F442986

General Info

Members Datasets Scaffolds Average Seq Length
433 371 866 213

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055431914|8055435585
Length 259
Sequence AGRLHFAIFLVSGLLGVCALSPAATAQDSSSNPVAVQAPVANPGQDQPPASALAPLQNNDDTITDVPVTERQVQIIGLGDSLMAGYQLPGDQSLTSQLEKALQDKGLNVSIGDAGVSGDTSEGGLSRVDWSVPDGTDGVILELGANDALRGIAPEETERNLAAIIQKLQARKIAVLLVGMIAPPNMGVDYGRRFNPIYKRLADKYHLAFYPFILQGVATNPKLKLSDGMHPNAEGVKVMVHNMLPTVLSFAKALADKHN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
149 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
150 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
153 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
158 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
161 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
162 2509276019 Ensifer aridi TW10 Isolate Nodule
163 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
164 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
165 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
166 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
167 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
168 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
169 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
170 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
171 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
172 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
173 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
174 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
175 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
176 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
177 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
178 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
179 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
180 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
181 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
182 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
183 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
184 2516143018 Ensifer sp. BR816 Isolate Nodule
185 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
186 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
187 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
188 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
189 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
190 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
191 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
192 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
193 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
194 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
195 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
196 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
197 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
198 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
199 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
200 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
201 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
202 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
203 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
204 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
205 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
206 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
207 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
208 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
209 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
210 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
211 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
212 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
213 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
214 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
215 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
216 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
217 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
218 2643221557 Ensifer sp. Root558 Isolate Unclassified
219 2643221607 Rhizobium sp. Root73 Isolate Unclassified
220 2643221610 Ensifer sp. Root74 Isolate Unclassified
221 2643221626 Ensifer sp. Root31 Isolate Unclassified
222 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
223 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
224 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
225 2643221655 Ensifer sp. Root1252 Isolate Unclassified
226 2643221659 Ensifer sp. Root127 Isolate Unclassified
227 2643221668 Ensifer sp. Root423 Isolate Unclassified
228 2643221675 Ensifer sp. Root1298 Isolate Unclassified
229 2643221680 Ensifer sp. Root1312 Isolate Unclassified
230 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
231 2643221688 Rhizobium sp. Root482 Isolate Unclassified
232 2643221693 Rhizobium sp. Root491 Isolate Unclassified
233 2643221698 Ensifer sp. Root142 Isolate Unclassified
234 2643221712 Ensifer sp. Root258 Isolate Unclassified
235 2643221719 Rhizobium sp. Root274 Isolate Unclassified
236 2643221723 Ensifer sp. Root278 Isolate Unclassified
237 2643221726 Ensifer sp. Root954 Isolate Unclassified
238 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
239 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
240 2718217882 Rhizobium sp. N741 Isolate Nodule
