Bacteria 11707
148 Ga0105248_10645942 3300009177 Unclassified 1194
149 Ga0105249_10137529 3300009553 Bacteria 2340
150 Ga0157373_10000317 3300013100 Bacteria 38873
151 Ga0157369_10007617 3300013105 Bacteria 12456
152 Ga0157378_10145548 3300013297 Bacteria 2204
153 Ga0163163_10046753 3300014325 Bacteria 4251
154 Ga0157380_10271537 3300014326 Bacteria 1546
155 Ga0206356_10779955 3300020070 Bacteria 1303
156 Ga0207653_10000733 3300025885 Bacteria 11228
157 Ga0207653_10064239 3300025885 Bacteria 1244
158 Ga0207642_10357323 3300025899 Bacteria 863
159 Ga0207688_10006383 3300025901 Bacteria 6422
160 Ga0207699_10193883 3300025906 Bacteria 1372
161 Ga0207645_10000442 3300025907 Bacteria 34471
162 Ga0207643_10000411 3300025908 Bacteria 28425
163 Ga0207643_10117544 3300025908 Bacteria 1572
164 Ga0207684_10037473 3300025910 Bacteria 4114
165 Ga0207684_10052424 3300025910 Bacteria 3462
166 Ga0207684_10151664 3300025910 Bacteria 1994
167 Ga0207684_10460801 3300025910 Unclassified 1091
168 Ga0207654_10021062 3300025911 Bacteria 3463
169 Ga0207707_10002845 3300025912 Bacteria 15440
170 Ga0207693_10095636 3300025915 Unclassified 2329
171 Ga0207693_10215299 3300025915 Bacteria 1509
172 Ga0207663_10065520 3300025916 Unclassified 2322
173 Ga0207660_10001698 3300025917 Bacteria 14770
174 Ga0207660_10016990 3300025917 Bacteria 4827
175 Ga0207657_10000095 3300025919 Bacteria 85098
176 Ga0207649_10001570 3300025920 Bacteria 13320
177 Ga0207652_10001545 3300025921 Bacteria 20293
178 Ga0207646_10025429 3300025922 Bacteria 5415
179 Ga0207646_10053971 3300025922 Bacteria 3595
180 Ga0207646_10139751 3300025922 Bacteria 2181
181 Ga0207646_10185547 3300025922 Bacteria 1879
182 Ga0207646_10270717 3300025922 Bacteria 1535
183 Ga0207646_10739084 3300025922 Bacteria 878
184 Ga0207681_10019266 3300025923 Bacteria 4310
185 Ga0207650_10050705 3300025925 Bacteria 3070
186 Ga0207690_10002172 3300025932 Bacteria 11967
187 Ga0207706_10000780 3300025933 Bacteria 32994
188 Ga0207706_10059901 3300025933 Bacteria 3353
189 Ga0207686_10234966 3300025934 Bacteria 1331
190 Ga0207709_10006452 3300025935 Bacteria 6587
191 Ga0207665_10006802 3300025939 Bacteria 7576
192 Ga0207711_10100524 3300025941 Bacteria 2558
193 Ga0207711_10533039 3300025941 Unclassified 1095
194 Ga0207689_10000121 3300025942 Bacteria 65023
195 Ga0207689_10016738 3300025942 Bacteria 6206
196 Ga0207689_10120434 3300025942 Bacteria 2159
197 Ga0207679_10000385 3300025945 Bacteria 31832
198 Ga0207667_10002155 3300025949 Bacteria 24692
199 Ga0207651_10033002 3300025960 Bacteria 3333
200 Ga0207640_10097403 3300025981 Bacteria 2053
201 Ga0207677_10026020 3300026023 Bacteria 3662
202 Ga0207703_10039894 3300026035 Bacteria 3755
203 Ga0207703_10233926 3300026035 Bacteria 1649
204 Ga0207639_10015306 3300026041 Bacteria 5408
205 Ga0207639_10052798 3300026041 Bacteria 3099
206 Ga0207678_10004871 3300026067 Bacteria 12054
207 Ga0207708_10107981 3300026075 Bacteria 2158
208 Ga0207702_10007037 3300026078 Bacteria 9624
209 Ga0207641_10342085 3300026088 Bacteria 1424
210 Ga0207641_10406584 3300026088 Unclassified 1308
211 Ga0207648_10000997 3300026089 Bacteria 31973
212 Ga0207676_10478050 3300026095 Bacteria 1179
213 Ga0207674_10000307 3300026116 Bacteria 62207
214 Ga0207674_10008616 3300026116 Bacteria 11757
215 Ga0207675_100050316 3300026118 Bacteria 3888
216 Ga0209969_1001525 3300027360 Bacteria 3193
217 Ga0210000_1006177 3300027462 Bacteria 1744
218 Ga0209999_1007526 3300027543 Bacteria 1961
219 Ga0209970_1006595 3300027614 Bacteria 1906
220 Ga0209983_1001579 3300027665 Bacteria 5044
221 Ga0209983_1030429 3300027665 Bacteria 1149
222 Ga0209971_1000003 3300027682 Bacteria 110664
223 Ga0209966_1000045 3300027695 Bacteria 52459
224 Ga0209966_1022606 3300027695 Bacteria 1231
225 Ga0209998_10000124 3300027717 Bacteria 30188
226 Ga0207428_10000029 3300027907 Bacteria 241338
227 Ga0207428_10000214 3300027907 Bacteria 80012
228 Ga0268265_10004050 3300028380 Bacteria 10310
229 Ga0268265_10721906 3300028380 Bacteria 965
230 Ga0268264_10837268 3300028381 Bacteria 921
231 Ga0307408_100027130 3300031548 Bacteria 3944
232 Ga0307406_10380384 3300031901 Bacteria 1113
233 Ga0307412_10427774 3300031911 Bacteria 1085
234 Ga0307416_100025094 3300032002 Bacteria 4364
235 Ga0307416_100171819 3300032002 Bacteria 2019
236 Ga0307416_100270038 3300032002 Bacteria 1669
237 Ga0373930_0038693 3300034816 Bacteria 1009
238 Ga0373940_0020798 3300035088 Bacteria 1671
239 Ga0373940_0030433 3300035088 Bacteria 1436
240 Ga0373940_0034700 3300035088 Bacteria 1362
241 Ga0373951_0005865 3300035091 Bacteria 2837
242 Ga0373932_0009495 3300035112 Bacteria 2339
243 Ga0373961_0009084 3300035241 Bacteria 2426
244 Ga0373961_0063049 3300035241 Bacteria 1130
245 Ga0373962_0062981 3300035242 Bacteria 1093
246 Ga0373962_0073670 3300035242 Bacteria 1025
247 Ga0439443_024577 3300042003 Unclassified 967
248 Ga0439448_0000097 3300042005 Bacteria 15663
249 Ga0439460_0000569 3300042461 Bacteria 8087
250 Ga0451577_0000785 3300042876 Bacteria 47794
251 Ga0451577_0082240 3300042876 Bacteria 2872
252 Ga0451577_0315165 3300042876 Bacteria 1418
253 Ga0453683_0065028 3300044673 Bacteria 2280
254 Ga0453684_0145427 3300044712 Bacteria 2825
255 Ga0453684_0327154 3300044712 Bacteria 1734
256 Ga0451576_0005524 3300045051 Bacteria 15791
257 Ga0451576_0037223 3300045051 Bacteria 5154
