F443121

General Info

Members Datasets Scaffolds Average Seq Length
434 249 868 269

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10190051|Ga0307405_101900512
Length 287
Sequence MSGLLRHCVPRNDDFMPELPEVETTVRGLEKVLQGRRLVRVEPRRADLRRAMPVDLGQRLTGARVTGLGRRAKYGLIETDRGDTLIFHLGMSGRWRIDPEEIGPHDHLLIESDDGHRLSLNDPRRFGSLDLVPTAEVASWPPFAVMGPEPLGDALSGAWLKQRLAGRTAAIKLMLLDQAIVAGLGNIYVCEALFRARIDPRRAAGKVSKARLDALVGAIRAVLDEAIAAGGSTLRDFARPDGELGYFSKQFDVYGREGERCRGDCGGTVKRFVQGGRSTFFCASCQR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
71 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
235 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
238 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
239 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
240 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
241 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
242 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
243 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
244 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
245 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
246 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
247 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
248 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
249 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 16.59
Nodule 0
Rhizoplane 3.69
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10190051 3300031731 Bacteria 1482
2 JGI24741J21665_1001762 3300001915 Bacteria 5953
3 JGI24738J21930_10005673 3300002075 Bacteria 2972
4 JGI24751J29686_10000093 3300002459 Bacteria 50074
5 JGI25150J39212_1000465 3300002774 Bacteria 17717
6 JGI25151J46595_10029422 3300003187 Bacteria 2175
7 JGI25153J46596_10000029 3300003215 Bacteria 201658
8 Ga0055525_1000063 3300003759 Bacteria 198877
9 Ga0055525_1000064 3300003759 Bacteria 198750
10 Ga0055542_1000795 3300003762 Bacteria 23364
11 Ga0055542_1001337 3300003762 Bacteria 12843
12 Ga0055529_1000037 3300003763 Bacteria 237307
13 Ga0055526_1016035 3300003771 Bacteria 2966
14 Ga0055537_1003251 3300003773 Bacteria 5061
15 Ga0055524_1000410 3300003775 Bacteria 36259
16 Ga0055536_1014951 3300003781 Bacteria 2686
17 Ga0055530_10039588 3300003791 Bacteria 1163
18 Ga0055530_10040380 3300003791 Bacteria 1146
19 Ga0055540_1007633 3300003792 Bacteria 4039
20 Ga0055531_10020213 3300003794 Bacteria 2648
21 Ga0055531_10048253 3300003794 Bacteria 1150
22 Ga0055531_10048820 3300003794 Bacteria 1137
23 Ga0055543_1032020 3300004625 Bacteria 915
24 Ga0065165_1002223 3300005262 Bacteria 17324
25 Ga0065165_1005559 3300005262 Bacteria 7010
26 Ga0065165_1029801 3300005262 Bacteria 1744
27 Ga0065165_1065476 3300005262 Bacteria 980
28 Ga0070658_10000703 3300005327 Bacteria 29018
29 Ga0070658_10011480 3300005327 Bacteria 7104
30 Ga0070676_10042902 3300005328 Bacteria 2628
31 Ga0070676_10115907 3300005328 Bacteria 1675
32 Ga0070683_100497055 3300005329 Bacteria 1165
33 Ga0070670_100000005 3300005331 Bacteria 351569
34 Ga0070670_100040533 3300005331 Bacteria 4003
35 Ga0070670_100077904 3300005331 Bacteria 2848
36 Ga0070677_10052631 3300005333 Bacteria 1653
37 Ga0070666_10000476 3300005335 Bacteria 24221
38 Ga0070666_10080120 3300005335 Bacteria 2231
39 Ga0070680_100108767 3300005336 Bacteria 2306
40 Ga0070660_100001294 3300005339 Bacteria 17036
41 Ga0070660_100017915 3300005339 Bacteria 5167
42 Ga0070660_100119026 3300005339 Bacteria 2106
43 Ga0070660_100363056 3300005339 Bacteria 1194
44 Ga0070661_100014887 3300005344 Bacteria 5488
45 Ga0070661_100253939 3300005344 Bacteria 1357
46 Ga0070692_10025731 3300005345 Bacteria 2903
47 Ga0070692_10043587 3300005345 Bacteria 2308
48 Ga0070668_100000064 3300005347 Bacteria 65793
49 Ga0070668_100019555 3300005347 Bacteria 5097
50 Ga0070668_100091317 3300005347 Bacteria 2401
51 Ga0070669_100000096 3300005353 Bacteria 86930
52 Ga0070669_100000195 3300005353 Bacteria 53791
53 Ga0070675_100079591 3300005354 Bacteria 2731
54 Ga0070675_100142068 3300005354 Bacteria 2052
55 Ga0070671_100000045 3300005355 Bacteria 85779
56 Ga0070671_100017281 3300005355 Bacteria 5841
57 Ga0070674_100004401 3300005356 Bacteria 8030
58 Ga0070674_100010366 3300005356 Bacteria 5630
59 Ga0070673_100062226 3300005364 Bacteria 2965