241 2718217927 Rhizobium sp. N324 Isolate Nodule
242 2718218009 Rhizobium sp. N561 Isolate Nodule
243 2718218363 Rhizobium sp. N113 Isolate Nodule
244 2718218365 Rhizobium sp. N731 Isolate Nodule
245 2718218366 Rhizobium sp. N621 Isolate Nodule
246 2718218423 Rhizobium sp. N941 Isolate Nodule
247 2721755514 Rhizobium sp. N6212 Isolate Nodule
248 2721755809 Rhizobium sp. N541 Isolate Nodule
249 2721755810 Rhizobium sp. N871 Isolate Nodule
250 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
251 2728369365 Rhizobium sp. N1341 Isolate Nodule
252 2728369397 Rhizobium sp. N1314 Isolate Nodule
253 2738541293 Rhizobium sp. GV031 Isolate Unclassified
254 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
255 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
256 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
257 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
258 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
259 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
260 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
261 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
262 2791355260 Rhizobium sp. L9 Isolate Nodule
263 2791355264 Rhizobium sp. S9 Isolate Nodule
264 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
265 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
266 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
267 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
268 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
269 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
270 2802429633 Rhizobium anhuiense J3 Isolate Nodule
271 2802429634 Rhizobium anhuiense S10 Isolate Nodule
272 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
273 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
274 2802429637 Rhizobium anhuiense C15 Isolate Nodule
275 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
276 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
277 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
278 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
279 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
280 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
281 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
282 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
283 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
284 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
285 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
286 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
287 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
288 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
289 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
290 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
291 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
292 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
293 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
294 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
295 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
296 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
297 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
298 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
299 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
300 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
301 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
302 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
303 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
304 2854911287 Brucella lupini LUP21 Isolate Unclassified
305 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
306 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
307 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
308 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
309 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
310 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
311 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
312 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
313 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
314 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
315 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
316 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
317 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
318 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
319 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
320 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
321 2936381700 Rhizobium chutanense C16 Isolate Unclassified
322 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
323 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
324 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
325 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
326 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
327 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
328 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
329 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
330 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
331 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
332 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
333 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
334 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
