metagRoot

F442970

General Info

Members	Datasets	Scaffolds	Average Seq Length
433	320	312	638

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2508501114\|2509077076
Length	666
Sequence	ITPNELDAVPEISRLATGERGGLPGVQSQADEPISPDELRDDQVDGPELTARLAKTWGTDKGIIGALSTVDHKVIGRRFIATAILFLFLGGLSAILMRMQLALPENRLMGPDFYNQLFTMHGTTMMFLFGVPIGEAFAVYLVPLMVGTRNIAFPRLNAYAYYVYVFGGLLIWVAFVLNIGPDVGWFAYVPLSGPEYSPGKRADFWAQMITFTEVSGIAVAISVIVTVFKFRAPGMTLDRIPLFVWAELINSFVIIFALPAVVTASATLMMDRLVGTHFFNPAEGGDALLYQHLFWFFGHPEVYIIFLPATGWVSAIVVTFSRRQAFGYIALVLSLIATGFLSFGLWVHHMFTTGLPQLGASFFTASSMLIAIPNGIQIFCWIATLWDGRPVFRTPLLFIVGFFFIFVAGGLSGIMLASVPLDTQVHDTFFVVAHFHYVLIGGNVFPLIGAVYYWFPKFTGRMMSERLGKWHFWLAFIGFNATFFPMHILGLMGMPRRVYTYLPEMGWGSLNLFTSLGAALFFASFVLFLYNIVSSARRGAVAGPNPWNAGTLEWASASPPRPQNFDRIPVVTNREPLWAHRDDLPVVAGLSVENREQLVTTVTDARADLRETTPEPSIWPFIAAIATAILFIGSMFTPWALVWGSVPLALALMGWFWPKPSTEDER

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
3	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
4	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
5	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
6	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
7	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
8	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
9	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
10	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
11	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
12	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
13	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
14	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
15	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
16	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
17	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
18	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
19	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
20	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
21	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
22	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
23	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
24	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
25	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
26	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
27	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
28	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
29	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
30	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
31	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
32	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
33	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
34	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
35	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
36	2884298095	Microvirga thermotolerans HR1	Isolate	Rhizosphere
37	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
38	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
39	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
40	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
41	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
42	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
43	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
44	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
45	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
46	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
47	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
48	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
49	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
50	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
51	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
52	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
53	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
54	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
55	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
56	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
57	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
58	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
59	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
60	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
61	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
62	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
63	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
64	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
65	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
66	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
67	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
68	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
69	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
70	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
71	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
72	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
73	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
74	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
75	2953994433	Luteibacter sp. W1I16	Isolate	Rhizosphere
76	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
77	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
78	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
79	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
80	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
81	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
82	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
83	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
84	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
85	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
86	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
87	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
88	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
89	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
90	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
91	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
92	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
93	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
94	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
95	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
96	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
97	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
98	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
99	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
100	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
101	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
102	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
103	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
104	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
105	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
106	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
107	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
108	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
109	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
110	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
111	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
112	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
113	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
114	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
115	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
116	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
117	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
118	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
119	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
120	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
121	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
122	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
123	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
124	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
125	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
126	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
127	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
128	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
129	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
130	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
131	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
132	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
133	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
134	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
135	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
136	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
137	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
138	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
139	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
140	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
141	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
142	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
143	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
144	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
145	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
146	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
147	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
148	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
149	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
150	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
151	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
152	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
153	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
154	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
155	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
156	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
157	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
158	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
159	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
160	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
161	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
162	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
163	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
164	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
165	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
166	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
167	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
168	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
169	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
170	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
171	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
172	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
173	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
174	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
175	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
176	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
220	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
221	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
222	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
223	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
224	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
225	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
226	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
227	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
228	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
229	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
230	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
231	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
232	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
233	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
234	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
235	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
236	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
237	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
238	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
239	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
240	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
241	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
242	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
243	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
244	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
245	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
246	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
247	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
248	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
249	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
250	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
251	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
252	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
253	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
254	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
255	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
256	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
257	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
258	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
259	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
260	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
261	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
262	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
263	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
264	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
265	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
266	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
267	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
268	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
269	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
270	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
271	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
272	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
273	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
274	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
275	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
276	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
277	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
278	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
279	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
280	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
281	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
282	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
283	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
284	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
285	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
286	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
287	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
288	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
289	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
290	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
291	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
292	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
293	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
294	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
295	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
296	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
297	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
298	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
299	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
300	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
301	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
302	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
303	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
304	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
305	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
306	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
307	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
308	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
309	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
310	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
311	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
312	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
313	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
314	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
315	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
316	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
317	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
318	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
319	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
320	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	71.13
Metatranscriptomes	0.92
Isolates	27.94

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.08
Nodule	26.56
Rhizoplane	1.85
Rhizosphere	63.05
Stem	0
Stem Tuber	0
Unclassified	3.46