60 Ga0070659_100000001 3300005366 Bacteria 576390
61 Ga0070659_100021220 3300005366 Bacteria 4941
62 Ga0070667_100000003 3300005367 Bacteria 447715
63 Ga0070667_100011334 3300005367 Bacteria 7374
64 Ga0070678_100007825 3300005456 Bacteria 6358
65 Ga0070662_100556418 3300005457 Bacteria 962
66 Ga0070681_10012624 3300005458 Bacteria 8380
67 Ga0070681_10100038 3300005458 Bacteria 2845
68 Ga0068867_100261624 3300005459 Bacteria 1411
69 Ga0070679_100407306 3300005530 Bacteria 1306
70 Ga0068853_100029337 3300005539 Bacteria 4636
71 Ga0068853_100094074 3300005539 Bacteria 2640
72 Ga0068853_100208329 3300005539 Bacteria 1781
73 Ga0070672_100080105 3300005543 Bacteria 2616
74 Ga0070686_100178733 3300005544 Bacteria 1506
75 Ga0070665_100000023 3300005548 Bacteria 375278
76 Ga0068854_100017271 3300005578 Bacteria 4826
77 Ga0068854_100037586 3300005578 Bacteria 3399
78 Ga0068854_100049025 3300005578 Bacteria 3015
79 Ga0068854_100057690 3300005578 Bacteria 2801
80 Ga0068856_100030557 3300005614 Bacteria 5265
81 Ga0068852_100071772 3300005616 Bacteria 3041
82 Ga0068852_100078536 3300005616 Bacteria 2920
83 Ga0068859_100000162 3300005617 Bacteria 65033
84 Ga0068859_100020051 3300005617 Bacteria 6714
85 Ga0068859_100028071 3300005617 Bacteria 5643
86 Ga0068859_100132544 3300005617 Bacteria 2564
87 Ga0068864_100000011 3300005618 Bacteria 350056
88 Ga0068864_100000677 3300005618 Bacteria 28506
89 Ga0068864_100004457 3300005618 Bacteria 11506
90 Ga0068861_100003029 3300005719 Bacteria 11100
91 Ga0068861_100004554 3300005719 Bacteria 9307
92 Ga0068861_100079246 3300005719 Bacteria 2567
93 Ga0068851_10038323 3300005834 Bacteria 2404
94 Ga0068863_100000784 3300005841 Bacteria 31931
95 Ga0068863_100028056 3300005841 Bacteria 5374
96 Ga0068863_100173482 3300005841 Bacteria 2069
97 Ga0068858_100000112 3300005842 Bacteria 86034
98 Ga0068858_100000892 3300005842 Bacteria 30965
99 Ga0068858_100002314 3300005842 Bacteria 19259
100 Ga0068860_100000045 3300005843 Bacteria 223252
101 Ga0068860_100004945 3300005843 Bacteria 13583
102 Ga0068862_100000011 3300005844 Bacteria 270105
103 Ga0068862_100000385 3300005844 Bacteria 47562
104 Ga0068862_100001387 3300005844 Bacteria 22482
105 Ga0068862_100007339 3300005844 Bacteria 9155
106 Ga0075432_10003913 3300006058 Bacteria 5072
107 Ga0075366_10028114 3300006195 Bacteria 3299
108 Ga0075366_10331383 3300006195 Bacteria 933
109 Ga0097620_100000162 3300006931 Bacteria 65033
110 Ga0097620_100020051 3300006931 Bacteria 6714
111 Ga0097620_100028069 3300006931 Bacteria 5643
112 Ga0097620_100132551 3300006931 Bacteria 2564
113 Ga0097620_100239520 3300006931 Bacteria 1903
114 Ga0105240_10314199 3300009093 Bacteria 1788
115 Ga0105245_10005071 3300009098 Bacteria 11578
116 Ga0105245_10013733 3300009098 Bacteria 7053
117 Ga0105247_10001548 3300009101 Bacteria 16396
118 Ga0105247_10436528 3300009101 Bacteria 941
119 Ga0105243_10000221 3300009148 Bacteria 66335
120 Ga0105241_10017028 3300009174 Bacteria 5335
121 Ga0105248_10000069 3300009177 Bacteria 120989
122 Ga0105248_10071990 3300009177 Bacteria 3885
123 Ga0105248_10105410 3300009177 Bacteria 3178
124 Ga0105237_10002971 3300009545 Bacteria 20505
125 Ga0105238_10655848 3300009551 Bacteria 1060
126 Ga0105249_10016302 3300009553 Bacteria 6590
127 Ga0105249_10874683 3300009553 Bacteria 965
128 Ga0157324_1001555 3300012506 Bacteria 1283
129 Ga0157326_1000018 3300012513 Bacteria 14715
130 Ga0157373_10058985 3300013100 Bacteria 2720
131 Ga0157371_10000256 3300013102 Bacteria 73768
132 Ga0157369_10242641 3300013105 Bacteria 1882
133 Ga0157369_10454584 3300013105 Bacteria 1326
134 Ga0157374_10151118 3300013296 Bacteria 2258
135 Ga0157378_10046547 3300013297 Bacteria 3856
136 Ga0157378_10051333 3300013297 Bacteria 3670
137 Ga0163162_10000823 3300013306 Bacteria 28858
138 Ga0163162_10290213 3300013306 Bacteria 1768
139 Ga0157372_10218242 3300013307 Bacteria 2211
140 Ga0157380_10000700 3300014326 Bacteria 20898
141 Ga0157379_10011118 3300014968 Bacteria 7849
142 Ga0163161_10062921 3300017792 Bacteria 2703
143 Ga0213875_10000105 3300021388 Bacteria 96051
144 Ga0213875_10008584 3300021388 Bacteria 5221
145 Ga0209674_109055 3300025226 Bacteria 1131
146 Ga0209563_100066 3300025230 Bacteria 257382