258 Ga0451576_0056093 3300045051 Bacteria 4121
259 Ga0451576_0157842 3300045051 Bacteria 2367
260 Ga0496102_0140395 3300048905 Bacteria 2265
261 Ga0496102_0520567 3300048905 Bacteria 1112
262 Ga0496110_0048534 3300048913 Bacteria 3722
263 Ga0501031_0000852 3300049568 Bacteria 18319
264 Ga0501032_0087194 3300049569 Bacteria 2073
265 Ga0501033_0015758 3300049570 Bacteria 5730
266 Ga0501036_0003119 3300049572 Bacteria 13230
267 Ga0501036_0021976 3300049572 Bacteria 5365
268 Ga0501036_0163092 3300049572 Bacteria 1879
269 Ga0501037_0002813 3300049573 Bacteria 12617
270 Ga0501037_0400534 3300049573 Bacteria 941
271 Ga0501038_0000665 3300049574 Bacteria 30606
272 Ga0501038_0016690 3300049574 Bacteria 6653
273 Ga0501038_0371471 3300049574 Bacteria 1111
274 Ga0501039_0001823 3300049575 Bacteria 15759
275 Ga0501039_0016108 3300049575 Bacteria 5726
276 Ga0501039_0016444 3300049575 Bacteria 5667
277 Ga0501040_0002463 3300049576 Bacteria 11924
278 Ga0501040_0003245 3300049576 Bacteria 10513
279 Ga0501040_0021123 3300049576 Bacteria 4342
280 Ga0501040_0065808 3300049576 Bacteria 2497
281 Ga0501040_0073018 3300049576 Bacteria 2370
282 Ga0501041_0001618 3300049577 Bacteria 12566
283 Ga0501041_0003903 3300049577 Bacteria 8591
284 Ga0501042_0000025 3300049578 Bacteria 48562
285 Ga0501042_0000655 3300049578 Bacteria 18579
286 Ga0501042_0006208 3300049578 Bacteria 7756
287 Ga0501042_0039054 3300049578 Bacteria 3373
288 Ga0501042_0123669 3300049578 Bacteria 1863
289 Ga0501042_0204565 3300049578 Bacteria 1424
290 Ga0501042_0256017 3300049578 Bacteria 1263
291 Ga0501042_0310192 3300049578 Bacteria 1140
292 Ga0501043_0019688 3300049579 Bacteria 5300
293 Ga0501043_0151951 3300049579 Bacteria 1812
294 Ga0501046_0010632 3300049580 Bacteria 7895
295 Ga0501046_0013046 3300049580 Bacteria 7052
296 Ga0501046_0032443 3300049580 Bacteria 4229
297 Ga0501046_0248164 3300049580 Bacteria 1311
298 Ga0501046_0432918 3300049580 Bacteria 947
299 Ga0501048_0000410 3300049582 Bacteria 29950
300 Ga0501048_0020849 3300049582 Bacteria 4802
301 Ga0501048_0070410 3300049582 Bacteria 2470
302 Ga0501048_0133398 3300049582 Bacteria 1755
303 Ga0501067_0214644 3300049583 Bacteria 1072
304 Ga0501068_0093478 3300049584 Bacteria 1858
305 Ga0501069_0059427 3300049585 Bacteria 2133
306 Ga0501069_0100972 3300049585 Bacteria 1638
307 Ga0501070_0019797 3300049586 Bacteria 5644
308 Ga0501071_0005377 3300049587 Bacteria 8222
309 Ga0501071_0020070 3300049587 Bacteria 4643
310 Ga0501071_0035328 3300049587 Bacteria 3560
311 Ga0501071_0104285 3300049587 Bacteria 2092
312 Ga0501071_0122560 3300049587 Bacteria 1928
313 Ga0501071_0144191 3300049587 Bacteria 1775
314 Ga0501071_0279066 3300049587 Bacteria 1264
315 Ga0501072_0004197 3300049588 Bacteria 10923
316 Ga0501072_0025419 3300049588 Bacteria 4613
317 Ga0501072_0032398 3300049588 Bacteria 4093
318 Ga0501072_0052490 3300049588 Bacteria 3210
319 Ga0501072_0098492 3300049588 Bacteria 2324
320 Ga0501073_0056624 3300049589 Bacteria 2742
321 Ga0501073_0459213 3300049589 Bacteria 880
322 Ga0501074_0001414 3300049590 Bacteria 15973
323 Ga0501074_0009141 3300049590 Bacteria 7195
324 Ga0501074_0182192 3300049590 Bacteria 1498
325 Ga0501074_0237048 3300049590 Bacteria 1298
326 Ga0501074_0441650 3300049590 Bacteria 923
327 Ga0501075_0001399 3300049591 Bacteria 15704
328 Ga0501075_0004977 3300049591 Bacteria 9062
329 Ga0501075_0086334 3300049591 Bacteria 2377
330 Ga0501075_0103441 3300049591 Bacteria 2164
331 Ga0501075_0152864 3300049591 Bacteria 1759
332 Ga0501075_0165902 3300049591 Bacteria 1685
333 Ga0501075_0344916 3300049591 Bacteria 1135
334 Ga0501076_0000399 3300049592 Bacteria 27186
335 Ga0501076_0006070 3300049592 Bacteria 8738
336 Ga0501076_0159511 3300049592 Bacteria 1837
337 Ga0501076_0282302 3300049592 Bacteria 1360
338 Ga0501077_0000213 3300049593 Bacteria 33845
339 Ga0501077_0097482 3300049593 Bacteria 1863
340 Ga0501077_0142283 3300049593 Bacteria 1521
341 Ga0501079_0000431 3300049741 Bacteria 27315
342 Ga0501079_0004049 3300049741 Bacteria 10849
343 Ga0501079_0014594 3300049741 Bacteria 5991
344 Ga0501079_0053523 3300049741 Bacteria 3114
345 Ga0501079_0382075 3300049741 Bacteria 1104
346 Ga0501080_0003518 3300049742 Bacteria 13791
347 Ga0501080_0007373 3300049742 Bacteria 9926
348 Ga0501081_0000190 3300049743 Bacteria 29695
349 Ga0501081_0008464 3300049743 Bacteria 6685
350 Ga0501081_0011350 3300049743 Bacteria 5830
351 Ga0501081_0018064 3300049743 Bacteria 4679
352 Ga0501081_0082576 3300049743 Bacteria 2251
353 Ga0501081_0099701 3300049743 Bacteria 2052
354 Ga0501081_0120385 3300049743 Bacteria 1869
355 Ga0501081_0172047 3300049743 Bacteria 1564
356 Ga0501081_0458531 3300049743 Bacteria 947
357 Ga0501083_0005850 3300049744 Bacteria 8709
358 Ga0501083_0017859 3300049744 Bacteria 4948
359 Ga0501035_0019516 3300049822 Bacteria 6232
360 Ga0501035_0120137 3300049822 Bacteria 2298
361 Ga0501035_0378956 3300049822 Bacteria 1180
362 Ga0501045_0000034 3300049824 Bacteria 58823
363 Ga0501045_0002101 3300049824 Bacteria 13468
364 Ga0501045_0041068 3300049824 Bacteria 3365
365 Ga0501045_0209207 3300049824 Bacteria 1453
366 nmdc:mga05p37_127152_c1 3300050507 Bacteria 3129
367 nmdc:mga05p37_13728_c1 3300050507 Bacteria 9070
368 nmdc:mga05p37_191828_c1 3300050507 Bacteria 2480
369 nmdc:mga05p37_210074_c1 3300050507 Bacteria 2353