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24752J21851_1000187	3300001976	Bacteria	8596
2	JGI24748J21848_1000033	3300002074	Bacteria	78443
3	JGI24034J26672_10000032	3300002239	Bacteria	89175
4	JGI25406J46586_10000566	3300003203	Bacteria	17440
5	JGI25406J46586_10000579	3300003203	Bacteria	17283
6	Ga0007417J51691_1016079	3300003544	Bacteria	5785
7	Ga0007409J51694_1030209	3300003575	Bacteria	5915
8	Ga0007416J51690_1017177	3300003577	Bacteria	5968
9	Ga0032354_1007186	3300003693	Bacteria	5128
10	Ga0055536_1000023	3300003781	Bacteria	191663
11	Ga0055531_10000185	3300003794	Bacteria	69495
12	Ga0055531_10000323	3300003794	Bacteria	47101
13	Ga0070658_10099894	3300005327	Bacteria	2398
14	Ga0070676_10003976	3300005328	Bacteria	7754
15	Ga0070676_10014958	3300005328	Bacteria	4272
16	Ga0070690_100000011	3300005330	Bacteria	95472
17	Ga0070670_100032042	3300005331	Bacteria	4526
18	Ga0070666_10000035	3300005335	Bacteria	121458
19	Ga0070666_10001791	3300005335	Bacteria	13087
20	Ga0070666_10020478	3300005335	Bacteria	4275
21	Ga0070682_100051308	3300005337	Bacteria	2578
22	Ga0070660_100000421	3300005339	Bacteria	28145
23	Ga0070660_100004900	3300005339	Bacteria	9256
24	Ga0070661_100005130	3300005344	Bacteria	9023
25	Ga0070661_100010340	3300005344	Bacteria	6487
26	Ga0070661_100010715	3300005344	Bacteria	6379
27	Ga0070669_100000131	3300005353	Bacteria	68114
28	Ga0070669_100033190	3300005353	Bacteria	3732
29	Ga0070675_100004404	3300005354	Bacteria	10741
30	Ga0070675_100042467	3300005354	Bacteria	3715
31	Ga0070671_100002646	3300005355	Bacteria	13862
32	Ga0070671_100015960	3300005355	Bacteria	6068
33	Ga0070671_100049833	3300005355	Bacteria	3484
34	Ga0070671_100078398	3300005355	Bacteria	2761
35	Ga0070673_100021496	3300005364	Bacteria	4679
36	Ga0070673_100030511	3300005364	Bacteria	4036
37	Ga0070688_100001296	3300005365	Bacteria	12456
38	Ga0070688_100011135	3300005365	Bacteria	4993
39	Ga0070659_100001630	3300005366	Bacteria	16151
40	Ga0070667_100019380	3300005367	Bacteria	5644
41	Ga0070714_100006621	3300005435	Bacteria	8963
42	Ga0070662_100003404	3300005457	Bacteria	9917
43	Ga0070662_100011689	3300005457	Bacteria	5793
44	Ga0070681_10015772	3300005458	Bacteria	7530
45	Ga0070681_10027702	3300005458	Bacteria	5696
46	Ga0068867_100007014	3300005459	Bacteria	7962
47	Ga0068853_100002714	3300005539	Bacteria	13357
48	Ga0070672_100015829	3300005543	Bacteria	5384
49	Ga0070672_100021731	3300005543	Bacteria	4699
50	Ga0070672_100031996	3300005543	Bacteria	3966
51	Ga0070672_100059132	3300005543	Bacteria	3015
52	Ga0070686_100000035	3300005544	Bacteria	108191
53	Ga0070686_100004462	3300005544	Bacteria	7719
54	Ga0070695_100064009	3300005545	Bacteria	2391
55	Ga0070665_100000161	3300005548	Bacteria	122088
56	Ga0070665_100010894	3300005548	Bacteria	9198
57	Ga0070665_100014628	3300005548	Bacteria	7874
58	Ga0070704_100061015	3300005549	Bacteria	2697
59	Ga0068855_100001230	3300005563	Bacteria	31780
60	Ga0068855_100010395	3300005563	Bacteria	11225
61	Ga0068855_100062313	3300005563	Bacteria	4354
62	Ga0070664_100001727	3300005564	Bacteria	17490
63	Ga0070664_100004572	3300005564	Bacteria	11106
64	Ga0070664_100013514	3300005564	Bacteria	6652
65	Ga0070664_100023597	3300005564	Bacteria	5081
66	Ga0068857_100000674	3300005577	Bacteria	25328
67	Ga0068857_100004887	3300005577	Bacteria	11367
68	Ga0068854_100001471	3300005578	Bacteria	14274
69	Ga0068854_100041937	3300005578	Bacteria	3236
70	Ga0068856_100000267	3300005614	Bacteria	56822
71	Ga0068856_100017285	3300005614	Bacteria	6991
72	Ga0068856_100081849	3300005614	Bacteria	3204
73	Ga0070702_100062803	3300005615	Bacteria	2167
74	Ga0068852_100059313	3300005616	Bacteria	3318
75	Ga0068864_100014687	3300005618	Bacteria	6505
76	Ga0068864_100026915	3300005618	Bacteria	4851
77	Ga0068851_10010060	3300005834	Bacteria	4406
78	Ga0068863_100000060	3300005841	Bacteria	122123
79	Ga0068863_100003179	3300005841	Bacteria	16242
80	Ga0068863_100119871	3300005841	Bacteria	2508
81	Ga0068858_100002514	3300005842	Bacteria	18483
82	Ga0068860_100000126	3300005843	Bacteria	122923
83	Ga0068862_100000146	3300005844	Bacteria	80138
84	Ga0081538_10023186	3300005981	Bacteria	4469
85	Ga0081539_10000084	3300005985	Bacteria	218801
86	Ga0081539_10000795	3300005985	Bacteria	61261
87	Ga0081539_10013431	3300005985	Bacteria	6170
88	Ga0081539_10028701	3300005985	Bacteria	3494
89	Ga0075370_10002253	3300006353	Bacteria	8881
90	Ga0068871_100022201	3300006358	Bacteria	4893
91	Ga0068871_100026432	3300006358	Bacteria	4529
92	Ga0075428_100001838	3300006844	Bacteria	22743
93	Ga0075431_100039197	3300006847	Bacteria	4881
94	Ga0075433_10122961	3300006852	Bacteria	2305
95	Ga0075434_100013667	3300006871	Bacteria	7738
96	Ga0075434_100059457	3300006871	Bacteria	3799
97	Ga0075435_100002443	3300007076	Bacteria	12335
98	Ga0105240_10013633	3300009093	Bacteria	11146
99	Ga0105240_10020695	3300009093	Bacteria	8766
100	Ga0105240_10027658	3300009093	Bacteria	7422
101	Ga0111539_10032684	3300009094	Bacteria	6318
102	Ga0114129_10010974	3300009147	Bacteria	12907
103	Ga0114129_10123931	3300009147	Bacteria	3554
104	Ga0105241_10065603	3300009174	Bacteria	2805
105	Ga0105248_10007087	3300009177	Bacteria	12278
106	Ga0105248_10019571	3300009177	Bacteria	7491
107	Ga0105237_10025089	3300009545	Bacteria	6098
108	Ga0105237_10111785	3300009545	Bacteria	2724
109	Ga0105238_10001551	3300009551	Bacteria	23064
110	Ga0105238_10014845	3300009551	Bacteria	7881
111	Ga0105249_10000094	3300009553	Bacteria	122611
112	Ga0105239_10170972	3300010375	Bacteria	2430
113	Ga0157373_10001380	3300013100	Bacteria	18627
114	Ga0157373_10011519	3300013100	Bacteria	6498
115	Ga0157373_10015303	3300013100	Bacteria	5608
116	Ga0157371_10003105	3300013102	Bacteria	15379
117	Ga0157371_10059849	3300013102	Bacteria	2700
118	Ga0157369_10022766	3300013105	Bacteria	6986
119	Ga0157378_10038378	3300013297	Bacteria	4245
120	Ga0163162_10074821	3300013306	Bacteria	3446
121	Ga0157372_10000613	3300013307	Bacteria	38963
122	Ga0157375_10012607	3300013308	Bacteria	7501
123	Ga0157375_10015915	3300013308	Bacteria	6743
124	Ga0163163_10025283	3300014325	Bacteria	5661
125	Ga0157376_10030718	3300014969	Bacteria	4294
126	Ga0182006_1009523	3300015261	Bacteria	4350
127	Ga0163161_10000195	3300017792	Bacteria	55605
128	Ga0213876_10003742	3300021384	Bacteria	8626
129	Ga0213871_10000504	3300021441	Bacteria	5364
130	Ga0228710_1003087	3300022740	Bacteria	26521
131	Ga0209673_1008321	3300025273	Bacteria	4627
132	Ga0209676_1000072	3300025292	Bacteria	307347
133	Ga0209676_1000964	3300025292	Bacteria	34819
134	Ga0209676_1001440	3300025292	Bacteria	22418
135	Ga0209025_1001094	3300025294	Bacteria	39112