147 Ga0207425_1000041 3300025245 Bacteria 210441
148 Ga0207425_1011379 3300025245 Bacteria 2126
149 Ga0209148_1000011 3300025254 Bacteria 1196503
150 Ga0209129_1001272 3300025258 Bacteria 14424
151 Ga0209233_1017631 3300025261 Bacteria 1941
152 Ga0209565_1000008 3300025263 Bacteria 774179
153 Ga0209565_1000755 3300025263 Bacteria 19012
154 Ga0209455_1000006 3300025272 Bacteria 1196503
155 Ga0209673_1012801 3300025273 Bacteria 3354
156 Ga0209673_1013903 3300025273 Bacteria 3150
157 Ga0209675_1015297 3300025291 Bacteria 2288
158 Ga0209676_1013302 3300025292 Bacteria 3173
159 Ga0209676_1047606 3300025292 Bacteria 1152
160 Ga0209025_1000654 3300025294 Bacteria 60452
161 Ga0209564_1000565 3300025295 Bacteria 58712
162 Ga0209564_1037228 3300025295 Bacteria 1375
163 Ga0209758_1000004 3300025297 Bacteria 1375322
164 Ga0209758_1000017 3300025297 Bacteria 754393
165 Ga0209050_1000001 3300025298 Bacteria 3563507
166 Ga0209050_1010220 3300025298 Bacteria 4656
167 Ga0209050_1017968 3300025298 Bacteria 2781
168 Ga0209256_1000009 3300025299 Bacteria 922071
169 Ga0209256_1000010 3300025299 Bacteria 912110
170 Ga0209051_1000475 3300025303 Bacteria 52139
171 Ga0209257_1008341 3300025304 Bacteria 5923
172 Ga0209257_1008364 3300025304 Bacteria 5906
173 Ga0207697_10001562 3300025315 Bacteria 12366
174 Ga0207656_10012961 3300025321 Bacteria 3175
175 Ga0207682_10080950 3300025893 Bacteria 1392
176 Ga0207710_10061207 3300025900 Bacteria 1708
177 Ga0207688_10068880 3300025901 Bacteria 2005
178 Ga0207680_10000156 3300025903 Bacteria 33323
179 Ga0207680_10060831 3300025903 Bacteria 2301
180 Ga0207645_10082984 3300025907 Bacteria 2055
181 Ga0207705_10000513 3300025909 Bacteria 33021
182 Ga0207705_10011704 3300025909 Bacteria 6338
183 Ga0207705_10024244 3300025909 Bacteria 4330
184 Ga0207654_10004906 3300025911 Bacteria 6773
185 Ga0207707_10401823 3300025912 Bacteria 1176
186 Ga0207707_10484615 3300025912 Bacteria 1056
187 Ga0207695_10047824 3300025913 Bacteria 4523
188 Ga0207671_10001071 3300025914 Bacteria 33222
189 Ga0207671_10012983 3300025914 Bacteria 6663
190 Ga0207660_10041911 3300025917 Bacteria 3211
191 Ga0207660_10121560 3300025917 Bacteria 1978
192 Ga0207657_10000504 3300025919 Bacteria 41239
193 Ga0207657_10001645 3300025919 Bacteria 24085
194 Ga0207657_10002900 3300025919 Bacteria 18411
195 Ga0207657_10006411 3300025919 Bacteria 12208
196 Ga0207657_10034797 3300025919 Bacteria 4524
197 Ga0207649_10057685 3300025920 Bacteria 2428
198 Ga0207652_10089687 3300025921 Bacteria 2700
199 Ga0207652_10094189 3300025921 Bacteria 2637
200 Ga0207681_10000001 3300025923 Bacteria 1105841
201 Ga0207681_10000030 3300025923 Bacteria 173766
202 Ga0207681_10262860 3300025923 Bacteria 1352
203 Ga0207681_10437168 3300025923 Bacteria 1062
204 Ga0207694_10038386 3300025924 Bacteria 3682
205 Ga0207650_10000018 3300025925 Bacteria 352120
206 Ga0207650_10004846 3300025925 Bacteria 9193
207 Ga0207650_10057726 3300025925 Bacteria 2888
208 Ga0207659_10058902 3300025926 Bacteria 2759
209 Ga0207659_10117749 3300025926 Bacteria 2031
210 Ga0207659_10168015 3300025926 Bacteria 1728
211 Ga0207687_10016745 3300025927 Bacteria 4819
212 Ga0207687_10051979 3300025927 Bacteria 2858
213 Ga0207644_10000017 3300025931 Bacteria 177818
214 Ga0207644_10088561 3300025931 Bacteria 2302
215 Ga0207690_10000018 3300025932 Bacteria 238992
216 Ga0207690_10015155 3300025932 Bacteria 4668
217 Ga0207690_10034872 3300025932 Bacteria 3245
218 Ga0207706_10028490 3300025933 Bacteria 4988
219 Ga0207709_10000078 3300025935 Bacteria 169141
220 Ga0207669_10000020 3300025937 Bacteria 105051
221 Ga0207669_10003084 3300025937 Bacteria 7176
222 Ga0207691_10092889 3300025940 Bacteria 2702
223 Ga0207711_10021763 3300025941 Bacteria 5354
224 Ga0207711_10032762 3300025941 Bacteria 4395
225 Ga0207661_10214840 3300025944 Bacteria 1697
226 Ga0207667_10000002 3300025949 Bacteria 895662
227 Ga0207668_10000030 3300025972 Bacteria 122797
228 Ga0207668_10000620 3300025972 Bacteria 22083
229 Ga0207668_10003547 3300025972 Bacteria 9173
230 Ga0207668_10018106 3300025972 Bacteria 4426
231 Ga0207668_10056000 3300025972 Bacteria 2744
232 Ga0207668_10221113 3300025972 Bacteria 1521
233 Ga0207640_10013334 3300025981 Bacteria 4706