370 nmdc:mga05p37_2219_c1 3300050507 Bacteria 22635
371 nmdc:mga05p37_275575_c1 3300050507 Bacteria 2009
372 nmdc:mga05p37_29037_c1 3300050507 Bacteria 6749
373 nmdc:mga05p37_53612_c1 3300050507 Bacteria 4960
374 nmdc:mga05p37_61826_c1 3300050507 Bacteria 4610
375 nmdc:mga05p37_68123_c1 3300050507 Bacteria 4377
376 nmdc:mga05p37_72571_c1 3300050507 Bacteria 4236
377 nmdc:mga09592_1740_c1 3300050508 Bacteria 17511
378 nmdc:mga09592_26924_c1 3300050508 Bacteria 4767
379 nmdc:mga09592_3336_c1 3300050508 Bacteria 12983
380 nmdc:mga09592_445_c1 3300050508 Bacteria 30603
381 nmdc:mga09592_44888_c1 3300050508 Bacteria 3722
382 nmdc:mga09592_689080_c1 3300050508 Bacteria 870
383 nmdc:mga0qj67_17352_c1 3300050509 Bacteria 5472
384 nmdc:mga0qj67_177121_c1 3300050509 Bacteria 1732
385 nmdc:mga0qj67_195959_c1 3300050509 Bacteria 1642
386 nmdc:mga0qj67_2722_c1 3300050509 Bacteria 12673
387 nmdc:mga0qj67_7046_c1 3300050509 Bacteria 8289
388 nmdc:mga06r32_1072968_c1 3300050510 Bacteria 755
389 nmdc:mga06r32_1543_c1 3300050510 Bacteria 20750
390 nmdc:mga06r32_2624_c1 3300050510 Bacteria 16054
391 nmdc:mga06r32_27293_c1 3300050510 Bacteria 5332
392 nmdc:mga06r32_4619_c1 3300050510 Bacteria 12346
393 nmdc:mga06r32_4823_c1 3300050510 Bacteria 12141
394 nmdc:mga06r32_65489_c1 3300050510 Bacteria 3505
395 nmdc:mga06r32_75797_c1 3300050510 Bacteria 3265
396 nmdc:mga06r32_939725_c1 3300050510 Bacteria 820
397 nmdc:mga08y16_307377_c1 3300050511 Bacteria 1633
398 nmdc:mga08y16_40161_c1 3300050511 Bacteria 4905
399 nmdc:mga08y16_4887_c1 3300050511 Bacteria 14001
400 nmdc:mga08y16_525_c1 3300050511 Bacteria 35391
401 nmdc:mga0n895_11932_c1 3300050512 Bacteria 7776
402 nmdc:mga0n895_121612_c1 3300050512 Bacteria 2632
403 nmdc:mga0n895_258110_c1 3300050512 Bacteria 1769
404 nmdc:mga0n895_274485_c1 3300050512 Bacteria 1710
405 nmdc:mga0n895_387246_c1 3300050512 Bacteria 1414
406 nmdc:mga0rr50_170688_c1 3300050513 Bacteria 1772
407 nmdc:mga0rr50_191084_c1 3300050513 Bacteria 1678
408 nmdc:mga0rr50_26474_c1 3300050513 Bacteria 4047
409 nmdc:mga0rr50_54196_c1 3300050513 Bacteria 2987
410 nmdc:mga08x19_2075_c1 3300050514 Bacteria 12261
411 nmdc:mga0a205_112188_c1 3300050515 Bacteria 2626
412 nmdc:mga0a205_126662_c1 3300050515 Bacteria 2454
413 nmdc:mga0a205_228047_c1 3300050515 Bacteria 1747
414 nmdc:mga0a205_2359_c1 3300050515 Bacteria 16652
415 nmdc:mga0a205_2857_c1 3300050515 Bacteria 15285
416 nmdc:mga0a205_427724_c1 3300050515 Bacteria 1186
417 nmdc:mga0a205_481235_c1 3300050515 Bacteria 1100
418 nmdc:mga0a205_638728_c1 3300050515 Bacteria 916
419 Ga0501084_0002090 3300054114 Bacteria 15950
420 Ga0501084_0002977 3300054114 Bacteria 13721
421 Ga0501084_0034470 3300054114 Bacteria 4233
422 Ga0501084_0043164 3300054114 Bacteria 3772
423 Ga0501084_0111159 3300054114 Bacteria 2303
424 Ga0501082_0000814 3300060353 Bacteria 27392
425 Ga0501082_0002071 3300060353 Bacteria 17644
426 Ga0501082_0010052 3300060353 Bacteria 8153
427 Ga0501082_0051158 3300060353 Bacteria 3561
428 Ga0530510_0000207 3300061734 Bacteria 36298
429 Ga0530510_0034230 3300061734 Bacteria 3658
430 Ga0530510_0153782 3300061734 Bacteria 1699
431 Ga0530510_0367099 3300061734 Bacteria 1082
432 Ga0530510_0385490 3300061734 Bacteria 1055
433 Ga0530510_0638740 3300061734 Bacteria 810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100001527 Ga0068869_1000015272 226
2 3300005546 Ga0070696_100047596 Ga0070696_1000475963 226
3 3300005547 Ga0070693_100027745 Ga0070693_1000277452 226
4 3300009098 Ga0105245_10249576 Ga0105245_102495762 226
5 3300006844 Ga0075428_100024097 Ga0075428_1000240973 227
6 3300006847 Ga0075431_100000732 Ga0075431_10000073218 227
7 3300006880 Ga0075429_100008950 Ga0075429_1000089505 227
8 3300009147 Ga0114129_10001612 Ga0114129_1000161226 227
9 3300050507 nmdc:mga05p37_2219_c1 nmdc:mga05p37_2219_c1_17623_18420 227
10 3300050508 nmdc:mga09592_1740_c1 nmdc:mga09592_1740_c1_5181_5978 227
11 3300050510 nmdc:mga06r32_1543_c1 nmdc:mga06r32_1543_c1_8336_9133 227
12 3300006847 Ga0075431_100020914 Ga0075431_1000209144 228
13 3300050510 nmdc:mga06r32_4619_c1 nmdc:mga06r32_4619_c1_4898_5698 228
14 3300049579 Ga0501043_0151951 Ga0501043_0151951_778_1518 229
15 3300006871 Ga0075434_100280264 Ga0075434_1002802642 230
16 3300009094 Ga0111539_10402057 Ga0111539_104020572 230
17 3300050508 nmdc:mga09592_689080_c1 nmdc:mga09592_689080_c1_86_781 230
18 3300050511 nmdc:mga08y16_307377_c1 nmdc:mga08y16_307377_c1_574_1368 230
19 3300050512 nmdc:mga0n895_387246_c1 nmdc:mga0n895_387246_c1_118_912 230
20 3300050510 nmdc:mga06r32_1072968_c1 nmdc:mga06r32_1072968_c1_32_730 232
21 3300049578 Ga0501042_0204565 Ga0501042_0204565_656_1402 233
22 3300013297 Ga0157378_10145548 Ga0157378_101455481 235
23 3300026088 Ga0207641_10342085 Ga0207641_103420851 236
24 3300049576 Ga0501040_0073018 Ga0501040_0073018_487_1281 236
25 3300049578 Ga0501042_0039054 Ga0501042_0039054_2449_3243 236
26 3300049580 Ga0501046_0032443 Ga0501046_0032443_2396_3190 236
27 3300049587 Ga0501071_0035328 Ga0501071_0035328_2288_3082 236
28 3300049590 Ga0501074_0182192 Ga0501074_0182192_138_932 236
29 3300049591 Ga0501075_0152864 Ga0501075_0152864_149_943 236
30 3300049593 Ga0501077_0142283 Ga0501077_0142283_599_1393 236
31 3300049741 Ga0501079_0053523 Ga0501079_0053523_2182_2976 236