136	Ga0209050_1000077	3300025298	Bacteria	278985
137	Ga0209051_1000025	3300025303	Bacteria	415397
138	Ga0209257_1000039	3300025304	Bacteria	591694
139	Ga0209257_1000088	3300025304	Bacteria	279014
140	Ga0209257_1000971	3300025304	Bacteria	39170
141	Ga0207697_10027243	3300025315	Bacteria	2337
142	Ga0207682_10002171	3300025893	Bacteria	8870
143	Ga0207680_10000007	3300025903	Bacteria	623574
144	Ga0207680_10011882	3300025903	Bacteria	4418
145	Ga0207645_10018752	3300025907	Bacteria	4545
146	Ga0207643_10002273	3300025908	Bacteria	10462
147	Ga0207654_10021920	3300025911	Bacteria	3403
148	Ga0207695_10058257	3300025913	Bacteria	4010
149	Ga0207671_10039706	3300025914	Bacteria	3485
150	Ga0207657_10002546	3300025919	Bacteria	19710
151	Ga0207657_10004698	3300025919	Bacteria	14419
152	Ga0207657_10013540	3300025919	Bacteria	8000
153	Ga0207649_10002319	3300025920	Bacteria	10689
154	Ga0207649_10017866	3300025920	Bacteria	4023
155	Ga0207681_10000053	3300025923	Bacteria	110626
156	Ga0207681_10069744	3300025923	Bacteria	2446
157	Ga0207694_10003151	3300025924	Bacteria	13180
158	Ga0207694_10018655	3300025924	Bacteria	5245
159	Ga0207694_10027187	3300025924	Bacteria	4356
160	Ga0207650_10023334	3300025925	Bacteria	4385
161	Ga0207650_10054652	3300025925	Bacteria	2963
162	Ga0207659_10015482	3300025926	Bacteria	4943
163	Ga0207644_10014707	3300025931	Bacteria	5244
164	Ga0207644_10015340	3300025931	Bacteria	5140
165	Ga0207644_10032706	3300025931	Bacteria	3631
166	Ga0207644_10072115	3300025931	Bacteria	2528
167	Ga0207690_10002724	3300025932	Bacteria	10670
168	Ga0207690_10036899	3300025932	Bacteria	3169
169	Ga0207706_10005883	3300025933	Bacteria	11408
170	Ga0207706_10013171	3300025933	Bacteria	7526
171	Ga0207706_10014915	3300025933	Bacteria	7037
172	Ga0207706_10026835	3300025933	Bacteria	5156
173	Ga0207706_10072625	3300025933	Bacteria	3026
174	Ga0207691_10021445	3300025940	Bacteria	6099
175	Ga0207691_10024163	3300025940	Bacteria	5715
176	Ga0207691_10028061	3300025940	Bacteria	5273
177	Ga0207691_10028480	3300025940	Bacteria	5231
178	Ga0207691_10033572	3300025940	Bacteria	4778
179	Ga0207691_10074053	3300025940	Bacteria	3071
180	Ga0207691_10077806	3300025940	Bacteria	2987
181	Ga0207691_10137160	3300025940	Bacteria	2157
182	Ga0207661_10034862	3300025944	Bacteria	3917
183	Ga0207679_10001259	3300025945	Bacteria	16064
184	Ga0207679_10009399	3300025945	Bacteria	6263
185	Ga0207679_10044592	3300025945	Bacteria	3200
186	Ga0207667_10002232	3300025949	Bacteria	24328
187	Ga0207667_10009092	3300025949	Bacteria	11745
188	Ga0207651_10000945	3300025960	Bacteria	12799
189	Ga0207651_10005646	3300025960	Bacteria	6449
190	Ga0207651_10038915	3300025960	Bacteria	3130
191	Ga0207712_10000004	3300025961	Bacteria	614655
192	Ga0207658_10001427	3300025986	Bacteria	18634
193	Ga0207658_10009501	3300025986	Bacteria	6601
194	Ga0207703_10002077	3300026035	Bacteria	17605
195	Ga0207639_10003176	3300026041	Bacteria	11042
196	Ga0207639_10041916	3300026041	Bacteria	3429
197	Ga0207702_10005201	3300026078	Bacteria	11430
198	Ga0207702_10040503	3300026078	Bacteria	3905
199	Ga0207641_10000100	3300026088	Bacteria	122664
200	Ga0207641_10005334	3300026088	Bacteria	10981
201	Ga0207641_10095569	3300026088	Bacteria	2609
202	Ga0207648_10041506	3300026089	Bacteria	4039
203	Ga0207676_10004838	3300026095	Bacteria	9546
204	Ga0207676_10054605	3300026095	Bacteria	3132
205	Ga0207674_10000014	3300026116	Bacteria	183605
206	Ga0207674_10011744	3300026116	Bacteria	9827
207	Ga0207674_10027668	3300026116	Bacteria	5993
208	Ga0207675_100125929	3300026118	Bacteria	2426
209	Ga0207683_10003342	3300026121	Bacteria	13982
210	Ga0207683_10008194	3300026121	Bacteria	8940
211	Ga0207683_10099982	3300026121	Bacteria	2589
212	Ga0209974_10001510	3300027876	Bacteria	8451
213	Ga0209974_10009460	3300027876	Bacteria	3308
214	Ga0268266_10000040	3300028379	Bacteria	323843
215	Ga0268266_10002529	3300028379	Bacteria	19452
216	Ga0268265_10000128	3300028380	Bacteria	96118
217	Ga0268264_10000003	3300028381	Bacteria	1141976
218	Ga0265338_10013648	3300028800	Bacteria	9148
219	Ga0307405_10007369	3300031731	Bacteria	5495
220	Ga0307410_10013196	3300031852	Bacteria	4810
221	Ga0307406_10017996	3300031901	Bacteria	4122
222	Ga0307406_10022146	3300031901	Bacteria	3768
223	Ga0307407_10005393	3300031903	Bacteria	5544
224	Ga0307412_10068882	3300031911	Bacteria	2407
225	Ga0315914_1000060	3300031967	Bacteria	84937
226	Ga0307409_100002919	3300031995	Bacteria	9082
227	Ga0307409_100043350	3300031995	Bacteria	3377
228	Ga0307416_100016118	3300032002	Bacteria	5182
229	Ga0307416_100024610	3300032002	Bacteria	4399
230	Ga0307416_100031878	3300032002	Bacteria	3974
231	Ga0307416_100035284	3300032002	Bacteria	3818
232	Ga0307414_10029890	3300032004	Bacteria	3552
233	Ga0307414_10048235	3300032004	Bacteria	2937
234	Ga0307411_10082038	3300032005	Bacteria	2222
235	Ga0307415_100048748	3300032126	Bacteria	2860
236	Ga0315913_1000025	3300033430	Bacteria	84490
237	Ga0315915_1000036	3300033464	Bacteria	84883
238	Ga0395900_0000394	3300037418	Bacteria	63170
239	Ga0395898_0016040	3300037466	Bacteria	7673
240	Ga0395905_0036636	3300037471	Bacteria	4608
241	Ga0395905_0090181	3300037471	Bacteria	2874
242	Ga0436364_1056701	3300037853	Bacteria	6191
243	Ga0395901_0015140	3300038443	Bacteria	7842
244	Ga0395901_0017233	3300038443	Bacteria	7372
245	Ga0436365_0409866	3300039437	Bacteria	83836
246	Ga0436365_0545430	3300039437	Bacteria	32751
247	Ga0436360_1030100	3300039438	Bacteria	5609
248	Ga0436363_1675970	3300039450	Bacteria	4479
249	Ga0436362_1077409	3300039453	Bacteria	8862
250	Ga0439465_0003005	3300041413	Bacteria	5512
251	Ga0466969_0018451	3300044656	Bacteria	3633
252	Ga0466972_0024597	3300044658	Bacteria	2988
253	Ga0466982_0000117	3300044672	Bacteria	19697
254	Ga0466966_0003434	3300044684	Bacteria	10450
255	Ga0466966_0014504	3300044684	Bacteria	5215
256	Ga0466961_0000009	3300044693	Bacteria	139001
257	Ga0466964_0008133	3300044706	Bacteria	3936
258	Ga0466971_0035397	3300044719	Bacteria	2238
259	Ga0466970_0000650	3300044765	Bacteria	17096
260	Ga0466970_0007731	3300044765	Bacteria	5393
261	Ga0466959_0030157	3300045049	Bacteria	4016
262	Ga0466967_0057324	3300045976	Bacteria	3438
263	Ga0495606_0012819	3300046507	Bacteria	6679
264	Ga0495643_0020119	3300046522	Bacteria	3855
265	Ga0495648_0027697	3300046524	Bacteria	3789
266	Ga0495621_0002666	3300046539	Bacteria	4828
267	Ga0495668_0002569	3300046616	Bacteria	14745
268	Ga0495668_0028409	3300046616	Bacteria	3163
269	Ga0495625_0001340	3300046660	Bacteria	30487
270	Ga0495625_0025838	3300046660	Bacteria	4445
271	Ga0495659_0002802	3300046664	Bacteria	5602
272	Ga0495659_0010475	3300046664	Bacteria	2974