234 Ga0207640_10025277 3300025981 Bacteria 3592
235 Ga0207640_10063924 3300025981 Bacteria 2448
236 Ga0207658_10000002 3300025986 Bacteria 1364188
237 Ga0207658_10000350 3300025986 Bacteria 45928
238 Ga0207658_10012120 3300025986 Bacteria 5879
239 Ga0207658_10129351 3300025986 Bacteria 2026
240 Ga0207677_10000013 3300026023 Bacteria 186519
241 Ga0207703_10000358 3300026035 Bacteria 49140
242 Ga0207703_10003384 3300026035 Bacteria 13391
243 Ga0207703_10009901 3300026035 Bacteria 7478
244 Ga0207639_10002135 3300026041 Bacteria 13313
245 Ga0207639_10005755 3300026041 Bacteria 8392
246 Ga0207639_10039066 3300026041 Bacteria 3534
247 Ga0207639_10120019 3300026041 Bacteria 2159
248 Ga0207678_10006261 3300026067 Bacteria 10569
249 Ga0207702_10012593 3300026078 Bacteria 7039
250 Ga0207641_10000720 3300026088 Bacteria 35557
251 Ga0207641_10001779 3300026088 Bacteria 20758
252 Ga0207641_10006993 3300026088 Bacteria 9441
253 Ga0207641_10014895 3300026088 Bacteria 6375
254 Ga0207676_10000004 3300026095 Bacteria 725417
255 Ga0207676_10001237 3300026095 Bacteria 19005
256 Ga0207676_10003709 3300026095 Bacteria 10800
257 Ga0207674_10010604 3300026116 Bacteria 10425
258 Ga0207675_100000221 3300026118 Bacteria 53325
259 Ga0207675_100004956 3300026118 Bacteria 12833
260 Ga0207675_100061325 3300026118 Bacteria 3511
261 Ga0207683_10001150 3300026121 Bacteria 24080
262 Ga0207683_10145831 3300026121 Bacteria 2134
263 Ga0207698_10018394 3300026142 Bacteria 4760
264 Ga0268266_10000002 3300028379 Bacteria 3059047
265 Ga0268265_10000002 3300028380 Bacteria 1035381
266 Ga0268265_10000074 3300028380 Bacteria 127599
267 Ga0268265_10000469 3300028380 Bacteria 42727
268 Ga0268265_10008631 3300028380 Bacteria 6887
269 Ga0268264_10000101 3300028381 Bacteria 225109
270 Ga0268264_10000215 3300028381 Bacteria 113994
271 Ga0307513_10042610 3300031456 Bacteria 4996
272 Ga0307408_100016701 3300031548 Bacteria 4906
273 Ga0307408_100298559 3300031548 Bacteria 1348
274 Ga0316576_10075158 3300031727 Bacteria 2499
275 Ga0307413_10034689 3300031824 Bacteria 2886
276 Ga0307413_10088682 3300031824 Bacteria 2007
277 Ga0307413_10258151 3300031824 Bacteria 1297
278 Ga0307410_10090984 3300031852 Bacteria 2165
279 Ga0307410_10096887 3300031852 Bacteria 2106
280 Ga0307406_10235274 3300031901 Bacteria 1370
281 Ga0307406_10244978 3300031901 Bacteria 1347
282 Ga0307412_10003432 3300031911 Bacteria 8806
283 Ga0307412_10025800 3300031911 Bacteria 3644
284 Ga0307412_10031934 3300031911 Bacteria 3330
285 Ga0307412_10052199 3300031911 Bacteria 2706
286 Ga0307409_100027886 3300031995 Bacteria 4011
287 Ga0307409_100141095 3300031995 Bacteria 2076
288 Ga0307409_100435612 3300031995 Bacteria 1261
289 Ga0307409_100460047 3300031995 Bacteria 1230
290 Ga0307416_100059138 3300032002 Bacteria 3112
291 Ga0307416_100111409 3300032002 Bacteria 2413
292 Ga0307416_100166410 3300032002 Bacteria 2046
293 Ga0307416_100307108 3300032002 Bacteria 1580
294 Ga0307414_10026412 3300032004 Bacteria 3737
295 Ga0307414_10084992 3300032004 Bacteria 2329
296 Ga0307414_10091650 3300032004 Bacteria 2259
297 Ga0307414_10164329 3300032004 Bacteria 1767
298 Ga0307414_10201109 3300032004 Bacteria 1620
299 Ga0307411_10024284 3300032005 Bacteria 3610
300 Ga0307411_10024975 3300032005 Bacteria 3571
301 Ga0307411_10134579 3300032005 Bacteria 1812
302 Ga0307411_10213253 3300032005 Bacteria 1492
303 Ga0307415_100029147 3300032126 Bacteria 3523
304 Ga0307415_100194228 3300032126 Bacteria 1604
305 Ga0316584_0196193 3300036712 Bacteria 1491
306 Ga0395899_0000287 3300037312 Bacteria 64885
307 Ga0395899_0036920 3300037312 Bacteria 3664
308 Ga0395900_0000031 3300037418 Bacteria 262393
309 Ga0395900_1012086 3300037418 Bacteria 750
310 Ga0395905_0159596 3300037471 Bacteria 2120
311 Ga0395905_0208768 3300037471 Bacteria 1830
312 Ga0395905_0800343 3300037471 Bacteria 845
313 Ga0436364_0184827 3300037853 Bacteria 146498
314 Ga0436364_0393449 3300037853 Bacteria 15268
315 Ga0395901_0000035 3300038443 Bacteria 223888
316 Ga0395901_0785287 3300038443 Bacteria 942
317 Ga0436363_1197184 3300039450 Bacteria 1365
318 Ga0439431_0052130 3300041997 Bacteria 1062
319 Ga0466963_0004653 3300044694 Bacteria 8005
320 Ga0466963_0214661 3300044694 Bacteria 1347