32 3300049824 Ga0501045_0041068 Ga0501045_0041068_702_1496 236
33 3300032002 Ga0307416_100025094 Ga0307416_1000250944 240
34 3300009177 Ga0105248_10645942 Ga0105248_106459421 245
35 3300045051 Ga0451576_0157842 Ga0451576_0157842_1571_2308 245
36 3300050507 nmdc:mga05p37_61826_c1 nmdc:mga05p37_61826_c1_3810_4547 245
37 3300050508 nmdc:mga09592_44888_c1 nmdc:mga09592_44888_c1_2144_2881 245
38 3300050509 nmdc:mga0qj67_195959_c1 nmdc:mga0qj67_195959_c1_842_1579 245
39 3300050510 nmdc:mga06r32_939725_c1 nmdc:mga06r32_939725_c1_30_767 245
40 3300061734 Ga0530510_0638740 Ga0530510_0638740_19_756 245
41 3300049589 Ga0501073_0459213 Ga0501073_0459213_126_869 247
42 3300050515 nmdc:mga0a205_126662_c1 nmdc:mga0a205_126662_c1_135_878 247
43 3300027665 Ga0209983_1030429 Ga0209983_10304291 248
44 3300005539 Ga0068853_100070864 Ga0068853_1000708642 249
45 3300009147 Ga0114129_10885016 Ga0114129_108850162 249
46 3300020070 Ga0206356_10779955 Ga0206356_107799552 249
47 3300026041 Ga0207639_10052798 Ga0207639_100527982 249
48 3300049576 Ga0501040_0065808 Ga0501040_0065808_311_1108 249
49 3300049572 Ga0501036_0021976 Ga0501036_0021976_1461_2255 250
50 3300049574 Ga0501038_0016690 Ga0501038_0016690_2972_3766 250
51 3300049575 Ga0501039_0016444 Ga0501039_0016444_3432_4226 250
52 3300049576 Ga0501040_0021123 Ga0501040_0021123_2693_3487 250
53 3300049578 Ga0501042_0006208 Ga0501042_0006208_3709_4503 250
54 3300049582 Ga0501048_0070410 Ga0501048_0070410_855_1649 250
55 3300049587 Ga0501071_0005377 Ga0501071_0005377_613_1407 250
56 3300049588 Ga0501072_0098492 Ga0501072_0098492_1371_2165 250
57 3300049590 Ga0501074_0237048 Ga0501074_0237048_92_886 250
58 3300049591 Ga0501075_0001399 Ga0501075_0001399_7914_8708 250
59 3300049592 Ga0501076_0000399 Ga0501076_0000399_18562_19356 250
60 3300049741 Ga0501079_0014594 Ga0501079_0014594_4184_4978 250
61 3300049742 Ga0501080_0007373 Ga0501080_0007373_4414_5208 250
62 3300049743 Ga0501081_0082576 Ga0501081_0082576_571_1365 250
63 3300054114 Ga0501084_0034470 Ga0501084_0034470_2488_3282 250
64 3300061734 Ga0530510_0000207 Ga0530510_0000207_28118_28912 250
65 3300005444 Ga0070694_100073281 Ga0070694_1000732812 251
66 3300005467 Ga0070706_100595084 Ga0070706_1005950841 252
67 3300025910 Ga0207684_10151664 Ga0207684_101516642 252
68 3300005444 Ga0070694_100188608 Ga0070694_1001886081 255
69 3300005546 Ga0070696_100013743 Ga0070696_1000137435 255
70 3300005843 Ga0068860_100611297 Ga0068860_1006112971 255
71 3300025942 Ga0207689_10120434 Ga0207689_101204341 255
72 3300028381 Ga0268264_10837268 Ga0268264_108372682 255
73 3300035088 Ga0373940_0020798 Ga0373940_0020798_753_1547 255
74 3300035242 Ga0373962_0073670 Ga0373962_0073670_132_926 255
75 3300049584 Ga0501068_0093478 Ga0501068_0093478_59_853 255
76 3300049591 Ga0501075_0165902 Ga0501075_0165902_649_1443 255
77 3300054114 Ga0501084_0111159 Ga0501084_0111159_44_838 255
78 3300049568 Ga0501031_0000852 Ga0501031_0000852_13320_14114 256
79 3300049569 Ga0501032_0087194 Ga0501032_0087194_639_1433 256
80 3300049570 Ga0501033_0015758 Ga0501033_0015758_1494_2288 256
81 3300049572 Ga0501036_0003119 Ga0501036_0003119_9288_10082 256
82 3300049573 Ga0501037_0002813 Ga0501037_0002813_1018_1812 256
83 3300049574 Ga0501038_0000665 Ga0501038_0000665_5308_6102 256
84 3300049575 Ga0501039_0001823 Ga0501039_0001823_9739_10533 256
85 3300049576 Ga0501040_0002463 Ga0501040_0002463_5936_6730 256
86 3300049577 Ga0501041_0003903 Ga0501041_0003903_4063_4857 256
87 3300049578 Ga0501042_0000655 Ga0501042_0000655_7488_8282 256
88 3300049579 Ga0501043_0019688 Ga0501043_0019688_3352_4146 256
89 3300049580 Ga0501046_0010632 Ga0501046_0010632_3124_3918 256
90 3300049582 Ga0501048_0000410 Ga0501048_0000410_25639_26433 256
91 3300049585 Ga0501069_0059427 Ga0501069_0059427_73_867 256
92 3300049586 Ga0501070_0019797 Ga0501070_0019797_4079_4873 256
93 3300049587 Ga0501071_0020070 Ga0501071_0020070_307_1101 256
94 3300049588 Ga0501072_0004197 Ga0501072_0004197_2916_3710 256
95 3300049590 Ga0501074_0009141 Ga0501074_0009141_1534_2328 256
96 3300049591 Ga0501075_0004977 Ga0501075_0004977_5079_5873 256
97 3300049593 Ga0501077_0000213 Ga0501077_0000213_27824_28618 256
98 3300049741 Ga0501079_0000431 Ga0501079_0000431_7253_8047 256
99 3300049742 Ga0501080_0003518 Ga0501080_0003518_12095_12889 256
100 3300049743 Ga0501081_0000190 Ga0501081_0000190_3856_4650 256
101 3300049744 Ga0501083_0005850 Ga0501083_0005850_506_1300 256
102 3300049822 Ga0501035_0019516 Ga0501035_0019516_1477_2271 256
103 3300049824 Ga0501045_0002101 Ga0501045_0002101_7575_8369 256
104 3300054114 Ga0501084_0002090 Ga0501084_0002090_9859_10653 256
105 3300060353 Ga0501082_0002071 Ga0501082_0002071_1438_2232 256
106 3300006846 Ga0075430_100025516 Ga0075430_1000255166 263
107 3300006846 Ga0075430_100033865 Ga0075430_1000338652 263
108 3300006847 Ga0075431_100049328 Ga0075431_1000493284 263
109 3300006880 Ga0075429_100010352 Ga0075429_1000103522 263
110 3300006880 Ga0075429_100012386 Ga0075429_1000123862 263
111 3300027695 Ga0209966_1022606 Ga0209966_10226062 263
112 3300031548 Ga0307408_100027130 Ga0307408_1000271305 263
113 3300031901 Ga0307406_10380384 Ga0307406_103803842 263
114 3300032002 Ga0307416_100270038 Ga0307416_1002700382 263
115 3300049572 Ga0501036_0163092 Ga0501036_0163092_643_1440 263
116 3300049582 Ga0501048_0133398 Ga0501048_0133398_248_1045 263