273	Ga0495661_0032316	3300046665	Bacteria	3309
274	Ga0495671_0048173	3300046692	Bacteria	2127
275	Ga0495649_0016907	3300046694	Bacteria	4128
276	Ga0495683_0019359	3300047323	Bacteria	3514
277	Ga0496102_0008305	3300048905	Bacteria	8893
278	Ga0496103_0002395	3300048906	Bacteria	11807
279	Ga0496103_0026632	3300048906	Bacteria	3500
280	Ga0496106_0001690	3300048909	Bacteria	16497
281	Ga0496107_0011593	3300048910	Bacteria	6144
282	Ga0496108_0101557	3300048911	Bacteria	2454
283	Ga0496109_0167797	3300048912	Bacteria	2059
284	Ga0496112_0094367	3300048915	Bacteria	2962
285	Ga0496117_0010660	3300048920	Bacteria	8331
286	Ga0496118_0014990	3300048921	Bacteria	7210
287	Ga0501038_0099905	3300049574	Bacteria	2418
288	Ga0501041_0016451	3300049577	Bacteria	4397
289	Ga0501042_0006017	3300049578	Bacteria	7856
290	Ga0501048_0049025	3300049582	Bacteria	3011
291	Ga0501071_0011587	3300049587	Bacteria	5950
292	Ga0501074_0138447	3300049590	Bacteria	1741
293	Ga0501075_0013151	3300049591	Bacteria	5900
294	Ga0501076_0017534	3300049592	Bacteria	5443
295	Ga0501035_0072575	3300049822	Bacteria	3046
296	nmdc:mga0yw44_3682_c1	3300050492	Bacteria	6857
297	nmdc:mga07m45_6300_c1	3300050496	Bacteria	5992
298	nmdc:mga05p37_4886_c1	3300050507	Bacteria	15686
299	nmdc:mga0qj67_34460_c1	3300050509	Bacteria	3954
300	nmdc:mga06r32_39098_c1	3300050510	Bacteria	4500
301	nmdc:mga08y16_35959_c1	3300050511	Bacteria	5201
302	nmdc:mga0rr50_36518_c1	3300050513	Bacteria	3539
303	Ga0500583_0003644	3300053092	Bacteria	4888
304	Ga0500583_0005412	3300053092	Bacteria	4277
305	Ga0500556_0000792	3300053104	Bacteria	18540
306	Ga0500616_0000016	3300053153	Bacteria	627087
307	Ga0500622_0001863	3300053156	Bacteria	15960
308	Ga0500622_0003368	3300053156	Bacteria	10755
309	Ga0590071_000126	3300059421	Bacteria	21337
310	Ga0590075_001183	3300059424	Bacteria	6605
311	Ga0466962_0017534	3300061719	Bacteria	3446
312	Ga0530510_0055041	3300061734	Bacteria	2874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005459	Ga0068867_100007014	Ga0068867_1000070145	523
2	3300046692	Ga0495671_0048173	Ga0495671_0048173_29_1672	547
3	3300006844	Ga0075428_100001838	Ga0075428_10000183818	563
4	3300006852	Ga0075433_10122961	Ga0075433_101229612	563
5	3300009147	Ga0114129_10010974	Ga0114129_100109746	563
6	3300050507	nmdc:mga05p37_4886_c1	nmdc:mga05p37_4886_c1_9535_11487	563
7	3300049590	Ga0501074_0138447	Ga0501074_0138447_13_1731	570
8	3300046664	Ga0495659_0002802	Ga0495659_0002802_539_2491	584
9	3300044656	Ga0466969_0018451	Ga0466969_0018451_1538_3409	602
10	3300044684	Ga0466966_0003434	Ga0466966_0003434_229_2100	602
11	3300044706	Ga0466964_0008133	Ga0466964_0008133_1742_3613	602
12	3300044719	Ga0466971_0035397	Ga0466971_0035397_279_2150	602
13	3300044765	Ga0466970_0007731	Ga0466970_0007731_1409_3280	602
14	3300045049	Ga0466959_0030157	Ga0466959_0030157_1538_3409	602
15	3300061719	Ga0466962_0017534	Ga0466962_0017534_1357_3228	602
16	3300059421	Ga0590071_000126	Ga0590071_000126_15986_17893	604
17	3300059424	Ga0590075_001183	Ga0590075_001183_4225_6132	604
18	3300006353	Ga0075370_10002253	Ga0075370_100022535	605
19	3300050496	nmdc:mga07m45_6300_c1	nmdc:mga07m45_6300_c1_550_2433	605
20	3300005981	Ga0081538_10023186	Ga0081538_100231862	606
21	3300046616	Ga0495668_0028409	Ga0495668_0028409_21_1877	607
22	3300046664	Ga0495659_0010475	Ga0495659_0010475_622_2541	608
23	3300005355	Ga0070671_100049833	Ga0070671_1000498331	609
24	3300005564	Ga0070664_100023597	Ga0070664_1000235973	609
25	3300009177	Ga0105248_10019571	Ga0105248_100195715	609
26	3300013297	Ga0157378_10038378	Ga0157378_100383782	609
27	3300025931	Ga0207644_10015340	Ga0207644_100153403	609
28	iso_pu_bacteria	2617270735	2617352702	610
29	3300005563	Ga0068855_100001230	Ga0068855_10000123019	611
30	3300009093	Ga0105240_10027658	Ga0105240_100276583	611
31	3300009545	Ga0105237_10025089	Ga0105237_100250894	611
32	3300025949	Ga0207667_10002232	Ga0207667_1000223217	611
33	3300005985	Ga0081539_10028701	Ga0081539_100287012	613
34	3300025923	Ga0207681_10069744	Ga0207681_100697442	615
35	3300025933	Ga0207706_10072625	Ga0207706_100726253	615
36	3300005331	Ga0070670_100032042	Ga0070670_1000320422	616
37	3300005335	Ga0070666_10020478	Ga0070666_100204783	616
38	3300005353	Ga0070669_100033190	Ga0070669_1000331902	616
39	3300005367	Ga0070667_100019380	Ga0070667_1000193802	616
40	3300005549	Ga0070704_100061015	Ga0070704_1000610152	616
41	3300005841	Ga0068863_100119871	Ga0068863_1001198712	616
42	3300009147	Ga0114129_10123931	Ga0114129_101239312	616
43	3300013308	Ga0157375_10012607	Ga0157375_100126075	616
44	3300025931	Ga0207644_10032706	Ga0207644_100327062	616
45	3300025940	Ga0207691_10077806	Ga0207691_100778062	616
46	3300025986	Ga0207658_10009501	Ga0207658_100095012	616
47	3300026088	Ga0207641_10095569	Ga0207641_100955692	616
48	3300026121	Ga0207683_10008194	Ga0207683_100081946	616
49	3300048912	Ga0496109_0167797	Ga0496109_0167797_24_1913	616
50	iso_pu_bacteria	2953994433	2953994537	616
51	3300025292	Ga0209676_1000964	Ga0209676_10009648	617
52	3300003794	Ga0055531_10000323	Ga0055531_1000032333	618
53	3300025292	Ga0209676_1001440	Ga0209676_100144022	618
54	3300025294	Ga0209025_1001094	Ga0209025_100109423	618
55	3300025304	Ga0209257_1000971	Ga0209257_100097123	618
56	3300005337	Ga0070682_100051308	Ga0070682_1000513082	619
57	3300005543	Ga0070672_100031996	Ga0070672_1000319963	619
58	3300005543	Ga0070672_100059132	Ga0070672_1000591322	619
59	3300006358	Ga0068871_100022201	Ga0068871_1000222012	619
60	3300006358	Ga0068871_100026432	Ga0068871_1000264323	619
61	3300009094	Ga0111539_10032684	Ga0111539_100326845	619
62	3300013308	Ga0157375_10015915	Ga0157375_100159153	619
63	3300014969	Ga0157376_10030718	Ga0157376_100307183	619
64	3300025893	Ga0207682_10002171	Ga0207682_100021713	619
65	3300025940	Ga0207691_10028061	Ga0207691_100280615	619
66	3300025940	Ga0207691_10028480	Ga0207691_100284802	619
67	3300025940	Ga0207691_10074053	Ga0207691_100740532	619
68	3300026121	Ga0207683_10003342	Ga0207683_100033424	619
69	3300031901	Ga0307406_10022146	Ga0307406_100221462	619
70	3300031903	Ga0307407_10005393	Ga0307407_100053932	619
71	3300032002	Ga0307416_100035284	Ga0307416_1000352842	619
72	3300032005	Ga0307411_10082038	Ga0307411_100820382	619
73	3300039450	Ga0436363_1675970	Ga0436363_1675970_681_2621	619
74	3300050511	nmdc:mga08y16_35959_c1	nmdc:mga08y16_35959_c1_2231_4153	619
75	3300005615	Ga0070702_100062803	Ga0070702_1000628031	620
76	3300037471	Ga0395905_0036636	Ga0395905_0036636_2365_4374	620
77	3300038443	Ga0395901_0017233	Ga0395901_0017233_1199_3208	620
78	3300041413	Ga0439465_0003005	Ga0439465_0003005_1554_3425	620