335 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
336 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
337 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
338 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
339 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
340 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
341 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
342 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
343 2996887358 Rhizobium sp. R711 Isolate Nodule
344 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
345 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
346 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
347 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
348 8005258706 Rhizobium sp. R693 Isolate Nodule
349 8005275841 Rhizobium sp. N4311 Isolate Nodule
350 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
351 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
352 8005321885 Rhizobium sp. R72 Isolate Nodule
353 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
354 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
355 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
356 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
357 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
358 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
359 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
360 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
361 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
362 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
363 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
364 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
365 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
366 8018176218 Rhizobium sp. N122 Isolate Nodule
367 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
368 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
369 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
370 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
371 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.04
Metatranscriptomes 0
Isolates 48.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.25
Nodule 29.56
Rhizoplane 2.77
Rhizosphere 25.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000013 3300001979 Bacteria 62177
2 JGI25155J39150_1000010 3300002704 Bacteria 207717
3 JGI25156J39149_1000102 3300002705 Bacteria 62463
4 JGI25162J39368_1001052 3300002737 Bacteria 16925
5 JGI25162J39368_1001061 3300002737 Bacteria 16807
6 JGI25154J39366_1000184 3300002738 Bacteria 48243
7 JGI25157J39369_1000009 3300002741 Bacteria 207868
8 JGI25159J45721_1000017 3300002987 Bacteria 136127
9 JGI25159J45721_1000623 3300002987 Bacteria 15724
10 JGI25151J46595_10011591 3300003187 Bacteria 4047
11 JGI25165J46597_1001126 3300003214 Bacteria 16807
12 JGI25165J46597_1001559 3300003214 Bacteria 11338
13 JGI25165J46597_1004972 3300003214 Bacteria 2674
14 rootH1_10046822 3300003316 Bacteria 3316
15 rootH1_10119709 3300003323 Bacteria 1165
16 JGI25160J50197_1000027 3300003354 Bacteria 182809
17 JGI25160J50197_1000235 3300003354 Bacteria 43030
18 JGI25161J50226_1000175 3300003374 Bacteria 43039
19 JGI25161J50226_1000533 3300003374 Bacteria 16369
20 Ga0055539_1016448 3300003752 Bacteria 897
21 Ga0055526_1003362 3300003771 Bacteria 10207
22 Ga0055526_1003979 3300003771 Bacteria 9100
23 Ga0055524_1002526 3300003775 Bacteria 9374
24 Ga0055536_1001546 3300003781 Bacteria 13806
25 Ga0055528_1002500 3300003790 Bacteria 9814
26 Ga0055530_10015408 3300003791 Bacteria 2496
27 Ga0055530_10022537 3300003791 Bacteria 1831
28 Ga0055540_1001660 3300003792 Bacteria 12897
29 Ga0055540_1006775 3300003792 Bacteria 4477
30 Ga0055531_10001931 3300003794 Bacteria 14503
31 Ga0055531_10040610 3300003794 Bacteria 1360
32 Ga0058692_1008859 3300003856 Bacteria 2576
33 Ga0058692_1010511 3300003856 Bacteria 2284
34 Ga0055543_1000030 3300004625 Bacteria 130849
35 Ga0055543_1000226 3300004625 Bacteria 44983
36 Ga0065165_1000122 3300005262 Bacteria 132524
37 Ga0065165_1001345 3300005262 Bacteria 27210
38 Ga0070658_10898513 3300005327 Bacteria 770
39 Ga0070670_100000116 3300005331 Bacteria 74586
40 Ga0070669_100035185 3300005353 Bacteria 3628
41 Ga0068853_100354687 3300005539 Bacteria 1365
42 Ga0070665_100004011 3300005548 Bacteria 15524
43 Ga0070665_100180333 3300005548 Bacteria 2113
44 Ga0068856_100116818 3300005614 Bacteria 2669
45 Ga0068852_100293650 3300005616 Bacteria 1571
46 Ga0068851_10103711 3300005834 Bacteria 1511
47 Ga0068860_100266357 3300005843 Bacteria 1671
48 Ga0075365_10007221 3300006038 Bacteria 6205
49 Ga0075368_10002647 3300006042 Bacteria 5885
50 Ga0075364_10000026 3300006051 Bacteria 51217
51 Ga0075367_10027467 3300006178 Bacteria 3238
52 Ga0075366_10153999 3300006195 Bacteria 1392
53 Ga0075370_10003299 3300006353 Bacteria 7657
54 Ga0105244_10039565 3300009036 Bacteria 2453
55 Ga0105240_10000013 3300009093 Bacteria 483458
56 Ga0105243_10017097 3300009148 Bacteria 5485
57 Ga0105243_10428087 3300009148 Bacteria 1236
58 Ga0105248_10202019 3300009177 Bacteria 2239
59 Ga0105237_10002248 3300009545 Bacteria 24031
60 Ga0105239_10000820 3300010375 Bacteria 44190
61 Ga0157373_10003539 3300013100 Bacteria 11797
62 Ga0157373_10249619 3300013100 Bacteria 1255