117 3300049587 Ga0501071_0104285 Ga0501071_0104285_706_1503 263
118 3300049588 Ga0501072_0032398 Ga0501072_0032398_703_1500 263
119 3300049590 Ga0501074_0441650 Ga0501074_0441650_99_896 263
120 3300049591 Ga0501075_0086334 Ga0501075_0086334_234_1031 263
121 3300049592 Ga0501076_0006070 Ga0501076_0006070_1430_2227 263
122 3300049741 Ga0501079_0004049 Ga0501079_0004049_6643_7440 263
123 3300049743 Ga0501081_0011350 Ga0501081_0011350_4167_4964 263
124 3300049824 Ga0501045_0209207 Ga0501045_0209207_89_886 263
125 3300050507 nmdc:mga05p37_127152_c1 nmdc:mga05p37_127152_c1_1842_2633 263
126 3300050508 nmdc:mga09592_3336_c1 nmdc:mga09592_3336_c1_126_917 263
127 3300050509 nmdc:mga0qj67_177121_c1 nmdc:mga0qj67_177121_c1_696_1487 263
128 3300050510 nmdc:mga06r32_4823_c1 nmdc:mga06r32_4823_c1_897_1688 263
129 3300050510 nmdc:mga06r32_65489_c1 nmdc:mga06r32_65489_c1_2606_3403 263
130 3300054114 Ga0501084_0043164 Ga0501084_0043164_1010_1807 263
131 3300060353 Ga0501082_0010052 Ga0501082_0010052_4015_4812 263
132 3300061734 Ga0530510_0153782 Ga0530510_0153782_65_916 263
133 3300005334 Ga0068869_100178475 Ga0068869_1001784752 264
134 3300005336 Ga0070680_100104807 Ga0070680_1001048072 264
135 3300005406 Ga0070703_10016681 Ga0070703_100166812 264
136 3300005434 Ga0070709_10365927 Ga0070709_103659271 264
137 3300005438 Ga0070701_10011313 Ga0070701_100113133 264
138 3300005440 Ga0070705_100017997 Ga0070705_1000179974 264
139 3300005440 Ga0070705_100096026 Ga0070705_1000960262 264
140 3300005441 Ga0070700_100058496 Ga0070700_1000584962 264
141 3300005444 Ga0070694_100000709 Ga0070694_1000007097 264
142 3300005445 Ga0070708_100026704 Ga0070708_1000267043 264
143 3300005445 Ga0070708_100052189 Ga0070708_1000521892 264
144 3300005445 Ga0070708_100198272 Ga0070708_1001982722 264
145 3300005445 Ga0070708_100254965 Ga0070708_1002549652 264
146 3300005445 Ga0070708_100264048 Ga0070708_1002640482 264
147 3300005459 Ga0068867_100062387 Ga0068867_1000623872 264
148 3300005467 Ga0070706_100251899 Ga0070706_1002518992 264
149 3300005468 Ga0070707_100060085 Ga0070707_1000600852 264
150 3300005468 Ga0070707_100213567 Ga0070707_1002135672 264
151 3300005468 Ga0070707_100271627 Ga0070707_1002716272 264
152 3300005468 Ga0070707_100273459 Ga0070707_1002734592 264
153 3300005471 Ga0070698_100216499 Ga0070698_1002164992 264
154 3300005518 Ga0070699_100011444 Ga0070699_1000114442 264
155 3300005518 Ga0070699_100066445 Ga0070699_1000664452 264
156 3300005536 Ga0070697_100011316 Ga0070697_1000113167 264
157 3300005536 Ga0070697_100018482 Ga0070697_1000184827 264
158 3300005536 Ga0070697_100058970 Ga0070697_1000589702 264
159 3300005536 Ga0070697_100210206 Ga0070697_1002102062 264
160 3300005536 Ga0070697_100248899 Ga0070697_1002488992 264
161 3300005545 Ga0070695_100000540 Ga0070695_1000005407 264
162 3300005545 Ga0070695_100003284 Ga0070695_1000032842 264
163 3300005546 Ga0070696_100357845 Ga0070696_1003578452 264
164 3300005549 Ga0070704_100359472 Ga0070704_1003594721 264
165 3300005577 Ga0068857_100006547 Ga0068857_1000065477 264
166 3300005718 Ga0068866_10058493 Ga0068866_100584931 264
167 3300005843 Ga0068860_100188402 Ga0068860_1001884022 264
168 3300005843 Ga0068860_100246240 Ga0068860_1002462402 264
169 3300005844 Ga0068862_100008936 Ga0068862_1000089362 264
170 3300005844 Ga0068862_100306462 Ga0068862_1003064622 264
171 3300005981 Ga0081538_10005367 Ga0081538_100053678 264
172 3300005983 Ga0081540_1021420 Ga0081540_10214203 264
173 3300005985 Ga0081539_10000020 Ga0081539_10000020189 264
174 3300006844 Ga0075428_100000622 Ga0075428_10000062226 264
175 3300006844 Ga0075428_100030836 Ga0075428_1000308368 264
176 3300006844 Ga0075428_100078574 Ga0075428_1000785742 264
177 3300006844 Ga0075428_100168433 Ga0075428_1001684332 264
178 3300006846 Ga0075430_100000084 Ga0075430_10000008444 264
179 3300006846 Ga0075430_100004388 Ga0075430_1000043882 264
180 3300006846 Ga0075430_100012282 Ga0075430_1000122824 264
181 3300006846 Ga0075430_100161591 Ga0075430_1001615912 264
182 3300006846 Ga0075430_100590895 Ga0075430_1005908951 264
183 3300006847 Ga0075431_100000641 Ga0075431_1000006412 264
184 3300006847 Ga0075431_100005985 Ga0075431_1000059852 264
185 3300006847 Ga0075431_100082644 Ga0075431_1000826443 264
186 3300006847 Ga0075431_100089456 Ga0075431_1000894563 264
187 3300006847 Ga0075431_100328437 Ga0075431_1003284372 264
188 3300006852 Ga0075433_10031303 Ga0075433_100313034 264
189 3300006871 Ga0075434_100073082 Ga0075434_1000730825 264
190 3300006871 Ga0075434_100074559 Ga0075434_1000745593 264
191 3300006871 Ga0075434_100101023 Ga0075434_1001010232 264
192 3300006871 Ga0075434_100281345 Ga0075434_1002813452 264
193 3300006871 Ga0075434_100301245 Ga0075434_1003012452 264
194 3300006880 Ga0075429_100000177 Ga0075429_10000017722 264
195 3300006880 Ga0075429_100047000 Ga0075429_1000470002 264
196 3300006914 Ga0075436_100116991 Ga0075436_1001169912 264
197 3300006931 Ga0097620_101027591 Ga0097620_1010275911 264
198 3300007076 Ga0075435_100058980 Ga0075435_1000589803 264
199 3300007076 Ga0075435_100113924 Ga0075435_1001139242 264
200 3300007076 Ga0075435_100198332 Ga0075435_1001983322 264
201 3300007265 Ga0099794_10039204 Ga0099794_100392043 264
202 3300007265 Ga0099794_10114555 Ga0099794_101145552 264
203 3300009094 Ga0111539_10001204 Ga0111539_1000120423 264