79	3300044672	Ga0466982_0000117	Ga0466982_0000117_5123_6994	620
80	3300046660	Ga0495625_0001340	Ga0495625_0001340_12840_14711	620
81	3300006847	Ga0075431_100039197	Ga0075431_1000391974	622
82	3300049574	Ga0501038_0099905	Ga0501038_0099905_222_2111	622
83	3300049577	Ga0501041_0016451	Ga0501041_0016451_1377_3266	622
84	3300049578	Ga0501042_0006017	Ga0501042_0006017_549_2438	622
85	3300049582	Ga0501048_0049025	Ga0501048_0049025_576_2465	622
86	3300049587	Ga0501071_0011587	Ga0501071_0011587_648_2537	622
87	3300049591	Ga0501075_0013151	Ga0501075_0013151_988_2877	622
88	3300049592	Ga0501076_0017534	Ga0501076_0017534_3276_5165	622
89	3300049822	Ga0501035_0072575	Ga0501035_0072575_1096_2985	622
90	3300050509	nmdc:mga0qj67_34460_c1	nmdc:mga0qj67_34460_c1_702_2615	622
91	3300050510	nmdc:mga06r32_39098_c1	nmdc:mga06r32_39098_c1_702_2615	622
92	3300061734	Ga0530510_0055041	Ga0530510_0055041_288_2177	622
93	3300005545	Ga0070695_100064009	Ga0070695_1000640091	623
94	3300005548	Ga0070665_100014628	Ga0070665_1000146283	623
95	3300025925	Ga0207650_10054652	Ga0207650_100546523	623
96	3300025940	Ga0207691_10137160	Ga0207691_101371602	623
97	3300048910	Ga0496107_0011593	Ga0496107_0011593_462_2369	623
98	3300053153	Ga0500616_0000016	Ga0500616_0000016_507195_509135	623
99	3300053156	Ga0500622_0003368	Ga0500622_0003368_6308_8215	623
100	3300005614	Ga0068856_100081849	Ga0068856_1000818494	624
101	3300031731	Ga0307405_10007369	Ga0307405_100073695	624
102	3300032002	Ga0307416_100016118	Ga0307416_1000161185	624
103	3300009093	Ga0105240_10013633	Ga0105240_1001363312	625
104	3300009551	Ga0105238_10014845	Ga0105238_100148458	625
105	3300013102	Ga0157371_10059849	Ga0157371_100598492	625
106	3300013105	Ga0157369_10022766	Ga0157369_100227666	625
107	3300044658	Ga0466972_0024597	Ga0466972_0024597_211_2148	625
108	3300003781	Ga0055536_1000023	Ga0055536_1000023141	626
109	3300003794	Ga0055531_10000185	Ga0055531_1000018525	626
110	3300005548	Ga0070665_100010894	Ga0070665_1000108942	626
111	3300009093	Ga0105240_10020695	Ga0105240_100206959	626
112	3300021441	Ga0213871_10000504	Ga0213871_100005045	626
113	3300025292	Ga0209676_1000072	Ga0209676_100007226	626
114	3300025298	Ga0209050_1000077	Ga0209050_100007726	626
115	3300025304	Ga0209257_1000088	Ga0209257_100008826	626
116	3300026089	Ga0207648_10041506	Ga0207648_100415063	626
117	3300028379	Ga0268266_10002529	Ga0268266_1000252919	626
118	3300037471	Ga0395905_0090181	Ga0395905_0090181_576_2483	626
119	3300037853	Ga0436364_1056701	Ga0436364_1056701_2093_3997	626
120	3300039438	Ga0436360_1030100	Ga0436360_1030100_956_2860	626
121	3300053092	Ga0500583_0003644	Ga0500583_0003644_1076_3043	626
122	3300053092	Ga0500583_0005412	Ga0500583_0005412_1866_3830	626
123	iso_pu_bacteria	2879099564	2879102442	626
124	3300005355	Ga0070671_100078398	Ga0070671_1000783982	627
125	3300025931	Ga0207644_10072115	Ga0207644_100721152	627
126	3300026041	Ga0207639_10041916	Ga0207639_100419163	627
127	3300026118	Ga0207675_100125929	Ga0207675_1001259292	627
128	3300031911	Ga0307412_10068882	Ga0307412_100688822	627
129	3300031995	Ga0307409_100002919	Ga0307409_1000029194	627
130	3300032002	Ga0307416_100031878	Ga0307416_1000318784	627
131	3300032004	Ga0307414_10048235	Ga0307414_100482352	627
132	3300032126	Ga0307415_100048748	Ga0307415_1000487483	627
133	3300048911	Ga0496108_0101557	Ga0496108_0101557_416_2332	627
134	3300048915	Ga0496112_0094367	Ga0496112_0094367_246_2162	627
135	iso_pu_bacteria	2513237089	2513607109	627
136	iso_pu_bacteria	2802428860	2802734734	627
137	iso_pu_bacteria	2937084907	2937087470	627
138	iso_pu_bacteria	2957375807	2957378924	627
139	iso_pu_bacteria	2960631154	2960636485	627
140	iso_pu_bacteria	2967686174	2967692899	627
141	iso_pu_bacteria	2977544691	2977551261	627
142	3300025933	Ga0207706_10026835	Ga0207706_100268356	628
143	3300053156	Ga0500622_0001863	Ga0500622_0001863_13044_14957	628
144	iso_pu_bacteria	2507262055	2507510830	628
145	iso_pu_bacteria	2513237161	2514017309	628
146	iso_pu_bacteria	2515154112	2515628088	628
147	iso_pu_bacteria	2617270735	2617351204	628
148	iso_pu_bacteria	2643221552	2643782083	628
149	iso_pu_bacteria	2824671348	2824675489	628
150	iso_pu_bacteria	2824687955	2824691668	628
151	iso_pu_bacteria	2838122688	2838122771	628
152	iso_pu_bacteria	2841941048	2841946231	628
153	iso_pu_bacteria	2841949485	2841950973	628
154	iso_pu_bacteria	2841966195	2841973415	628
155	iso_pu_bacteria	2841974524	2841982497	628
156	iso_pu_bacteria	2841983080	2841988838	628
157	iso_pu_bacteria	2874590934	2874592432	628
158	iso_pu_bacteria	2874645413	2874645611	628
159	iso_pu_bacteria	2876771140	2876775293	628
160	iso_pu_bacteria	2876818435	2876826356	628
161	iso_pu_bacteria	2879074833	2879079619	628
162	iso_pu_bacteria	2879127579	2879129243	628
163	iso_pu_bacteria	2879142872	2879144884	628
164	iso_pu_bacteria	2922393267	2922399841	628
165	iso_pu_bacteria	2932784394	2932792275	628
166	iso_pu_bacteria	2932818245	2932826380	628
167	iso_pu_bacteria	2932828146	2932836426	628
168	iso_pu_bacteria	2935648319	2935655280	628
169	iso_pu_bacteria	2935656913	2935664160	628
170	iso_pu_bacteria	2935703347	2935711189	628
171	iso_pu_bacteria	2935769743	2935775350	628
172	iso_pu_bacteria	2935777560	2935779447	628
173	iso_pu_bacteria	2935785616	2935790981	628
174	iso_pu_bacteria	2935793552	2935801216	628
175	iso_pu_bacteria	2935908558	2935913434	628
176	iso_pu_bacteria	2935916978	2935923330	628
177	iso_pu_bacteria	2935926038	2935931249	628
178	iso_pu_bacteria	2935934488	2935935531	628
179	iso_pu_bacteria	2935942939	2935947097	628
180	iso_pu_bacteria	2935951376	2935953808	628
181	iso_pu_bacteria	2935967501	2935968834	628
182	iso_pu_bacteria	2935975950	2935979427	628
183	iso_pu_bacteria	2935984226	2935989895	628
184	iso_pu_bacteria	2936011229	2936018188	628
185	iso_pu_bacteria	2936019824	2936021986	628
186	iso_pu_bacteria	2936028420	2936035629	628
187	iso_pu_bacteria	2936046547	2936053664	628
188	iso_pu_bacteria	2936055302	2936062762	628
189	iso_pu_bacteria	8016511872	8016512580	628
190	iso_pu_bacteria	8016530956	8016536167	628
191	iso_pu_bacteria	8016539877	8016540453	628
192	iso_pu_bacteria	8016548790	8016552790	628
193	iso_pu_bacteria	8016557553	8016561168	628
194	iso_pu_bacteria	8016595262	8016599026	628
195	iso_pu_bacteria	8016603502	8016612031	628
196	iso_pu_bacteria	8016613128	8016621775	628
197	iso_pu_bacteria	8016622563	8016628072	628
198	iso_pu_bacteria	8016630954	8016639660	628
199	iso_pu_bacteria	8017057580	8017067105	628
200	iso_pu_bacteria	8019530166	8019535893	628
201	iso_pu_bacteria	8019547302	8019555185	628
202	iso_pu_bacteria	8019576017	8019586096	628