63 Ga0157371_10000108 3300013102 Bacteria 126288
64 Ga0157370_10002495 3300013104 Bacteria 22179
65 Ga0157370_10002982 3300013104 Bacteria 20123
66 Ga0157369_10169001 3300013105 Bacteria 2305
67 Ga0171463_1004 3300013249 Bacteria 437207
68 Ga0182008_10061204 3300014497 Bacteria 1856
69 Ga0182007_10016455 3300015262 Bacteria 2728
70 Ga0182005_1001581 3300015265 Bacteria 8979
71 Ga0183363_1019 3300015690 Bacteria 61083
72 Ga0214543_1000015 3300021327 Bacteria 305679
73 Ga0209435_100009 3300025206 Bacteria 476614
74 Ga0209436_101012 3300025208 Bacteria 10769
75 Ga0209672_105313 3300025228 Bacteria 2230
76 Ga0209437_100057 3300025233 Bacteria 362922
77 Ga0209437_100107 3300025233 Bacteria 218656
78 Ga0209437_102494 3300025233 Bacteria 3544
79 Ga0207425_1005362 3300025245 Bacteria 3667
80 Ga0209646_1000018 3300025246 Bacteria 476716
81 Ga0209026_1000068 3300025250 Bacteria 207601
82 Ga0209677_100199 3300025253 Bacteria 48030
83 Ga0209759_1000007 3300025256 Bacteria 476614
84 Ga0209233_1000072 3300025261 Bacteria 363074
85 Ga0209233_1000134 3300025261 Bacteria 202535
86 Ga0209233_1000479 3300025261 Bacteria 24402
87 Ga0209673_1000953 3300025273 Bacteria 36121
88 Ga0209130_1000027 3300025284 Bacteria 327700
89 Ga0209130_1000132 3300025284 Bacteria 119765
90 Ga0209676_1001489 3300025292 Bacteria 21556
91 Ga0209676_1004139 3300025292 Bacteria 8256
92 Ga0209025_1001410 3300025294 Bacteria 31841
93 Ga0209564_1000782 3300025295 Bacteria 44138
94 Ga0209564_1000919 3300025295 Bacteria 38399
95 Ga0209758_1000570 3300025297 Bacteria 57866
96 Ga0209050_1000572 3300025298 Bacteria 59716
97 Ga0209050_1009365 3300025298 Bacteria 5022
98 Ga0209050_1013505 3300025298 Bacteria 3617
99 Ga0209256_1002945 3300025299 Bacteria 12778
100 Ga0209256_1004473 3300025299 Bacteria 8742
101 Ga0209256_1026756 3300025299 Bacteria 1655
102 Ga0207426_1000072 3300025302 Bacteria 327700
103 Ga0207426_1000246 3300025302 Bacteria 119765
104 Ga0209051_1000917 3300025303 Bacteria 29277
105 Ga0209051_1001068 3300025303 Bacteria 25445
106 Ga0209051_1002527 3300025303 Bacteria 12957
107 Ga0209257_1001566 3300025304 Bacteria 26435
108 Ga0209257_1003132 3300025304 Bacteria 14757
109 Ga0209257_1004050 3300025304 Bacteria 11779
110 Ga0207656_10040802 3300025321 Bacteria 1969
111 Ga0207695_10000044 3300025913 Bacteria 440819
112 Ga0207671_10000400 3300025914 Bacteria 60604
113 Ga0207681_10053629 3300025923 Bacteria 2738
114 Ga0207650_10000151 3300025925 Bacteria 83229
115 Ga0207709_10062193 3300025935 Bacteria 2336
116 Ga0207639_10249329 3300026041 Bacteria 1548
117 Ga0207702_10091036 3300026078 Bacteria 2670
118 Ga0207698_10024780 3300026142 Bacteria 4217
119 Ga0209371_1002109 3300027312 Bacteria 11760
120 Ga0209371_1002474 3300027312 Bacteria 10284
121 Ga0209813_10004256 3300027866 Bacteria 3404
122 Ga0268266_10056925 3300028379 Bacteria 3363
123 Ga0268266_10112238 3300028379 Bacteria 2416
124 Ga0268256_1001864 3300030500 Bacteria 11667
125 Ga0307513_10001043 3300031456 Bacteria 40213
126 Ga0307513_10044054 3300031456 Bacteria 4892
127 Ga0307408_100121861 3300031548 Bacteria 2021
128 Ga0307408_100230226 3300031548 Bacteria 1517
129 Ga0307408_100261822 3300031548 Bacteria 1432
130 Ga0307412_10184524 3300031911 Bacteria 1572
131 Ga0307409_100065249 3300031995 Bacteria 2864
132 Ga0307416_100068211 3300032002 Bacteria 2938
133 Ga0373927_0000019 3300035695 Bacteria 139754
134 Ga0373925_0003004 3300037068 Bacteria 13268
135 Ga0439438_077512 3300041405 Bacteria 818
136 Ga0439466_0038998 3300041411 Bacteria 1594
137 Ga0439449_0026675 3300042007 Bacteria 2156
138 Ga0466958_0398744 3300045836 Bacteria 888
139 Ga0495629_0033062 3300046459 Bacteria 3659
140 Ga0495662_0006521 3300046476 Bacteria 5831
141 Ga0495606_0017834 3300046507 Bacteria 5346
142 Ga0495606_0019465 3300046507 Bacteria 5050
143 Ga0495606_0179987 3300046507 Bacteria 1220
144 Ga0495648_0058913 3300046524 Bacteria 2294
145 Ga0495652_0189479 3300046529 Bacteria 1571
146 Ga0495640_0208156 3300046533 Bacteria 1237
147 Ga0495587_0032494 3300046536 Bacteria 3155
148 Ga0495625_0047829 3300046660 Bacteria 3084
149 Ga0495588_0006440 3300046674 Bacteria 5287
150 Ga0495657_0039608 3300046675 Bacteria 3237
151 Ga0495658_0215916 3300046683 Bacteria 1200
152 Ga0495600_0006091 3300046809 Bacteria 7308
153 Ga0495604_0115224 3300047317 Bacteria 1953
154 Ga0495676_0335454 3300047321 Bacteria 1013
155 Ga0495681_0005682 3300047470 Bacteria 8304
156 Ga0495686_0004327 3300047472 Bacteria 11738
157 Ga0495686_0090632 3300047472 Bacteria 1856
158 Ga0495626_0073687 3300048091 Bacteria 1529
159 Ga0496100_0628008 3300048903 Bacteria 835
160 Ga0496101_0609879 3300048904 Bacteria 863
161 Ga0496102_0113186 3300048905 Bacteria 2531
162 Ga0496103_0013562 3300048906 Bacteria 4833
163 Ga0496110_0030907 3300048913 Bacteria 4619
164 Ga0496111_0003646 3300048914 Bacteria 9554
165 Ga0496112_0449706 3300048915 Bacteria 1226
166 Ga0496116_0012793 3300048919 Bacteria 6818
167 Ga0496116_0087172 3300048919 Bacteria 1911
168 Ga0496117_0000031 3300048920 Bacteria 381048
169 Ga0496117_0002097 3300048920 Bacteria 26238
170 Ga0496117_0010058 3300048920 Bacteria 8689
171 Ga0496117_0041019 3300048920 Bacteria 3397
172 Ga0496118_0002291 3300048921 Bacteria 26051
173 Ga0496118_0009274 3300048921 Bacteria 9980
174 Ga0496118_0134575 3300048921 Bacteria 1580