204 3300009094 Ga0111539_10220193 Ga0111539_102201931 264
205 3300009147 Ga0114129_10013466 Ga0114129_100134662 264
206 3300009147 Ga0114129_10017502 Ga0114129_1001750210 264
207 3300009147 Ga0114129_10031997 Ga0114129_100319972 264
208 3300009147 Ga0114129_10057438 Ga0114129_100574387 264
209 3300009147 Ga0114129_10058387 Ga0114129_100583874 264
210 3300009147 Ga0114129_10134062 Ga0114129_101340622 264
211 3300009147 Ga0114129_10266189 Ga0114129_102661892 264
212 3300009148 Ga0105243_10025385 Ga0105243_100253852 264
213 3300009174 Ga0105241_10038687 Ga0105241_100386872 264
214 3300009176 Ga0105242_10003823 Ga0105242_100038233 264
215 3300009553 Ga0105249_10137529 Ga0105249_101375291 264
216 3300014326 Ga0157380_10271537 Ga0157380_102715372 264
217 3300025885 Ga0207653_10064239 Ga0207653_100642392 264
218 3300025899 Ga0207642_10357323 Ga0207642_103573231 264
219 3300025906 Ga0207699_10193883 Ga0207699_101938832 264
220 3300025908 Ga0207643_10117544 Ga0207643_101175442 264
221 3300025910 Ga0207684_10037473 Ga0207684_100374732 264
222 3300025910 Ga0207684_10052424 Ga0207684_100524244 264
223 3300025910 Ga0207684_10460801 Ga0207684_104608012 264
224 3300025915 Ga0207693_10095636 Ga0207693_100956362 264
225 3300025915 Ga0207693_10215299 Ga0207693_102152991 264
226 3300025916 Ga0207663_10065520 Ga0207663_100655202 264
227 3300025917 Ga0207660_10016990 Ga0207660_100169903 264
228 3300025922 Ga0207646_10025429 Ga0207646_100254295 264
229 3300025922 Ga0207646_10053971 Ga0207646_100539712 264
230 3300025922 Ga0207646_10139751 Ga0207646_101397511 264
231 3300025922 Ga0207646_10185547 Ga0207646_101855472 264
232 3300025922 Ga0207646_10270717 Ga0207646_102707172 264
233 3300025922 Ga0207646_10739084 Ga0207646_107390841 264
234 3300025933 Ga0207706_10059901 Ga0207706_100599012 264
235 3300025934 Ga0207686_10234966 Ga0207686_102349661 264
236 3300025935 Ga0207709_10006452 Ga0207709_100064525 264
237 3300025939 Ga0207665_10006802 Ga0207665_100068022 264
238 3300025941 Ga0207711_10533039 Ga0207711_105330391 264
239 3300025942 Ga0207689_10016738 Ga0207689_100167386 264
240 3300026035 Ga0207703_10233926 Ga0207703_102339262 264
241 3300026075 Ga0207708_10107981 Ga0207708_101079812 264
242 3300026088 Ga0207641_10406584 Ga0207641_104065842 264
243 3300026116 Ga0207674_10008616 Ga0207674_100086167 264
244 3300027907 Ga0207428_10000029 Ga0207428_1000002922 264
245 3300027907 Ga0207428_10000214 Ga0207428_1000021434 264
246 3300028380 Ga0268265_10721906 Ga0268265_107219062 264
247 3300031911 Ga0307412_10427774 Ga0307412_104277741 264
248 3300032002 Ga0307416_100171819 Ga0307416_1001718192 264
249 3300034816 Ga0373930_0038693 Ga0373930_0038693_143_937 264
250 3300035088 Ga0373940_0034700 Ga0373940_0034700_83_877 264
251 3300035112 Ga0373932_0009495 Ga0373932_0009495_728_1522 264
252 3300035241 Ga0373961_0063049 Ga0373961_0063049_57_851 264
253 3300035242 Ga0373962_0062981 Ga0373962_0062981_236_1036 264
254 3300042003 Ga0439443_024577 Ga0439443_024577_19_813 264
255 3300042876 Ga0451577_0000785 Ga0451577_0000785_24193_24993 264
256 3300044673 Ga0453683_0065028 Ga0453683_0065028_877_1671 264
257 3300045051 Ga0451576_0005524 Ga0451576_0005524_2891_3685 264
258 3300045051 Ga0451576_0037223 Ga0451576_0037223_2037_2831 264
259 3300048905 Ga0496102_0520567 Ga0496102_0520567_39_833 264
260 3300049573 Ga0501037_0400534 Ga0501037_0400534_22_816 264
261 3300049574 Ga0501038_0371471 Ga0501038_0371471_226_1020 264
262 3300049578 Ga0501042_0123669 Ga0501042_0123669_119_916 264
263 3300049578 Ga0501042_0256017 Ga0501042_0256017_390_1184 264
264 3300049578 Ga0501042_0310192 Ga0501042_0310192_41_835 264
265 3300049580 Ga0501046_0248164 Ga0501046_0248164_54_848 264
266 3300049580 Ga0501046_0432918 Ga0501046_0432918_42_848 264
267 3300049583 Ga0501067_0214644 Ga0501067_0214644_169_963 264
268 3300049585 Ga0501069_0100972 Ga0501069_0100972_680_1474 264
269 3300049587 Ga0501071_0144191 Ga0501071_0144191_269_1063 264
270 3300049591 Ga0501075_0103441 Ga0501075_0103441_633_1427 264
271 3300049591 Ga0501075_0344916 Ga0501075_0344916_56_850 264
272 3300049592 Ga0501076_0159511 Ga0501076_0159511_73_867 264
273 3300049592 Ga0501076_0282302 Ga0501076_0282302_324_1118 264
274 3300049741 Ga0501079_0382075 Ga0501079_0382075_215_1009 264
275 3300049743 Ga0501081_0018064 Ga0501081_0018064_3762_4556 264
276 3300049743 Ga0501081_0099701 Ga0501081_0099701_427_1224 264
277 3300049743 Ga0501081_0120385 Ga0501081_0120385_1032_1826 264
278 3300049743 Ga0501081_0172047 Ga0501081_0172047_279_1073 264
279 3300049743 Ga0501081_0458531 Ga0501081_0458531_32_826 264
280 3300049822 Ga0501035_0378956 Ga0501035_0378956_54_848 264
281 3300050507 nmdc:mga05p37_13728_c1 nmdc:mga05p37_13728_c1_6618_7415 264
282 3300050507 nmdc:mga05p37_191828_c1 nmdc:mga05p37_191828_c1_359_1153 264
283 3300050507 nmdc:mga05p37_210074_c1 nmdc:mga05p37_210074_c1_643_1437 264
284 3300050507 nmdc:mga05p37_275575_c1 nmdc:mga05p37_275575_c1_1059_1853 264
285 3300050507 nmdc:mga05p37_29037_c1 nmdc:mga05p37_29037_c1_4390_5184 264
286 3300050507 nmdc:mga05p37_53612_c1 nmdc:mga05p37_53612_c1_1397_2191 264
287 3300050507 nmdc:mga05p37_68123_c1 nmdc:mga05p37_68123_c1_1526_2320 264
288 3300050507 nmdc:mga05p37_72571_c1 nmdc:mga05p37_72571_c1_2284_3081 264
289 3300050508 nmdc:mga09592_26924_c1 nmdc:mga09592_26924_c1_3656_4450 264