203	iso_pu_bacteria	8019586578	8019586813	628
204	iso_pu_bacteria	8019597564	8019608301	628
205	iso_pu_bacteria	8019608314	8019608811	628
206	iso_pu_bacteria	8019619141	8019625512	628
207	iso_pu_bacteria	8019638758	8019642848	628
208	iso_pu_bacteria	8019648815	8019649772	628
209	iso_pu_bacteria	8019668869	8019674164	628
210	iso_pu_bacteria	8056689827	8056693269	628
211	3300005327	Ga0070658_10099894	Ga0070658_100998942	629
212	3300005344	Ga0070661_100010715	Ga0070661_1000107155	629
213	3300005563	Ga0068855_100062313	Ga0068855_1000623134	629
214	3300027876	Ga0209974_10009460	Ga0209974_100094603	629
215	3300053104	Ga0500556_0000792	Ga0500556_0000792_16465_18387	629
216	iso_pu_bacteria	2857504554	2857505982	629
217	iso_pu_bacteria	2964636051	2964638078	629
218	3300021384	Ga0213876_10003742	Ga0213876_100037425	630
219	3300037418	Ga0395900_0000394	Ga0395900_0000394_47702_49609	630
220	3300037466	Ga0395898_0016040	Ga0395898_0016040_3571_5478	630
221	3300038443	Ga0395901_0015140	Ga0395901_0015140_1722_3629	630
222	3300039437	Ga0436365_0409866	Ga0436365_0409866_59391_61298	630
223	3300039437	Ga0436365_0545430	Ga0436365_0545430_7539_9446	630
224	3300039453	Ga0436362_1077409	Ga0436362_1077409_5650_7557	630
225	3300045976	Ga0466967_0057324	Ga0466967_0057324_966_2873	630
226	3300046507	Ga0495606_0012819	Ga0495606_0012819_1735_3642	630
227	3300046522	Ga0495643_0020119	Ga0495643_0020119_687_2594	630
228	3300046524	Ga0495648_0027697	Ga0495648_0027697_1050_2957	630
229	3300046616	Ga0495668_0002569	Ga0495668_0002569_3555_5462	630
230	3300046660	Ga0495625_0025838	Ga0495625_0025838_1157_3064	630
231	3300046665	Ga0495661_0032316	Ga0495661_0032316_673_2580	630
232	3300046694	Ga0495649_0016907	Ga0495649_0016907_1546_3453	630
233	3300047323	Ga0495683_0019359	Ga0495683_0019359_646_2553	630
234	3300050492	nmdc:mga0yw44_3682_c1	nmdc:mga0yw44_3682_c1_4000_5907	630
235	iso_pu_bacteria	2510065057	2510305482	630
236	iso_pu_bacteria	2512875026	2512974332	630
237	iso_pu_bacteria	2513237156	2513988313	630
238	iso_pu_bacteria	2558860100	2558864812	630
239	iso_pu_bacteria	2802428858	2802722104	630
240	iso_pu_bacteria	2802428862	2802747716	630
241	iso_pu_bacteria	2839993093	2839996489	630
242	iso_pu_bacteria	2913295892	2913300399	630
243	iso_pu_bacteria	2916041962	2916042676	630
244	iso_pu_bacteria	2916061851	2916068235	630
245	iso_pu_bacteria	2916076590	2916079057	630
246	iso_pu_bacteria	2921208531	2921212890	630
247	iso_pu_bacteria	2937036028	2937039898	630
248	iso_pu_bacteria	2937071275	2937073730	630
249	iso_pu_bacteria	2937078374	2937079557	630
250	iso_pu_bacteria	2937126314	2937131157	630
251	iso_pu_bacteria	2957443900	2957450411	630
252	iso_pu_bacteria	2957450854	2957453905	630
253	iso_pu_bacteria	2957491536	2957492256	630
254	iso_pu_bacteria	2960610863	2960616130	630
255	iso_pu_bacteria	2960660292	2960660936	630
256	iso_pu_bacteria	2960693952	2960694392	630
257	iso_pu_bacteria	2964636051	2964642381	630
258	iso_pu_bacteria	2964705432	2964711759	630
259	iso_pu_bacteria	2964712639	2964713934	630
260	iso_pu_bacteria	2967728569	2967732134	630
261	iso_pu_bacteria	2970076120	2970082751	630
262	iso_pu_bacteria	2970143518	2970147179	630
263	iso_pu_bacteria	2977516862	2977517332	630
264	iso_pu_bacteria	2977530762	2977536153	630
265	iso_pu_bacteria	2977537788	2977540466	630
266	iso_pu_bacteria	2977565890	2977572760	630
267	iso_pu_bacteria	8003999396	8004006440	630
268	3300010375	Ga0105239_10170972	Ga0105239_101709721	631
269	3300014325	Ga0163163_10025283	Ga0163163_100252834	631
270	3300025920	Ga0207649_10017866	Ga0207649_100178664	631
271	3300025940	Ga0207691_10021445	Ga0207691_100214455	631
272	iso_pu_bacteria	2945945610	2945950018	631
273	iso_pu_bacteria	643348564	643600079	631
274	3300006871	Ga0075434_100059457	Ga0075434_1000594572	632
275	3300022740	Ga0228710_1003087	Ga0228710_100308715	632
276	3300025913	Ga0207695_10058257	Ga0207695_100582572	632
277	3300025924	Ga0207694_10027187	Ga0207694_100271872	632
278	3300028800	Ga0265338_10013648	Ga0265338_100136485	632
279	3300031967	Ga0315914_1000060	Ga0315914_100006053	632
280	3300031995	Ga0307409_100043350	Ga0307409_1000433503	632
281	3300032002	Ga0307416_100024610	Ga0307416_1000246102	632
282	3300033430	Ga0315913_1000025	Ga0315913_100002553	632
283	3300033464	Ga0315915_1000036	Ga0315915_100003619	632
284	3300044684	Ga0466966_0014504	Ga0466966_0014504_856_2769	632
285	3300044693	Ga0466961_0000009	Ga0466961_0000009_64733_66646	632
286	3300050513	nmdc:mga0rr50_36518_c1	nmdc:mga0rr50_36518_c1_1257_3248	632
287	iso_pu_bacteria	2884298095	2884301254	632
288	iso_pu_bacteria	2922361189	2922361629	632
289	3300005834	Ga0068851_10010060	Ga0068851_100100604	633
290	3300005985	Ga0081539_10013431	Ga0081539_100134312	633
291	3300015261	Ga0182006_1009523	Ga0182006_10095232	633
292	3300026121	Ga0207683_10099982	Ga0207683_100999822	633
293	3300003203	JGI25406J46586_10000566	JGI25406J46586_1000056613	634
294	3300003203	JGI25406J46586_10000579	JGI25406J46586_100005799	634
295	3300005344	Ga0070661_100010340	Ga0070661_1000103403	634
296	3300005577	Ga0068857_100004887	Ga0068857_1000048877	634
297	3300005578	Ga0068854_100001471	Ga0068854_1000014715	634
298	3300005614	Ga0068856_100017285	Ga0068856_1000172852	634
299	3300005618	Ga0068864_100026915	Ga0068864_1000269153	634
300	3300005985	Ga0081539_10000084	Ga0081539_1000008456	634
301	3300005985	Ga0081539_10000795	Ga0081539_1000079510	634
302	3300025908	Ga0207643_10002273	Ga0207643_100022737	634
303	3300025924	Ga0207694_10018655	Ga0207694_100186555	634
304	3300025925	Ga0207650_10023334	Ga0207650_100233342	634
305	3300025944	Ga0207661_10034862	Ga0207661_100348623	634
306	3300025945	Ga0207679_10044592	Ga0207679_100445922	634
307	3300026078	Ga0207702_10040503	Ga0207702_100405034	634
308	3300026095	Ga0207676_10054605	Ga0207676_100546053	634
309	3300026116	Ga0207674_10027668	Ga0207674_100276684	634
310	3300027876	Ga0209974_10001510	Ga0209974_100015106	634
311	3300005328	Ga0070676_10003976	Ga0070676_100039762	635
312	3300005335	Ga0070666_10001791	Ga0070666_100017916	635
313	3300005354	Ga0070675_100004404	Ga0070675_1000044045	635
314	3300005364	Ga0070673_100021496	Ga0070673_1000214964	635
315	3300005365	Ga0070688_100001296	Ga0070688_10000129610	635
316	3300005435	Ga0070714_100006621	Ga0070714_1000066214	635
317	3300005457	Ga0070662_100011689	Ga0070662_1000116896	635
318	3300005458	Ga0070681_10027702	Ga0070681_100277024	635
319	3300005543	Ga0070672_100015829	Ga0070672_1000158294	635
320	3300005544	Ga0070686_100004462	Ga0070686_1000044625	635
321	3300005564	Ga0070664_100001727	Ga0070664_1000017272	635
322	3300005564	Ga0070664_100013514	Ga0070664_1000135144	635