175 Ga0496119_0155157 3300048922 Bacteria 1223
176 Ga0496120_0002641 3300048923 Bacteria 17737
177 Ga0496120_0060679 3300048923 Bacteria 2114
178 Ga0496120_0246631 3300048923 Bacteria 840
179 Ga0496121_0011232 3300048924 Bacteria 9980
180 Ga0496121_0012300 3300048924 Bacteria 9362
181 Ga0496121_0031691 3300048924 Bacteria 4824
182 Ga0496122_0000023 3300048925 Bacteria 381035
183 Ga0496122_0013532 3300048925 Bacteria 7978
184 Ga0496122_0026114 3300048925 Bacteria 5050
185 Ga0496122_0107399 3300048925 Bacteria 1844
186 Ga0496123_0000027 3300048926 Bacteria 306773
187 Ga0496123_0010463 3300048926 Bacteria 8196
188 Ga0496124_0002248 3300048927 Bacteria 25664
189 Ga0496124_0005858 3300048927 Bacteria 13630
190 Ga0496124_0041989 3300048927 Bacteria 3941
191 Ga0496124_0061010 3300048927 Bacteria 3162
192 Ga0496125_0000030 3300048928 Bacteria 375023
193 Ga0496125_0236306 3300048928 Bacteria 1164
194 Ga0496126_0414875 3300048929 Bacteria 1089
195 Ga0501241_011010 3300049758 Bacteria 1643
196 nmdc:mga03683_10923_c1 3300050489 Bacteria 3269
197 nmdc:mga03n38_94738_c1 3300050490 Bacteria 1429
198 nmdc:mga00v17_1216_c1 3300050491 Bacteria 13522
199 nmdc:mga00v17_151_c1 3300050491 Bacteria 40348
200 nmdc:mga00v17_6381_c1 3300050491 Bacteria 6257
201 nmdc:mga0yw44_18355_c1 3300050492 Bacteria 3829
202 nmdc:mga0k408_30018_c1 3300050493 Bacteria 3098
203 nmdc:mga06z11_16937_c1 3300050494 Bacteria 3296
204 nmdc:mga06z11_189692_c1 3300050494 Bacteria 1189
205 nmdc:mga04h51_2539_c1 3300050495 Bacteria 4347
206 nmdc:mga07m45_107929_c1 3300050496 Bacteria 1602
207 nmdc:mga0sz30_107_c1 3300050516 Bacteria 31264
208 Ga0495601_0186774 3300053077 Bacteria 1355
209 Ga0495619_0168318 3300053085 Bacteria 1515
210 Ga0500646_0031491 3300053090 Bacteria 1460
211 Ga0500560_021194 3300053107 Bacteria 1854
212 Ga0500608_068006 3300053122 Bacteria 1697
213 Ga0500618_001280 3300053125 Bacteria 11596
214 Ga0500652_124171 3300053131 Bacteria 1078
215 Ga0500655_007895 3300053133 Bacteria 1917
216 Ga0500559_0007005 3300053136 Bacteria 5038
217 Ga0500561_0000177 3300053137 Bacteria 11747
218 Ga0500568_0009165 3300053139 Bacteria 4718
219 Ga0500573_0000334 3300053140 Bacteria 19960
220 Ga0500590_001183 3300053148 Bacteria 10347
221 Ga0500616_0003388 3300053153 Bacteria 12230
222 8055435585 8055431914 Bacteria 4551896
223 2509109544 2508501122 Bacteria 6292184
224 2509378132 2509276019 Bacteria 6802256
225 2509389437 2509276021 Bacteria 7634384
226 2510135220 2510065019 Bacteria 6903379
227 2510896674 2510461076 Bacteria 8618824
228 2511133847 2510917022 Bacteria 6504556
229 2511173058 2510917026 Bacteria 7046020
230 2512534617 2512047086 Bacteria 6850303
231 2512973578 2512875026 Bacteria 6861065
232 2513571604 2513237084 Bacteria 7231967
233 2513601903 2513237089 Bacteria 6553624
234 2513630178 2513237093 Bacteria 7545552
235 2513711324 2513237103 Bacteria 7647401
236 2513912352 2513237144 Bacteria 7530820
237 2513987196 2513237156 Bacteria 6402557
238 2513998461 2513237159 Bacteria 6810126
239 2514003497 2513237160 Bacteria 6650282
240 2514019374 2513237162 Bacteria 7468464
241 2515114376 2515075009 Bacteria 7288508
242 2515611046 2515154107 Bacteria 6795637
243 2515635381 2515154113 Bacteria 7807172
244 2515643212 2515154114 Bacteria 7848616
245 2515657676 2515154116 Bacteria 7552979
246 2516205559 2516143018 Bacteria 6951533
247 2517408565 2517287029 Bacteria 6905599
248 2517571418 2517487022 Bacteria 7227575
249 2524450436 2524023207 Bacteria 6813453
250 2524458441 2524023209 Bacteria 6679728
251 2537876415 2537561587 Bacteria 5425293
252 2554248842 2554235003 Bacteria 5877155
253 2558867367 2558860100 Bacteria 8458965
254 2559295930 2558860242 Bacteria 5568029
255 2561467091 2558860983 Bacteria 4133860
256 2585266966 2582581306 Bacteria 6450535
257 2585271635 2582581307 Bacteria 6597605
258 2585280698 2582581308 Bacteria 7413247
259 2585326483 2582581315 Bacteria 7318924
260 2585334175 2582581316 Bacteria 7774528
261 2585388007 2582581865 Bacteria 6644329
262 2585396634 2582581866 Bacteria 6859583
263 2585531632 2585427527 Bacteria 7273426
264 2585540752 2585427528 Bacteria 6842387
265 2585551421 2585427530 Bacteria 7383882
266 2585563125 2585427531 Bacteria 6992870
267 2585839022 2585427593 Bacteria 7141551
268 2585844893 2585427594 Bacteria 6180594
269 2585902825 2585427608 Bacteria 6544331
270 2585907343 2585427609 Bacteria 6667127
271 2585997753 2585427633 Bacteria 6413184
272 2586002337 2585427634 Bacteria 6455027
273 2587982663 2585428125 Bacteria 6662905
274 2599603279 2599185210 Bacteria 5624189
275 2599720306 2599185236 Bacteria 6875203
276 2600193347 2599185352 Bacteria 7228948
277 2616296341 2615840624 Bacteria 6557588
278 2616306757 2615840626 Bacteria 7921970
279 2616557603 2615840698 Bacteria 7319877
280 2643808045 2643221557 Bacteria 7184309
281 2644052250 2643221607 Bacteria 6314006
282 2644068766 2643221610 Bacteria 7480339
283 2644150448 2643221626 Bacteria 8069654
284 2644194850 2643221634 Bacteria 6705461
285 2644201367 2643221636 Bacteria 6583769
286 2644299908 2643221653 Bacteria 4569637
287 2644313052 2643221655 Bacteria 7722067
288 2644336600 2643221659 Bacteria 7890716
289 2644379479 2643221668 Bacteria 7306521
290 2644419836 2643221675 Bacteria 7473456
291 2644453193 2643221680 Bacteria 7473610
292 2644484528 2643221686 Bacteria 6310811