321 Ga0466963_0386784 3300044694 Bacteria 986
322 Ga0466957_0371265 3300044842 Bacteria 974
323 Ga0466958_0054518 3300045836 Bacteria 2425
324 Ga0466967_0073170 3300045976 Bacteria 3074
325 Ga0466967_0135671 3300045976 Bacteria 2288
326 Ga0495617_006544 3300046452 Bacteria 4079
327 Ga0495650_0000172 3300046471 Bacteria 142776
328 Ga0495584_0079864 3300046491 Bacteria 1646
329 Ga0495585_0027930 3300046492 Bacteria 3220
330 Ga0495585_0119642 3300046492 Bacteria 1394
331 Ga0495585_0175580 3300046492 Bacteria 1104
332 Ga0495583_0002048 3300046506 Bacteria 18294
333 Ga0495583_0004847 3300046506 Bacteria 9408
334 Ga0495583_0011033 3300046506 Bacteria 5210
335 Ga0495631_0158880 3300046518 Bacteria 970
336 Ga0495632_0100441 3300046519 Bacteria 1364
337 Ga0495643_0017797 3300046522 Bacteria 4145
338 Ga0495648_0000249 3300046524 Bacteria 60793
339 Ga0495663_0001306 3300046525 Bacteria 7894
340 Ga0495666_0068554 3300046526 Bacteria 1689
341 Ga0495587_0198068 3300046536 Bacteria 1136
342 Ga0495622_0019534 3300046557 Bacteria 3154
343 Ga0495668_0000080 3300046616 Bacteria 157259
344 Ga0495668_0017868 3300046616 Bacteria 4109
345 Ga0495625_0000541 3300046660 Bacteria 55446
346 Ga0495625_0179937 3300046660 Bacteria 1407
347 Ga0495661_0016849 3300046665 Bacteria 4831
348 Ga0495669_0000011 3300046684 Bacteria 158720
349 Ga0495649_0201673 3300046694 Bacteria 1033
350 Ga0495683_0019425 3300047323 Bacteria 3507
351 Ga0495687_000082 3300047443 Bacteria 147137
352 Ga0495687_002094 3300047443 Bacteria 16772
353 Ga0495677_0006435 3300047445 Bacteria 4439
354 Ga0495681_0005821 3300047470 Bacteria 8188
355 Ga0495681_0024906 3300047470 Bacteria 3139
356 Ga0495686_0163232 3300047472 Bacteria 1300
357 Ga0496102_0000034 3300048905 Bacteria 213826
358 Ga0496102_0000471 3300048905 Bacteria 44758
359 Ga0496102_0069336 3300048905 Bacteria 3237
360 Ga0496103_0000026 3300048906 Bacteria 213826
361 Ga0496103_0000166 3300048906 Bacteria 69117
362 Ga0496104_0010654 3300048907 Bacteria 8217
363 Ga0496105_0003221 3300048908 Bacteria 12024
364 Ga0496105_0211386 3300048908 Bacteria 1581
365 Ga0496109_0096519 3300048912 Bacteria 2739
366 Ga0496110_0101023 3300048913 Bacteria 2585
367 Ga0496111_0037863 3300048914 Bacteria 3453
368 Ga0496114_0076871 3300048917 Bacteria 2814
369 Ga0496115_0000030 3300048918 Bacteria 138328
370 Ga0496115_0000390 3300048918 Bacteria 36134
371 Ga0496116_0006531 3300048919 Bacteria 10566
372 Ga0496116_0010032 3300048919 Bacteria 7989
373 Ga0496117_0000072 3300048920 Bacteria 238366
374 Ga0496117_0000142 3300048920 Bacteria 157953
375 Ga0496117_0014014 3300048920 Bacteria 6938
376 Ga0496117_0020049 3300048920 Bacteria 5468
377 Ga0496118_0000030 3300048921 Bacteria 339946
378 Ga0496118_0000115 3300048921 Bacteria 146533
379 Ga0496118_0004303 3300048921 Bacteria 17009
380 Ga0496119_0059672 3300048922 Bacteria 2290
381 Ga0496120_0072884 3300048923 Bacteria 1881
382 Ga0496120_0100512 3300048923 Bacteria 1529
383 Ga0496121_0000104 3300048924 Bacteria 192186
384 Ga0496121_0000193 3300048924 Bacteria 136526
385 Ga0496122_0043264 3300048925 Bacteria 3531
386 Ga0496123_0028176 3300048926 Bacteria 4165
387 Ga0496123_0212985 3300048926 Bacteria 980
388 Ga0496124_0000061 3300048927 Bacteria 238225
389 Ga0496124_0000071 3300048927 Bacteria 220642
390 Ga0496124_0000146 3300048927 Bacteria 146468
391 Ga0496124_0055280 3300048927 Bacteria 3355
392 Ga0496124_0163651 3300048927 Bacteria 1731
393 Ga0496124_0177346 3300048927 Bacteria 1643
394 Ga0496125_0003343 3300048928 Bacteria 19548
395 Ga0496126_0000174 3300048929 Bacteria 146468
396 Ga0501032_0122302 3300049569 Bacteria 1720
397 Ga0501038_0046077 3300049574 Bacteria 3782
398 Ga0501043_0061428 3300049579 Bacteria 2951
399 Ga0501047_0014341 3300049581 Bacteria 7535
400 Ga0501249_000536 3300049679 Bacteria 9134
401 Ga0501268_024578 3300049765 Bacteria 1053
402 Ga0501044_0046060 3300049823 Bacteria 4517
403 Ga0501204_005365 3300049850 Bacteria 1404
404 nmdc:mga0k408_109619_c1 3300050493 Bacteria 1631
405 nmdc:mga0k408_63030_c1 3300050493 Bacteria 2156
406 Ga0500610_0000413 3300053079 Bacteria 13122
407 Ga0500643_004336 3300053087 Bacteria 6467
408 Ga0500643_034058 3300053087 Bacteria 1536
409 Ga0500643_039988 3300053087 Bacteria 1383