323	3300005577	Ga0068857_100000674	Ga0068857_10000067419	635
324	3300005616	Ga0068852_100059313	Ga0068852_1000593132	635
325	3300005841	Ga0068863_100003179	Ga0068863_1000031796	635
326	3300009174	Ga0105241_10065603	Ga0105241_100656032	635
327	3300009551	Ga0105238_10001551	Ga0105238_1000155114	635
328	3300013100	Ga0157373_10015303	Ga0157373_100153032	635
329	3300025315	Ga0207697_10027243	Ga0207697_100272432	635
330	3300025903	Ga0207680_10011882	Ga0207680_100118825	635
331	3300025924	Ga0207694_10003151	Ga0207694_1000315111	635
332	3300025932	Ga0207690_10036899	Ga0207690_100368992	635
333	3300025933	Ga0207706_10014915	Ga0207706_1001491510	635
334	3300025940	Ga0207691_10024163	Ga0207691_100241634	635
335	3300025945	Ga0207679_10009399	Ga0207679_100093995	635
336	3300025960	Ga0207651_10000945	Ga0207651_1000094515	635
337	3300026088	Ga0207641_10005334	Ga0207641_100053346	635
338	3300026116	Ga0207674_10000014	Ga0207674_10000014142	635
339	3300005328	Ga0070676_10014958	Ga0070676_100149582	636
340	3300005339	Ga0070660_100000421	Ga0070660_10000042123	636
341	3300005339	Ga0070660_100004900	Ga0070660_1000049006	636
342	3300005344	Ga0070661_100005130	Ga0070661_1000051306	636
343	3300005354	Ga0070675_100042467	Ga0070675_1000424671	636
344	3300005355	Ga0070671_100002646	Ga0070671_10000264612	636
345	3300005366	Ga0070659_100001630	Ga0070659_1000016307	636
346	3300005457	Ga0070662_100003404	Ga0070662_1000034043	636
347	3300005539	Ga0068853_100002714	Ga0068853_1000027146	636
348	3300005563	Ga0068855_100010395	Ga0068855_1000103957	636
349	3300005564	Ga0070664_100004572	Ga0070664_1000045727	636
350	3300005578	Ga0068854_100041937	Ga0068854_1000419372	636
351	3300005614	Ga0068856_100000267	Ga0068856_10000026743	636
352	3300013100	Ga0157373_10001380	Ga0157373_1000138011	636
353	3300013102	Ga0157371_10003105	Ga0157371_100031059	636
354	3300013307	Ga0157372_10000613	Ga0157372_1000061310	636
355	3300025907	Ga0207645_10018752	Ga0207645_100187522	636
356	3300025919	Ga0207657_10002546	Ga0207657_1000254613	636
357	3300025919	Ga0207657_10004698	Ga0207657_100046986	636
358	3300025920	Ga0207649_10002319	Ga0207649_100023197	636
359	3300025926	Ga0207659_10015482	Ga0207659_100154824	636
360	3300025931	Ga0207644_10014707	Ga0207644_100147076	636
361	3300025932	Ga0207690_10002724	Ga0207690_100027247	636
362	3300025933	Ga0207706_10005883	Ga0207706_100058837	636
363	3300025940	Ga0207691_10033572	Ga0207691_100335723	636
364	3300025945	Ga0207679_10001259	Ga0207679_100012597	636
365	3300025949	Ga0207667_10009092	Ga0207667_100090929	636
366	3300025960	Ga0207651_10005646	Ga0207651_100056466	636
367	3300026041	Ga0207639_10003176	Ga0207639_100031769	636
368	3300026078	Ga0207702_10005201	Ga0207702_100052015	636
369	3300031852	Ga0307410_10013196	Ga0307410_100131962	636
370	3300031901	Ga0307406_10017996	Ga0307406_100179965	636
371	3300032004	Ga0307414_10029890	Ga0307414_100298902	636
372	3300048905	Ga0496102_0008305	Ga0496102_0008305_513_2459	636
373	3300048906	Ga0496103_0026632	Ga0496103_0026632_1452_3398	636
374	3300048909	Ga0496106_0001690	Ga0496106_0001690_6775_8721	636
375	3300005364	Ga0070673_100030511	Ga0070673_1000305111	637
376	3300005543	Ga0070672_100021731	Ga0070672_1000217312	637
377	3300009177	Ga0105248_10007087	Ga0105248_1000708710	637
378	3300013306	Ga0163162_10074821	Ga0163162_100748214	637
379	3300044765	Ga0466970_0000650	Ga0466970_0000650_14643_16586	637
380	3300046539	Ga0495621_0002666	Ga0495621_0002666_1143_3131	637
381	3300005458	Ga0070681_10015772	Ga0070681_100157724	638
382	3300006871	Ga0075434_100013667	Ga0075434_1000136677	638
383	3300007076	Ga0075435_100002443	Ga0075435_1000024435	638
384	3300025273	Ga0209673_1008321	Ga0209673_10083212	638
385	3300025303	Ga0209051_1000025	Ga0209051_1000025112	638
386	3300025304	Ga0209257_1000039	Ga0209257_1000039496	638
387	3300025960	Ga0207651_10038915	Ga0207651_100389152	638
388	3300003544	Ga0007417J51691_1016079	Ga0007417J51691_10160794	639
389	3300003575	Ga0007409J51694_1030209	Ga0007409J51694_10302094	639
390	3300003577	Ga0007416J51690_1017177	Ga0007416J51690_10171774	639
391	3300003693	Ga0032354_1007186	Ga0032354_10071864	639
392	3300013100	Ga0157373_10011519	Ga0157373_100115195	639
393	iso_pu_bacteria	2508501114	2509077076	640
394	iso_pu_bacteria	2773857925	2774870022	640
395	iso_pu_bacteria	2835312727	2835313023	640
396	iso_pu_bacteria	2882456835	2882459994	640
397	iso_pu_bacteria	2894232714	2894236929	640
398	3300001976	JGI24752J21851_1000187	JGI24752J21851_10001875	643
399	3300002074	JGI24748J21848_1000033	JGI24748J21848_100003347	643
400	3300002239	JGI24034J26672_10000032	JGI24034J26672_1000003258	643
401	3300005330	Ga0070690_100000011	Ga0070690_10000001110	643
402	3300005335	Ga0070666_10000035	Ga0070666_1000003534	643
403	3300005353	Ga0070669_100000131	Ga0070669_10000013135	643
404	3300005355	Ga0070671_100015960	Ga0070671_1000159601	643
405	3300005365	Ga0070688_100011135	Ga0070688_1000111354	643
406	3300005544	Ga0070686_100000035	Ga0070686_10000003581	643
407	3300005548	Ga0070665_100000161	Ga0070665_10000016194	643
408	3300005618	Ga0068864_100014687	Ga0068864_1000146872	643
409	3300005841	Ga0068863_100000060	Ga0068863_10000006093	643
410	3300005842	Ga0068858_100002514	Ga0068858_1000025149	643
411	3300005843	Ga0068860_100000126	Ga0068860_10000012694	643
412	3300005844	Ga0068862_100000146	Ga0068862_10000014619	643
413	3300009545	Ga0105237_10111785	Ga0105237_101117852	643
414	3300009553	Ga0105249_10000094	Ga0105249_1000009435	643
415	3300017792	Ga0163161_10000195	Ga0163161_1000019524	643
416	3300025903	Ga0207680_10000007	Ga0207680_10000007311	643
417	3300025911	Ga0207654_10021920	Ga0207654_100219204	643
418	3300025914	Ga0207671_10039706	Ga0207671_100397062	643
419	3300025919	Ga0207657_10013540	Ga0207657_100135404	643
420	3300025923	Ga0207681_10000053	Ga0207681_1000005383	643
421	3300025933	Ga0207706_10013171	Ga0207706_100131714	643
422	3300025961	Ga0207712_10000004	Ga0207712_10000004299	643
423	3300025986	Ga0207658_10001427	Ga0207658_100014279	643
424	3300026035	Ga0207703_10002077	Ga0207703_100020778	643
425	3300026088	Ga0207641_10000100	Ga0207641_1000010084	643
426	3300026095	Ga0207676_10004838	Ga0207676_100048384	643
427	3300026116	Ga0207674_10011744	Ga0207674_100117446	643
428	3300028379	Ga0268266_10000040	Ga0268266_10000040223	643
429	3300028380	Ga0268265_10000128	Ga0268265_1000012865	643
430	3300028381	Ga0268264_10000003	Ga0268264_10000003313	643
431	3300048906	Ga0496103_0002395	Ga0496103_0002395_7816_9747	643
432	3300048920	Ga0496117_0010660	Ga0496117_0010660_1019_2950	643
433	3300048921	Ga0496118_0014990	Ga0496118_0014990_4312_6243	643