293 2644493107 2643221688 Bacteria 5260751
294 2644521508 2643221693 Bacteria 5513853
295 2644546247 2643221698 Bacteria 7756764
296 2644618782 2643221712 Bacteria 7729434
297 2644658135 2643221719 Bacteria 4568197
298 2644677073 2643221723 Bacteria 7095460
299 2644688779 2643221726 Bacteria 7455827
300 2671113499 2667528174 Bacteria 6435400
301 2692319938 2690316117 Bacteria 6800650
302 2719182937 2718217882 Bacteria 6556348
303 2719387650 2718217927 Bacteria 6972593
304 2719733654 2718218009 Bacteria 6478651
305 2721149049 2718218363 Bacteria 6524337
306 2721160447 2718218365 Bacteria 6274507
307 2721165862 2718218366 Bacteria 6425255
308 2721401284 2718218423 Bacteria 6438183
309 2722842032 2721755514 Bacteria 6424414
310 2724040098 2721755809 Bacteria 6438790
311 2724046410 2721755810 Bacteria 6479005
312 2725947511 2724679232 Bacteria 7646494
313 2730166172 2728369365 Bacteria 6555560
314 2730300079 2728369397 Bacteria 6274511
315 2738805601 2738541293 Bacteria 7065685
316 2739037249 2738541333 Bacteria 7106503
317 2753458580 2751185821 Bacteria 6189929
318 2766064294 2765235942 Bacteria 7445910
319 2776915452 2775507049 Bacteria 6284736
320 2778173727 2775507266 Bacteria 7392367
321 2792621917 2791355091 Bacteria 6135441
322 2792628826 2791355092 Bacteria 6248105
323 2792639971 2791355094 Bacteria 7011481
324 2793320685 2791355260 Bacteria 6598818
325 2793346574 2791355264 Bacteria 6429314
326 2802717215 2802428858 Bacteria 6636079
327 2802724796 2802428859 Bacteria 6667919
328 2802729547 2802428860 Bacteria 6525526
329 2802736893 2802428861 Bacteria 6534206
330 2802743298 2802428862 Bacteria 6633353
331 2802749576 2802428863 Bacteria 6410669
332 2806047340 2802429633 Bacteria 7341974
333 2806054195 2802429634 Bacteria 7083200
334 2806060221 2802429635 Bacteria 7650140
335 2806068832 2802429636 Bacteria 7597525
336 2806076438 2802429637 Bacteria 7067217
337 2808988246 2808606387 Bacteria 5697198
338 2819244691 2818991272 Bacteria 4622173
339 2819611220 2818991448 Bacteria 6772224
340 2819638851 2818991453 Bacteria 7181617
341 2819687035 2818991461 Bacteria 7026071
342 2838024042 2838022645 Bacteria 6494267
343 2838047813 2838042994 Bacteria 6046894
344 2838672137 2838668709 Bacteria 6671819
345 2838704993 2838701080 Bacteria 6669771
346 2841863197 2841859092 Bacteria 5436171
347 2842116882 2842110456 Bacteria 7656360
348 2842148771 2842146304 Bacteria 5957337
349 2842201635 2842198810 Bacteria 6608673
350 2842221752 2842217011 Bacteria 7497767
351 2842254674 2842250916 Bacteria 6579627
352 2842300302 2842298080 Bacteria 6123127
353 2842346610 2842341865 Bacteria 7003929
354 2842361180 2842357229 Bacteria 6485165
355 2842366300 2842363717 Bacteria 6844742
356 2842477641 2842475841 Bacteria 6603183
357 2842484946 2842482326 Bacteria 7212537
358 2842491137 2842489311 Bacteria 6620893
359 2842504486 2842502639 Bacteria 6604161
360 2842511734 2842509118 Bacteria 6850950
361 2842520065 2842515876 Bacteria 5436280
362 2847420838 2847417321 Bacteria 6913799
363 2848995665 2848992105 Bacteria 6810864
364 2852391671 2852387548 Bacteria 8025568
365 2854897097 2854896431 Bacteria 5869725
366 2854913954 2854911287 Bacteria 5582813
367 2854919455 2854916844 Bacteria 5725939
368 2855878202 2855872281 Bacteria 6964271
369 2857519546 2857516855 Bacteria 7787325
370 2899795297 2899792073 Bacteria 4926588
371 2899849277 2899845264 Bacteria 5672268
372 2913300178 2913295892 Bacteria 6333755
373 2916065014 2916061851 Bacteria 6737736
374 2919175816 2919171160 Bacteria 6499771
375 2919411044 2919408235 Bacteria 6149349
376 2921252938 2921250672 Bacteria 6677771
377 2926762218 2926760298 Bacteria 5505990
378 2929141845 2929138655 Bacteria 5810547
379 2933015676 2933011516 Bacteria 5439334
380 2933593114 2933586486 Bacteria 7667493
381 2936369860 2936367885 Bacteria 7324495
382 2936379047 2936375103 Bacteria 6652732
383 2936381978 2936381700 Bacteria 7006523
384 2936998968 2936996657 Bacteria 6298727
385 2937031858 2937029754 Bacteria 6424026
386 2937036211 2937036028 Bacteria 6846469
387 2937082047 2937078374 Bacteria 6610289
388 2937089985 2937084907 Bacteria 6618516
389 2957381828 2957375807 Bacteria 6425588
390 2957442087 2957437181 Bacteria 6568994
391 2960592235 2960591022 Bacteria 6622873
392 2960633401 2960631154 Bacteria 6732508
393 2960682342 2960680706 Bacteria 6624464
394 2960698232 2960693952 Bacteria 6749742
395 2967690248 2967686174 Bacteria 6678622
396 2967730825 2967728569 Bacteria 6641507
397 2970029536 2970026789 Bacteria 6785236
398 2970128930 2970122695 Bacteria 6625855
399 2970143602 2970143518 Bacteria 6446480
400 2977535082 2977530762 Bacteria 6951399
401 2977550627 2977544691 Bacteria 6875412
402 2979092512 2979089926 Bacteria 5670289
403 2979100097 2979095461 Bacteria 5669583
404 2989780050 2989776772 Bacteria 4843317
405 2996890213 2996887358 Bacteria 5795980
406 3005421646 3005416602 Bacteria 7064308
407 639650406 639633055 Bacteria 7751309
408 8004003080 8003999396 Bacteria 7063185
409 8005249194 8005246636 Bacteria 4933972
410 8005262397 8005258706 Bacteria 6184835
411 8005282405 8005275841 Bacteria 6929066
412 8005295056 8005289223 Bacteria 6634003
413 8005319650 8005314921 Bacteria 7072929
414 8005324740 8005321885 Bacteria 5795980
415 8005381595 8005376324 Bacteria 6590079