410 Ga0500592_018666 3300053116 Bacteria 1113
411 Ga0500595_001555 3300053119 Bacteria 12143
412 Ga0500618_003530 3300053125 Bacteria 5325
413 Ga0500642_0001088 3300053130 Bacteria 7802
414 Ga0500559_0017236 3300053136 Bacteria 3050
415 Ga0500559_0044675 3300053136 Bacteria 1938
416 Ga0500568_0026030 3300053139 Bacteria 2459
417 Ga0500577_0025971 3300053142 Bacteria 1988
418 Ga0500588_0068779 3300053146 Bacteria 1155
419 Ga0500619_037962 3300053154 Bacteria 1507
420 Ga0500624_000060 3300053157 Bacteria 68534
421 Ga0500645_000001 3300053730 Bacteria 455558
422 Ga0500596_004764 3300053735 Bacteria 2454
423 2585260476 2582581305 Bacteria 4895574
424 2600201659 2599185354 Bacteria 4398675
425 2600225314 2599185359 Bacteria 4772316
426 2644037534 2643221605 Bacteria 4772303
427 2819713583 2818991466 Bacteria 4748179
428 2879166298 2879163058 Bacteria 4223965
429 2885430423 2885429604 Bacteria 3642894
430 2896430595 2896429255 Bacteria 2557483
431 2928530115 2928526807 Bacteria 4760224
432 2928969698 2928968154 Bacteria 4633371
433 2990265857 2990265787 Bacteria 3943888
434 2993696352 2993693658 Bacteria 4040749
435 Ga0307405_10190051
436 JGI24741J21665_1001762
437 JGI24738J21930_10005673
438 JGI24751J29686_10000093
439 JGI25150J39212_1000465
440 JGI25151J46595_10029422
441 JGI25153J46596_10000029
442 Ga0055525_1000063
443 Ga0055525_1000064
444 Ga0055542_1000795
445 Ga0055542_1001337
446 Ga0055529_1000037
447 Ga0055526_1016035
448 Ga0055537_1003251
449 Ga0055524_1000410
450 Ga0055536_1014951
451 Ga0055530_10039588
452 Ga0055530_10040380
453 Ga0055540_1007633
454 Ga0055531_10020213
455 Ga0055531_10048253
456 Ga0055531_10048820
457 Ga0055543_1032020
458 Ga0065165_1002223
459 Ga0065165_1005559
460 Ga0065165_1029801
461 Ga0065165_1065476
462 Ga0070658_10000703
463 Ga0070658_10011480
464 Ga0070676_10042902
465 Ga0070676_10115907
466 Ga0070683_100497055
467 Ga0070670_100000005
468 Ga0070670_100040533
469 Ga0070670_100077904
470 Ga0070677_10052631
471 Ga0070666_10000476
472 Ga0070666_10080120
473 Ga0070680_100108767
474 Ga0070660_100001294
475 Ga0070660_100017915
476 Ga0070660_100119026
477 Ga0070660_100363056
478 Ga0070661_100014887
479 Ga0070661_100253939
480 Ga0070692_10025731
481 Ga0070692_10043587
482 Ga0070668_100000064
483 Ga0070668_100019555
484 Ga0070668_100091317
485 Ga0070669_100000096
486 Ga0070669_100000195
487 Ga0070675_100079591
488 Ga0070675_100142068
489 Ga0070671_100000045
490 Ga0070671_100017281
491 Ga0070674_100004401
492 Ga0070674_100010366
493 Ga0070673_100062226
494 Ga0070659_100000001
495 Ga0070659_100021220
496 Ga0070667_100000003
497 Ga0070667_100011334
498 Ga0070678_100007825
499 Ga0070662_100556418
500 Ga0070681_10012624
501 Ga0070681_10100038
502 Ga0068867_100261624
503 Ga0070679_100407306
504 Ga0068853_100029337
505 Ga0068853_100094074
506 Ga0068853_100208329
507 Ga0070672_100080105
508 Ga0070686_100178733
509 Ga0070665_100000023
510 Ga0068854_100017271
511 Ga0068854_100037586
512 Ga0068854_100049025
513 Ga0068854_100057690
514 Ga0068856_100030557
515 Ga0068852_100071772
516 Ga0068852_100078536
517 Ga0068859_100000162
518 Ga0068859_100020051
519 Ga0068859_100028071
520 Ga0068859_100132544
521 Ga0068864_100000011
522 Ga0068864_100000677
523 Ga0068864_100004457
524 Ga0068861_100003029
525 Ga0068861_100004554
526 Ga0068861_100079246
527 Ga0068851_10038323
528 Ga0068863_100000784
529 Ga0068863_100028056
530 Ga0068863_100173482
531 Ga0068858_100000112
532 Ga0068858_100000892
533 Ga0068858_100002314
534 Ga0068860_100000045
535 Ga0068860_100004945
536 Ga0068862_100000011
537 Ga0068862_100000385
538 Ga0068862_100001387
539 Ga0068862_100007339
540 Ga0075432_10003913
541 Ga0075366_10028114
542 Ga0075366_10331383
543 Ga0097620_100000162
544 Ga0097620_100020051
545 Ga0097620_100028069
546 Ga0097620_100132551
547 Ga0097620_100239520
548 Ga0105240_10314199
549 Ga0105245_10005071
550 Ga0105245_10013733
551 Ga0105247_10001548
552 Ga0105247_10436528
553 Ga0105243_10000221
554 Ga0105241_10017028
555 Ga0105248_10000069
556 Ga0105248_10071990
557 Ga0105248_10105410
558 Ga0105237_10002971
559 Ga0105238_10655848
560 Ga0105249_10016302
561 Ga0105249_10874683
562 Ga0157324_1001555
563 Ga0157326_1000018
564 Ga0157373_10058985