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

74

520

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6hwh-assembly1.cif.gz_V	structure of a functional obligate respiratory supercomplex from mycobacterium smegmatis	0.9433	34	555
3abk-assembly1.cif.gz_A	bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)	0.9407	40	540
8d4t-assembly1.cif.gz_N	mammalian civ with gdn bound	0.9388	40	545
1fft-assembly2.cif.gz_F	the structure of ubiquinol oxidase from escherichia coli	0.9366	45	539
7jrp-assembly1.cif.gz_a	plant mitochondrial complex sc iii2+iv from vigna radiata	0.934	40	546

ID	Description	Score	Start	End	Superfamily
af_Q2FZK0_30_556_1.20.210.10	Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain	0.9478	40	543	1.20.210.10
af_P9WP71_20_544_1.20.210.10	Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain	0.9395	32	550	1.20.210.10
2yevD01	Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain	0.9284	38	553	1.20.210.10
af_P9WP71_20_544_1.20.210.10	Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain	0.9274	32	550	1.20.210.10
af_O21042_10_509_1.20.210.10	Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain	0.9253	40	516	1.20.210.10

ID	Description	Score	Start	End	GO Terms
AF-A0A536ALJ4-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9888	408	555	GO:0004129 GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904
AF-A0A536CQ17-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9779	402	554	GO:0004129 GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904
AF-A0A6V8DB03-F1-model_v4	Cytochrome oxidase subunit I profile domain-containing protein	0.9771	406	544	GO:0004129 GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904
AF-A0A6G2V698-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9737	349	488	GO:0004129 GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904
AF-A0A6L6CXN6-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9722	33	143	GO:0004129 GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904

Feature Viewer

pLDDT	pTM	Quality
82.64	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442970

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

74

520

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map