290 3300050508 nmdc:mga09592_445_c1 nmdc:mga09592_445_c1_10452_11246 264
291 3300050509 nmdc:mga0qj67_17352_c1 nmdc:mga0qj67_17352_c1_1819_2616 264
292 3300050509 nmdc:mga0qj67_2722_c1 nmdc:mga0qj67_2722_c1_7979_8773 264
293 3300050509 nmdc:mga0qj67_7046_c1 nmdc:mga0qj67_7046_c1_5074_5868 264
294 3300050510 nmdc:mga06r32_2624_c1 nmdc:mga06r32_2624_c1_15027_15821 264
295 3300050510 nmdc:mga06r32_27293_c1 nmdc:mga06r32_27293_c1_2845_3642 264
296 3300050510 nmdc:mga06r32_75797_c1 nmdc:mga06r32_75797_c1_1236_2030 264
297 3300050511 nmdc:mga08y16_40161_c1 nmdc:mga08y16_40161_c1_570_1370 264
298 3300050511 nmdc:mga08y16_4887_c1 nmdc:mga08y16_4887_c1_11751_12551 264
299 3300050511 nmdc:mga08y16_525_c1 nmdc:mga08y16_525_c1_34078_34872 264
300 3300050512 nmdc:mga0n895_11932_c1 nmdc:mga0n895_11932_c1_799_1593 264
301 3300050512 nmdc:mga0n895_121612_c1 nmdc:mga0n895_121612_c1_114_914 264
302 3300050512 nmdc:mga0n895_258110_c1 nmdc:mga0n895_258110_c1_491_1285 264
303 3300050512 nmdc:mga0n895_274485_c1 nmdc:mga0n895_274485_c1_375_1169 264
304 3300050513 nmdc:mga0rr50_170688_c1 nmdc:mga0rr50_170688_c1_243_1043 264
305 3300050513 nmdc:mga0rr50_191084_c1 nmdc:mga0rr50_191084_c1_330_1124 264
306 3300050513 nmdc:mga0rr50_26474_c1 nmdc:mga0rr50_26474_c1_518_1312 264
307 3300050513 nmdc:mga0rr50_54196_c1 nmdc:mga0rr50_54196_c1_1931_2725 264
308 3300050514 nmdc:mga08x19_2075_c1 nmdc:mga08x19_2075_c1_9954_10748 264
309 3300050515 nmdc:mga0a205_112188_c1 nmdc:mga0a205_112188_c1_136_930 264
310 3300050515 nmdc:mga0a205_228047_c1 nmdc:mga0a205_228047_c1_227_1021 264
311 3300050515 nmdc:mga0a205_2359_c1 nmdc:mga0a205_2359_c1_1679_2473 264
312 3300050515 nmdc:mga0a205_2857_c1 nmdc:mga0a205_2857_c1_11594_12394 264
313 3300050515 nmdc:mga0a205_481235_c1 nmdc:mga0a205_481235_c1_134_934 264
314 3300050515 nmdc:mga0a205_638728_c1 nmdc:mga0a205_638728_c1_90_884 264
315 3300060353 Ga0501082_0051158 Ga0501082_0051158_139_933 264
316 3300061734 Ga0530510_0034230 Ga0530510_0034230_181_975 264
317 3300061734 Ga0530510_0385490 Ga0530510_0385490_74_868 264
318 3300005328 Ga0070676_10011846 Ga0070676_100118464 269
319 3300005329 Ga0070683_100022063 Ga0070683_1000220635 269
320 3300005331 Ga0070670_100008416 Ga0070670_1000084164 269
321 3300005334 Ga0068869_100001976 Ga0068869_1000019764 269
322 3300005336 Ga0070680_100005694 Ga0070680_1000056942 269
323 3300005337 Ga0070682_100000189 Ga0070682_10000018910 269
324 3300005339 Ga0070660_100001257 Ga0070660_1000012578 269
325 3300005340 Ga0070689_100014654 Ga0070689_1000146542 269
326 3300005341 Ga0070691_10043405 Ga0070691_100434052 269
327 3300005344 Ga0070661_100001900 Ga0070661_1000019002 269
328 3300005364 Ga0070673_100042049 Ga0070673_1000420492 269
329 3300005365 Ga0070688_100139100 Ga0070688_1001391001 269
330 3300005366 Ga0070659_100003162 Ga0070659_1000031625 269
331 3300005406 Ga0070703_10001030 Ga0070703_100010306 269
332 3300005440 Ga0070705_100001265 Ga0070705_1000012653 269
333 3300005441 Ga0070700_100024917 Ga0070700_1000249173 269
334 3300005444 Ga0070694_100000771 Ga0070694_1000007715 269
335 3300005444 Ga0070694_100004956 Ga0070694_1000049569 269
336 3300005455 Ga0070663_100001979 Ga0070663_1000019796 269
337 3300005458 Ga0070681_10012177 Ga0070681_100121775 269
338 3300005459 Ga0068867_100002214 Ga0068867_1000022147 269
339 3300005530 Ga0070679_100016369 Ga0070679_1000163692 269
340 3300005535 Ga0070684_100005008 Ga0070684_1000050088 269
341 3300005539 Ga0068853_100007406 Ga0068853_1000074065 269
342 3300005545 Ga0070695_100001076 Ga0070695_1000010762 269
343 3300005546 Ga0070696_100009359 Ga0070696_1000093595 269
344 3300005547 Ga0070693_100001198 Ga0070693_1000011982 269
345 3300005549 Ga0070704_100003421 Ga0070704_1000034216 269
346 3300005563 Ga0068855_100000315 Ga0068855_1000003158 269
347 3300005564 Ga0070664_100001078 Ga0070664_10000107813 269
348 3300005577 Ga0068857_100019705 Ga0068857_1000197054 269
349 3300005578 Ga0068854_100001899 Ga0068854_10000189912 269
350 3300005614 Ga0068856_100001193 Ga0068856_10000119322 269
351 3300005617 Ga0068859_100007963 Ga0068859_1000079639 269
352 3300005618 Ga0068864_100225335 Ga0068864_1002253352 269
353 3300005719 Ga0068861_100005299 Ga0068861_1000052996 269
354 3300005840 Ga0068870_10001408 Ga0068870_100014084 269
355 3300005843 Ga0068860_100374028 Ga0068860_1003740281 269
356 3300005844 Ga0068862_100005205 Ga0068862_1000052055 269
357 3300005937 Ga0081455_10007944 Ga0081455_100079444 269
358 3300006852 Ga0075433_10040131 Ga0075433_100401314 269
359 3300006931 Ga0097620_100007963 Ga0097620_1000079639 269
360 3300013100 Ga0157373_10000317 Ga0157373_1000031726 269
361 3300013105 Ga0157369_10007617 Ga0157369_100076174 269
362 3300014325 Ga0163163_10046753 Ga0163163_100467534 269
363 3300025885 Ga0207653_10000733 Ga0207653_1000073311 269
364 3300025901 Ga0207688_10006383 Ga0207688_100063836 269
365 3300025907 Ga0207645_10000442 Ga0207645_100004426 269
366 3300025908 Ga0207643_10000411 Ga0207643_1000041112 269
367 3300025911 Ga0207654_10021062 Ga0207654_100210622 269
368 3300025912 Ga0207707_10002845 Ga0207707_100028459 269
369 3300025917 Ga0207660_10001698 Ga0207660_100016983 269
370 3300025919 Ga0207657_10000095 Ga0207657_1000009512 269
371 3300025920 Ga0207649_10001570 Ga0207649_100015706 269