416 8005465067 8005460587 Bacteria 7157962
417 8005490273 8005484373 Bacteria 6297373
418 8005561143 8005556819 Bacteria 6908598
419 8005565769 8005563573 Bacteria 7153261
420 8005571816 8005570704 Bacteria 6957481
421 8005646929 8005645114 Bacteria 6950293
422 8005660781 8005658619 Bacteria 4500593
423 8005688010 8005682033 Bacteria 6726518
424 8005694366 8005688590 Bacteria 6610080
425 8018128883 8018127388 Bacteria 7351159
426 8018153336 8018150411 Bacteria 5549903
427 8018165119 8018163183 Bacteria 7277977
428 8018177122 8018176218 Bacteria 6896178
429 8024484342 8024479707 Bacteria 6954785
430 8046767204 8046767195 Bacteria 7547379
431 8049296291 8049293176 Bacteria 6128433
432 8056878250 8056875544 Bacteria 4355797
433 8057581590 8057575449 Bacteria 7367519
434 JGI24740J21852_10000013
435 JGI25155J39150_1000010
436 JGI25156J39149_1000102
437 JGI25162J39368_1001052
438 JGI25162J39368_1001061
439 JGI25154J39366_1000184
440 JGI25157J39369_1000009
441 JGI25159J45721_1000017
442 JGI25159J45721_1000623
443 JGI25151J46595_10011591
444 JGI25165J46597_1001126
445 JGI25165J46597_1001559
446 JGI25165J46597_1004972
447 rootH1_10046822
448 rootH1_10119709
449 JGI25160J50197_1000027
450 JGI25160J50197_1000235
451 JGI25161J50226_1000175
452 JGI25161J50226_1000533
453 Ga0055539_1016448
454 Ga0055526_1003362
455 Ga0055526_1003979
456 Ga0055524_1002526
457 Ga0055536_1001546
458 Ga0055528_1002500
459 Ga0055530_10015408
460 Ga0055530_10022537
461 Ga0055540_1001660
462 Ga0055540_1006775
463 Ga0055531_10001931
464 Ga0055531_10040610
465 Ga0058692_1008859
466 Ga0058692_1010511
467 Ga0055543_1000030
468 Ga0055543_1000226
469 Ga0065165_1000122
470 Ga0065165_1001345
471 Ga0070658_10898513
472 Ga0070670_100000116
473 Ga0070669_100035185
474 Ga0068853_100354687
475 Ga0070665_100004011
476 Ga0070665_100180333
477 Ga0068856_100116818
478 Ga0068852_100293650
479 Ga0068851_10103711
480 Ga0068860_100266357
481 Ga0075365_10007221
482 Ga0075368_10002647
483 Ga0075364_10000026
484 Ga0075367_10027467
485 Ga0075366_10153999
486 Ga0075370_10003299
487 Ga0105244_10039565
488 Ga0105240_10000013
489 Ga0105243_10017097
490 Ga0105243_10428087
491 Ga0105248_10202019
492 Ga0105237_10002248
493 Ga0105239_10000820
494 Ga0157373_10003539
495 Ga0157373_10249619
496 Ga0157371_10000108
497 Ga0157370_10002495
498 Ga0157370_10002982
499 Ga0157369_10169001
500 Ga0171463_1004
501 Ga0182008_10061204
502 Ga0182007_10016455
503 Ga0182005_1001581
504 Ga0183363_1019
505 Ga0214543_1000015
506 Ga0209435_100009
507 Ga0209436_101012
508 Ga0209672_105313
509 Ga0209437_100057
510 Ga0209437_100107
511 Ga0209437_102494
512 Ga0207425_1005362
513 Ga0209646_1000018
514 Ga0209026_1000068
515 Ga0209677_100199
516 Ga0209759_1000007
517 Ga0209233_1000072
518 Ga0209233_1000134
519 Ga0209233_1000479
520 Ga0209673_1000953
521 Ga0209130_1000027
522 Ga0209130_1000132
523 Ga0209676_1001489
524 Ga0209676_1004139
525 Ga0209025_1001410
526 Ga0209564_1000782
527 Ga0209564_1000919
528 Ga0209758_1000570
529 Ga0209050_1000572
530 Ga0209050_1009365
531 Ga0209050_1013505
532 Ga0209256_1002945
533 Ga0209256_1004473
534 Ga0209256_1026756
535 Ga0207426_1000072
536 Ga0207426_1000246
537 Ga0209051_1000917
538 Ga0209051_1001068
539 Ga0209051_1002527
540 Ga0209257_1001566
541 Ga0209257_1003132
542 Ga0209257_1004050
543 Ga0207656_10040802
544 Ga0207695_10000044
545 Ga0207671_10000400
546 Ga0207681_10053629
547 Ga0207650_10000151
548 Ga0207709_10062193
549 Ga0207639_10249329
550 Ga0207702_10091036
551 Ga0207698_10024780
552 Ga0209371_1002109
553 Ga0209371_1002474
554 Ga0209813_10004256
555 Ga0268266_10056925
556 Ga0268266_10112238
557 Ga0268256_1001864
558 Ga0307513_10001043
559 Ga0307513_10044054
560 Ga0307408_100121861
561 Ga0307408_100230226
562 Ga0307408_100261822
563 Ga0307412_10184524
564 Ga0307409_100065249
565 Ga0307416_100068211
566 Ga0373927_0000019
567 Ga0373925_0003004
568 Ga0439438_077512
569 Ga0439466_0038998
570 Ga0439449_0026675
571 Ga0466958_0398744
572 Ga0495629_0033062
573 Ga0495662_0006521
574 Ga0495606_0017834
575 Ga0495606_0019465
576 Ga0495606_0179987
577 Ga0495648_0058913
578 Ga0495652_0189479
579 Ga0495640_0208156
580 Ga0495587_0032494
581 Ga0495625_0047829
582 Ga0495588_0006440
583 Ga0495657_0039608
584 Ga0495658_0215916
585 Ga0495600_0006091
586 Ga0495604_0115224
587 Ga0495676_0335454
588 Ga0495681_0005682
589 Ga0495686_0004327
590 Ga0495686_0090632
591 Ga0495626_0073687
592 Ga0496100_0628008
593 Ga0496101_0609879
594 Ga0496102_0113186
595 Ga0496103_0013562
596 Ga0496110_0030907
597 Ga0496111_0003646
598 Ga0496112_0449706
599 Ga0496116_0012793
600 Ga0496116_0087172
601 Ga0496117_0000031
602 Ga0496117_0002097
603 Ga0496117_0010058
604 Ga0496117_0041019
605 Ga0496118_0002291
606 Ga0496118_0009274
607 Ga0496118_0134575
608 Ga0496119_0155157
609 Ga0496120_0002641
610 Ga0496120_0060679
611 Ga0496120_0246631
612 Ga0496121_0011232
613 Ga0496121_0012300
614 Ga0496121_0031691
615 Ga0496122_0000023
616 Ga0496122_0013532
617 Ga0496122_0026114
618 Ga0496122_0107399
619 Ga0496123_0000027
620 Ga0496123_0010463
621 Ga0496124_0002248
622 Ga0496124_0005858
623 Ga0496124_0041989
624 Ga0496124_0061010
625 Ga0496125_0000030
626 Ga0496125_0236306
627 Ga0496126_0414875
628 Ga0501241_011010
629 nmdc:mga03683_10923_c1
630 nmdc:mga03n38_94738_c1
631 nmdc:mga00v17_1216_c1
632 nmdc:mga00v17_151_c1
633 nmdc:mga00v17_6381_c1