565 Ga0157371_10000256
566 Ga0157369_10242641
567 Ga0157369_10454584
568 Ga0157374_10151118
569 Ga0157378_10046547
570 Ga0157378_10051333
571 Ga0163162_10000823
572 Ga0163162_10290213
573 Ga0157372_10218242
574 Ga0157380_10000700
575 Ga0157379_10011118
576 Ga0163161_10062921
577 Ga0213875_10000105
578 Ga0213875_10008584
579 Ga0209674_109055
580 Ga0209563_100066
581 Ga0207425_1000041
582 Ga0207425_1011379
583 Ga0209148_1000011
584 Ga0209129_1001272
585 Ga0209233_1017631
586 Ga0209565_1000008
587 Ga0209565_1000755
588 Ga0209455_1000006
589 Ga0209673_1012801
590 Ga0209673_1013903
591 Ga0209675_1015297
592 Ga0209676_1013302
593 Ga0209676_1047606
594 Ga0209025_1000654
595 Ga0209564_1000565
596 Ga0209564_1037228
597 Ga0209758_1000004
598 Ga0209758_1000017
599 Ga0209050_1000001
600 Ga0209050_1010220
601 Ga0209050_1017968
602 Ga0209256_1000009
603 Ga0209256_1000010
604 Ga0209051_1000475
605 Ga0209257_1008341
606 Ga0209257_1008364
607 Ga0207697_10001562
608 Ga0207656_10012961
609 Ga0207682_10080950
610 Ga0207710_10061207
611 Ga0207688_10068880
612 Ga0207680_10000156
613 Ga0207680_10060831
614 Ga0207645_10082984
615 Ga0207705_10000513
616 Ga0207705_10011704
617 Ga0207705_10024244
618 Ga0207654_10004906
619 Ga0207707_10401823
620 Ga0207707_10484615
621 Ga0207695_10047824
622 Ga0207671_10001071
623 Ga0207671_10012983
624 Ga0207660_10041911
625 Ga0207660_10121560
626 Ga0207657_10000504
627 Ga0207657_10001645
628 Ga0207657_10002900
629 Ga0207657_10006411
630 Ga0207657_10034797
631 Ga0207649_10057685
632 Ga0207652_10089687
633 Ga0207652_10094189
634 Ga0207681_10000001
635 Ga0207681_10000030
636 Ga0207681_10262860
637 Ga0207681_10437168
638 Ga0207694_10038386
639 Ga0207650_10000018
640 Ga0207650_10004846
641 Ga0207650_10057726
642 Ga0207659_10058902
643 Ga0207659_10117749
644 Ga0207659_10168015
645 Ga0207687_10016745
646 Ga0207687_10051979
647 Ga0207644_10000017
648 Ga0207644_10088561
649 Ga0207690_10000018
650 Ga0207690_10015155
651 Ga0207690_10034872
652 Ga0207706_10028490
653 Ga0207709_10000078
654 Ga0207669_10000020
655 Ga0207669_10003084
656 Ga0207691_10092889
657 Ga0207711_10021763
658 Ga0207711_10032762
659 Ga0207661_10214840
660 Ga0207667_10000002
661 Ga0207668_10000030
662 Ga0207668_10000620
663 Ga0207668_10003547
664 Ga0207668_10018106
665 Ga0207668_10056000
666 Ga0207668_10221113
667 Ga0207640_10013334
668 Ga0207640_10025277
669 Ga0207640_10063924
670 Ga0207658_10000002
671 Ga0207658_10000350
672 Ga0207658_10012120
673 Ga0207658_10129351
674 Ga0207677_10000013
675 Ga0207703_10000358
676 Ga0207703_10003384
677 Ga0207703_10009901
678 Ga0207639_10002135
679 Ga0207639_10005755
680 Ga0207639_10039066
681 Ga0207639_10120019
682 Ga0207678_10006261
683 Ga0207702_10012593
684 Ga0207641_10000720
685 Ga0207641_10001779
686 Ga0207641_10006993
687 Ga0207641_10014895
688 Ga0207676_10000004
689 Ga0207676_10001237
690 Ga0207676_10003709
691 Ga0207674_10010604
692 Ga0207675_100000221
693 Ga0207675_100004956
694 Ga0207675_100061325
695 Ga0207683_10001150
696 Ga0207683_10145831
697 Ga0207698_10018394
698 Ga0268266_10000002
699 Ga0268265_10000002
700 Ga0268265_10000074
701 Ga0268265_10000469
702 Ga0268265_10008631
703 Ga0268264_10000101
704 Ga0268264_10000215
705 Ga0307513_10042610
706 Ga0307408_100016701
707 Ga0307408_100298559
708 Ga0316576_10075158
709 Ga0307413_10034689
710 Ga0307413_10088682
711 Ga0307413_10258151
712 Ga0307410_10090984
713 Ga0307410_10096887
714 Ga0307406_10235274
715 Ga0307406_10244978
716 Ga0307412_10003432
717 Ga0307412_10025800
718 Ga0307412_10031934
719 Ga0307412_10052199
720 Ga0307409_100027886
721 Ga0307409_100141095
722 Ga0307409_100435612
723 Ga0307409_100460047
724 Ga0307416_100059138
725 Ga0307416_100111409
726 Ga0307416_100166410
727 Ga0307416_100307108
728 Ga0307414_10026412
729 Ga0307414_10084992
730 Ga0307414_10091650
731 Ga0307414_10164329
732 Ga0307414_10201109
733 Ga0307411_10024284
734 Ga0307411_10024975
735 Ga0307411_10134579
736 Ga0307411_10213253
737 Ga0307415_100029147
738 Ga0307415_100194228
739 Ga0316584_0196193
740 Ga0395899_0000287
741 Ga0395899_0036920
742 Ga0395900_0000031
743 Ga0395900_1012086
744 Ga0395905_0159596
745 Ga0395905_0208768
746 Ga0395905_0800343
747 Ga0436364_0184827
748 Ga0436364_0393449
749 Ga0395901_0000035