372 3300025921 Ga0207652_10001545 Ga0207652_1000154516 269
373 3300025923 Ga0207681_10019266 Ga0207681_100192662 269
374 3300025925 Ga0207650_10050705 Ga0207650_100507053 269
375 3300025932 Ga0207690_10002172 Ga0207690_100021724 269
376 3300025933 Ga0207706_10000780 Ga0207706_1000078021 269
377 3300025941 Ga0207711_10100524 Ga0207711_101005242 269
378 3300025942 Ga0207689_10000121 Ga0207689_1000012150 269
379 3300025945 Ga0207679_10000385 Ga0207679_100003859 269
380 3300025949 Ga0207667_10002155 Ga0207667_1000215514 269
381 3300025960 Ga0207651_10033002 Ga0207651_100330022 269
382 3300025981 Ga0207640_10097403 Ga0207640_100974032 269
383 3300026023 Ga0207677_10026020 Ga0207677_100260204 269
384 3300026035 Ga0207703_10039894 Ga0207703_100398943 269
385 3300026041 Ga0207639_10015306 Ga0207639_100153065 269
386 3300026067 Ga0207678_10004871 Ga0207678_100048715 269
387 3300026078 Ga0207702_10007037 Ga0207702_100070372 269
388 3300026089 Ga0207648_10000997 Ga0207648_1000099714 269
389 3300026095 Ga0207676_10478050 Ga0207676_104780502 269
390 3300026116 Ga0207674_10000307 Ga0207674_1000030748 269
391 3300026118 Ga0207675_100050316 Ga0207675_1000503164 269
392 3300027360 Ga0209969_1001525 Ga0209969_10015251 269
393 3300027462 Ga0210000_1006177 Ga0210000_10061771 269
394 3300027543 Ga0209999_1007526 Ga0209999_10075262 269
395 3300027614 Ga0209970_1006595 Ga0209970_10065951 269
396 3300027665 Ga0209983_1001579 Ga0209983_10015792 269
397 3300027682 Ga0209971_1000003 Ga0209971_10000032 269
398 3300027695 Ga0209966_1000045 Ga0209966_100004553 269
399 3300027717 Ga0209998_10000124 Ga0209998_1000012427 269
400 3300028380 Ga0268265_10004050 Ga0268265_100040506 269
401 3300035088 Ga0373940_0030433 Ga0373940_0030433_250_1065 269
402 3300035091 Ga0373951_0005865 Ga0373951_0005865_170_985 269
403 3300035241 Ga0373961_0009084 Ga0373961_0009084_231_1046 269
404 3300042005 Ga0439448_0000097 Ga0439448_0000097_2362_3177 269
405 3300042461 Ga0439460_0000569 Ga0439460_0000569_2166_2975 269
406 3300042876 Ga0451577_0082240 Ga0451577_0082240_157_972 269
407 3300042876 Ga0451577_0315165 Ga0451577_0315165_250_1059 269
408 3300044712 Ga0453684_0145427 Ga0453684_0145427_1724_2533 269
409 3300044712 Ga0453684_0327154 Ga0453684_0327154_326_1141 269
410 3300045051 Ga0451576_0056093 Ga0451576_0056093_2318_3133 269
411 3300048905 Ga0496102_0140395 Ga0496102_0140395_80_895 269
412 3300048913 Ga0496110_0048534 Ga0496110_0048534_21_836 269
413 3300049575 Ga0501039_0016108 Ga0501039_0016108_2223_3032 269
414 3300049576 Ga0501040_0003245 Ga0501040_0003245_7634_8443 269
415 3300049577 Ga0501041_0001618 Ga0501041_0001618_2309_3118 269
416 3300049578 Ga0501042_0000025 Ga0501042_0000025_29506_30315 269
417 3300049580 Ga0501046_0013046 Ga0501046_0013046_5198_6007 269
418 3300049582 Ga0501048_0020849 Ga0501048_0020849_2597_3406 269
419 3300049587 Ga0501071_0122560 Ga0501071_0122560_956_1765 269
420 3300049587 Ga0501071_0279066 Ga0501071_0279066_164_973 269
421 3300049588 Ga0501072_0025419 Ga0501072_0025419_1263_2072 269
422 3300049588 Ga0501072_0052490 Ga0501072_0052490_937_1746 269
423 3300049589 Ga0501073_0056624 Ga0501073_0056624_1040_1849 269
424 3300049590 Ga0501074_0001414 Ga0501074_0001414_6882_7691 269
425 3300049593 Ga0501077_0097482 Ga0501077_0097482_876_1685 269
426 3300049743 Ga0501081_0008464 Ga0501081_0008464_2541_3350 269
427 3300049744 Ga0501083_0017859 Ga0501083_0017859_1897_2706 269
428 3300049822 Ga0501035_0120137 Ga0501035_0120137_942_1751 269
429 3300049824 Ga0501045_0000034 Ga0501045_0000034_28504_29313 269
430 3300050515 nmdc:mga0a205_427724_c1 nmdc:mga0a205_427724_c1_14_829 269
431 3300054114 Ga0501084_0002977 Ga0501084_0002977_9461_10270 269
432 3300060353 Ga0501082_0000814 Ga0501082_0000814_23797_24606 269
433 3300061734 Ga0530510_0367099 Ga0530510_0367099_155_970 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

201

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

7

248

0.93

PF08659

KR

KR domain

2

184

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ewm-assembly1.cif.gz_A-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9426 3 251
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9376 2 248
3edm-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.936 3 248
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9352 3 251
2ew8-assembly1.cif.gz_D crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9347 3 251
ID Description Score Start End Superfamily
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9334 3 248 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9329 2 253 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9326 3 251 3.40.50.720
af_Q9T0G0_32_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9309 3 198 3.40.50.720
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9287 3 252 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A508X615-F1-model_v4 Meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase 0.9556 65 192 GO:0016616
AF-A0A814DJR1-F1-model_v4 Uncharacterized protein 0.9426 76 174 GO:0016491
AF-A0A6S7GHD8-F1-model_v4 Dehydrogenase reductase SDR family member 7-like 0.937 68 195 GO:0016491
AF-C2FAE8-F1-model_v4 deleted 0.9355 50 251
AF-A0A4R2XGW5-F1-model_v4 deleted 0.9352 3 251

Feature Viewer

pLDDT pTM Quality
88.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map