634 nmdc:mga0yw44_18355_c1
635 nmdc:mga0k408_30018_c1
636 nmdc:mga06z11_16937_c1
637 nmdc:mga06z11_189692_c1
638 nmdc:mga04h51_2539_c1
639 nmdc:mga07m45_107929_c1
640 nmdc:mga0sz30_107_c1
641 Ga0495601_0186774
642 Ga0495619_0168318
643 Ga0500646_0031491
644 Ga0500560_021194
645 Ga0500608_068006
646 Ga0500618_001280
647 Ga0500652_124171
648 Ga0500655_007895
649 Ga0500559_0007005
650 Ga0500561_0000177
651 Ga0500568_0009165
652 Ga0500573_0000334
653 Ga0500590_001183
654 Ga0500616_0003388
655 8055435585
656 2509109544
657 2509378132
658 2509389437
659 2510135220
660 2510896674
661 2511133847
662 2511173058
663 2512534617
664 2512973578
665 2513571604
666 2513601903
667 2513630178
668 2513711324
669 2513912352
670 2513987196
671 2513998461
672 2514003497
673 2514019374
674 2515114376
675 2515611046
676 2515635381
677 2515643212
678 2515657676
679 2516205559
680 2517408565
681 2517571418
682 2524450436
683 2524458441
684 2537876415
685 2554248842
686 2558867367
687 2559295930
688 2561467091
689 2585266966
690 2585271635
691 2585280698
692 2585326483
693 2585334175
694 2585388007
695 2585396634
696 2585531632
697 2585540752
698 2585551421
699 2585563125
700 2585839022
701 2585844893
702 2585902825
703 2585907343
704 2585997753
705 2586002337
706 2587982663
707 2599603279
708 2599720306
709 2600193347
710 2616296341
711 2616306757
712 2616557603
713 2643808045
714 2644052250
715 2644068766
716 2644150448
717 2644194850
718 2644201367
719 2644299908
720 2644313052
721 2644336600
722 2644379479
723 2644419836
724 2644453193
725 2644484528
726 2644493107
727 2644521508
728 2644546247
729 2644618782
730 2644658135
731 2644677073
732 2644688779
733 2671113499
734 2692319938
735 2719182937
736 2719387650
737 2719733654
738 2721149049
739 2721160447
740 2721165862
741 2721401284
742 2722842032
743 2724040098
744 2724046410
745 2725947511
746 2730166172
747 2730300079
748 2738805601
749 2739037249
750 2753458580
751 2766064294
752 2776915452
753 2778173727
754 2792621917
755 2792628826
756 2792639971
757 2793320685
758 2793346574
759 2802717215
760 2802724796
761 2802729547
762 2802736893
763 2802743298
764 2802749576
765 2806047340
766 2806054195
767 2806060221
768 2806068832
769 2806076438
770 2808988246
771 2819244691
772 2819611220
773 2819638851
774 2819687035
775 2838024042
776 2838047813
777 2838672137
778 2838704993
779 2841863197
780 2842116882
781 2842148771
782 2842201635
783 2842221752
784 2842254674
785 2842300302
786 2842346610
787 2842361180
788 2842366300
789 2842477641
790 2842484946
791 2842491137
792 2842504486
793 2842511734
794 2842520065
795 2847420838
796 2848995665
797 2852391671
798 2854897097
799 2854913954
800 2854919455
801 2855878202
802 2857519546
803 2899795297
804 2899849277
805 2913300178
806 2916065014
807 2919175816
808 2919411044
809 2921252938
810 2926762218
811 2929141845
812 2933015676
813 2933593114
814 2936369860
815 2936379047
816 2936381978
817 2936998968
818 2937031858
819 2937036211
820 2937082047
821 2937089985
822 2957381828
823 2957442087
824 2960592235
825 2960633401
826 2960682342
827 2960698232
828 2967690248
829 2967730825
830 2970029536
831 2970128930
832 2970143602
833 2977535082
834 2977550627
835 2979092512
836 2979100097
837 2989780050
838 2996890213
839 3005421646
840 639650406
841 8004003080
842 8005249194
843 8005262397
844 8005282405
845 8005295056
846 8005319650
847 8005324740
848 8005381595
849 8005465067
850 8005490273
851 8005561143
852 8005565769
853 8005571816
854 8005646929
855 8005660781
856 8005688010
857 8005694366
858 8018128883
859 8018153336
860 8018165119
861 8018177122
862 8024484342
863 8046767204
864 8049296291
865 8056878250
866 8057581590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

75

243

0.87

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

78

238

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jgg-assembly2.cif.gz_B crystal structure of tesa 0.9285 31 207
1jrl-assembly1.cif.gz_A crystal structure of e. coli lysophospholiase l1/acyl-coa thioesterase i/protease i l109p mutant 0.9219 29 208
1ivn-assembly1.cif.gz_A e.coli thioesterase i/protease i/lysophospholiase l1 0.9205 29 208
1u8u-assembly1.cif.gz_A e. coli thioesterase i/protease i/lysophospholiase l1 in complexed with octanoic acid 0.9193 29 206
3hp4-assembly1.cif.gz_A crystal structure of psychrotrophic esterase esta from pseudoalteromonas sp. 643a inhibited by monoethylphosphonate 0.9191 31 208
ID Description Score Start End Superfamily
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9285 31 207 3.40.50.1110
3hp4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9191 31 208 3.40.50.1110
5tifA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9145 29 208 3.40.50.1110
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9091 31 207 3.40.50.1110
3hp4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8954 31 208 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A248UGT5-F1-model_v4 GDSL-like Lipase/Acylhydrolase family protein 0.9674 30 215 GO:0004622
AF-A0A4R2GUW8-F1-model_v4 Acyl-CoA thioesterase-1 0.9646 34 211 GO:0004622
AF-A0A840N432-F1-model_v4 Acyl-CoA thioesterase-1 (EC 3.1.1.5, EC 3.1.2.-) 0.9622 28 211 GO:0004622
AF-A0A1X7EU01-F1-model_v4 Acyl-CoA thioesterase-1 0.9599 29 211 GO:0004622
AF-A0A4R8FP46-F1-model_v4 deleted 0.9593 30 214

Map