750 Ga0395901_0785287
751 Ga0436363_1197184
752 Ga0439431_0052130
753 Ga0466963_0004653
754 Ga0466963_0214661
755 Ga0466963_0386784
756 Ga0466957_0371265
757 Ga0466958_0054518
758 Ga0466967_0073170
759 Ga0466967_0135671
760 Ga0495617_006544
761 Ga0495650_0000172
762 Ga0495584_0079864
763 Ga0495585_0027930
764 Ga0495585_0119642
765 Ga0495585_0175580
766 Ga0495583_0002048
767 Ga0495583_0004847
768 Ga0495583_0011033
769 Ga0495631_0158880
770 Ga0495632_0100441
771 Ga0495643_0017797
772 Ga0495648_0000249
773 Ga0495663_0001306
774 Ga0495666_0068554
775 Ga0495587_0198068
776 Ga0495622_0019534
777 Ga0495668_0000080
778 Ga0495668_0017868
779 Ga0495625_0000541
780 Ga0495625_0179937
781 Ga0495661_0016849
782 Ga0495669_0000011
783 Ga0495649_0201673
784 Ga0495683_0019425
785 Ga0495687_000082
786 Ga0495687_002094
787 Ga0495677_0006435
788 Ga0495681_0005821
789 Ga0495681_0024906
790 Ga0495686_0163232
791 Ga0496102_0000034
792 Ga0496102_0000471
793 Ga0496102_0069336
794 Ga0496103_0000026
795 Ga0496103_0000166
796 Ga0496104_0010654
797 Ga0496105_0003221
798 Ga0496105_0211386
799 Ga0496109_0096519
800 Ga0496110_0101023
801 Ga0496111_0037863
802 Ga0496114_0076871
803 Ga0496115_0000030
804 Ga0496115_0000390
805 Ga0496116_0006531
806 Ga0496116_0010032
807 Ga0496117_0000072
808 Ga0496117_0000142
809 Ga0496117_0014014
810 Ga0496117_0020049
811 Ga0496118_0000030
812 Ga0496118_0000115
813 Ga0496118_0004303
814 Ga0496119_0059672
815 Ga0496120_0072884
816 Ga0496120_0100512
817 Ga0496121_0000104
818 Ga0496121_0000193
819 Ga0496122_0043264
820 Ga0496123_0028176
821 Ga0496123_0212985
822 Ga0496124_0000061
823 Ga0496124_0000071
824 Ga0496124_0000146
825 Ga0496124_0055280
826 Ga0496124_0163651
827 Ga0496124_0177346
828 Ga0496125_0003343
829 Ga0496126_0000174
830 Ga0501032_0122302
831 Ga0501038_0046077
832 Ga0501043_0061428
833 Ga0501047_0014341
834 Ga0501249_000536
835 Ga0501268_024578
836 Ga0501044_0046060
837 Ga0501204_005365
838 nmdc:mga0k408_109619_c1
839 nmdc:mga0k408_63030_c1
840 Ga0500610_0000413
841 Ga0500643_004336
842 Ga0500643_034058
843 Ga0500643_039988
844 Ga0500592_018666
845 Ga0500595_001555
846 Ga0500618_003530
847 Ga0500642_0001088
848 Ga0500559_0017236
849 Ga0500559_0044675
850 Ga0500568_0026030
851 Ga0500577_0025971
852 Ga0500588_0068779
853 Ga0500619_037962
854 Ga0500624_000060
855 Ga0500645_000001
856 Ga0500596_004764
857 2585260476
858 2600201659
859 2600225314
860 2644037534
861 2819713583
862 2879166298
863 2885430423
864 2896430595
865 2928530115
866 2928969698
867 2990265857
868 2993696352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

146

238

0.98

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

16

129

0.96

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

258

287

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c4i-assembly1.cif.gz_m conformation of methylated ggq in the peptidyl transferase center during translation termination 0.9217 169 206
8r57-assembly1.cif.gz_S cryoem structure of wheat 40s ribosomal subunit, head domain 0.915 169 202
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9112 2 270
7m4y-assembly1.cif.gz_m a. baumannii ribosome-eravacycline complex: e-site trna 70s 0.9102 152 204
7n2u-assembly1.cif.gz_SM elongating 70s ribosome complex in a hybrid-h1 pre-translocation (pre-h1) conformation 0.9092 168 206
ID Description Score Start End Superfamily
af_P05523_2_128_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9187 2 118 3.20.190.10
4ojuC00 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9184 48 69 3.80.10.10
af_P9WNC3_1_133_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9147 1 118 3.20.190.10
1l1tA01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8967 2 129 3.20.190.10
2y10M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8951 152 202 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A352H7J1-F1-model_v4 deleted 0.9914 1 168
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9892 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A352H7J1-F1-model_v4 deleted 0.9855 1 168
AF-A0A257PRL7-F1-model_v4 DNA-formamidopyrimidine glycosylase 0.9814 1 218 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9798 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Map