F443134

General Info

Members Datasets Scaffolds Average Seq Length
434 193 433 254

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0553647|Ga0395905_0553647_73_981
Length 302
Sequence MLFINATKTKFKYETSSSEVPGHPAGLEGGKNTVFGFLYCKLCRLRKYFCKKLEMSAKEWYKDWFNSPFYHKLYFERDDSEAQQFINKLLEHLKPRADSLMLDVACGKGRHSKFLATKGFDVTGIDISIDSINFAKQFEAPNLHFFQHDMRLPAWINYFDYAFNFFTSFGYFSTRREHDDAIKTIAQSLKPTGSLLFDYLNVHYVEEHLVHNEMKKIGNTNYEIHRWHDEHYFFKKITVTDPLLSQPIEYTEKVAKFSLGDFTDMLSFQNMQVTEVFGDYHLNRYDVRKTPRMIIIAHPSFH

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
172 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
173 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
174 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
177 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
182 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 0.23
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025354 3300003203 Bacteria 2303
2 rootH2_10033469 3300003320 Bacteria 18370
3 rootH2_10078432 3300003320 Bacteria 3758
4 Ga0065712_10077595 3300005290 Bacteria 3470
5 Ga0070658_10021180 3300005327 Bacteria 5208
6 Ga0070658_10065042 3300005327 Unclassified 2975
7 Ga0070676_10017640 3300005328 Bacteria 3951
8 Ga0070676_10123255 3300005328 Bacteria 1630
9 Ga0070690_100108479 3300005330 Bacteria 1849
10 Ga0070690_100513221 3300005330 Bacteria 898
11 Ga0070670_100028383 3300005331 Unclassified 4816
12 Ga0070670_100049198 3300005331 Bacteria 3625
13 Ga0070670_100054859 3300005331 Bacteria 3422
14 Ga0070670_100179611 3300005331 Bacteria 1837
15 Ga0068869_100097612 3300005334 Bacteria 2219
16 Ga0068869_100137477 3300005334 Bacteria 1884
17 Ga0068869_100204058 3300005334 Bacteria 1560
18 Ga0068869_100317890 3300005334 Bacteria 1262
19 Ga0070666_10000149 3300005335 Bacteria 47838
20 Ga0070680_100098332 3300005336 Bacteria 2427
21 Ga0070680_100220726 3300005336 Bacteria 1600
22 Ga0070682_100019909 3300005337 Bacteria 3942
23 Ga0068868_100009496 3300005338 Bacteria 7006
24 Ga0068868_100059382 3300005338 Bacteria 3025
25 Ga0068868_100591052 3300005338 Bacteria 982
26 Ga0070689_100008386 3300005340 Bacteria 7277
27 Ga0070689_100057510 3300005340 Bacteria 3018
28 Ga0070689_100080372 3300005340 Bacteria 2558
29 Ga0070689_100185554 3300005340 Bacteria 1691
30 Ga0070661_100334101 3300005344 Bacteria 1186
31 Ga0070669_100067477 3300005353 Bacteria 2639
32 Ga0070669_100094480 3300005353 Bacteria 2247
33 Ga0070669_100295021 3300005353 Bacteria 1303
34 Ga0070669_100301641 3300005353 Bacteria 1288
35 Ga0070675_100111077 3300005354 Bacteria 2319
36 Ga0070675_100135906 3300005354 Unclassified 2098
37 Ga0070675_100233950 3300005354 Bacteria 1603
38 Ga0070675_100253172 3300005354 Bacteria 1542
39 Ga0070675_100345021 3300005354 Bacteria 1319
40 Ga0070671_100042218 3300005355 Bacteria 3791
41 Ga0070671_100114613 3300005355 Bacteria 2265
42 Ga0070671_100226883 3300005355 Bacteria 1585
43 Ga0070674_100085724 3300005356 Unclassified 2261
44 Ga0070674_100335462 3300005356 Bacteria 1216
45 Ga0070673_100122738 3300005364 Bacteria 2170
46 Ga0070673_100194370 3300005364 Bacteria 1744
47 Ga0070673_100318391 3300005364 Bacteria 1373
48 Ga0070673_100342332 3300005364 Bacteria 1325
49 Ga0070688_100024204 3300005365 Bacteria 3579
50 Ga0070688_100064967 3300005365 Unclassified 2317
51 Ga0070667_100012652 3300005367 Bacteria 6978
52 Ga0070667_100088981 3300005367 Bacteria 2652
53 Ga0070667_100106771 3300005367 Bacteria 2424
54 Ga0070667_100662572 3300005367 Bacteria 964
55 Ga0070700_100060570 3300005441 Bacteria 2386
56 Ga0070700_100188230 3300005441 Bacteria 1441
57 Ga0070678_100219182 3300005456 Bacteria 1581
58 Ga0070678_100605277 3300005456 Bacteria 979
59 Ga0070662_100009279 3300005457 Bacteria 6429
60 Ga0070662_100077016 3300005457 Bacteria 2474
61 Ga0070662_100130688 3300005457 Bacteria 1935
62 Ga0070681_10112743 3300005458 Bacteria 2659
63 Ga0070681_10156932 3300005458 Bacteria 2200
64 Ga0068867_100041345 3300005459 Bacteria 3369
65 Ga0068867_100047671 3300005459 Bacteria 3150
66 Ga0068867_100116884 3300005459 Bacteria 2056
67 Ga0068867_100194056 3300005459 Bacteria 1622
68 Ga0070685_10043185 3300005466 Bacteria 2577
69 Ga0070685_10062041 3300005466 Bacteria 2191
70 Ga0070685_10073491 3300005466 Bacteria 2032
71 Ga0070685_10079922 3300005466 Bacteria 1958
72 Ga0070698_100011420 3300005471 Bacteria 9421
73 Ga0070698_100022946 3300005471 Bacteria 6525
74 Ga0070679_100005519 3300005530 Bacteria 11719
75 Ga0070684_100021658 3300005535 Bacteria 5354
76 Ga0068853_100111609 3300005539 Bacteria 2429
77 Ga0068853_100117173 3300005539 Bacteria 2372
78 Ga0068853_100251741 3300005539 Bacteria 1621
79 Ga0068853_100717729 3300005539 Bacteria 954
80 Ga0070672_100023983 3300005543 Bacteria 4500
81 Ga0070672_100072956 3300005543 Bacteria 2734
82 Ga0070672_100135674 3300005543 Bacteria 2026
83 Ga0070672_100242298 3300005543 Bacteria 1517
84 Ga0070672_100443126 3300005543 Bacteria 1118
85 Ga0070686_100129766 3300005544 Bacteria 1741
86 Ga0070686_100246251 3300005544 Bacteria 1304
87 Ga0070693_100162900 3300005547 Bacteria 1422
88 Ga0070704_100063417 3300005549 Bacteria 2652
89 Ga0070704_100091482 3300005549 Bacteria 2269
90 Ga0070664_100172135 3300005564 Bacteria 1921
91 Ga0070664_100261013 3300005564 Bacteria 1559
92 Ga0070664_100515301 3300005564 Bacteria 1103
93 Ga0068857_100013101 3300005577 Bacteria 7225
94 Ga0068857_100048938 3300005577 Bacteria 3750
95 Ga0068857_100153559 3300005577 Bacteria 2087
96 Ga0068857_100208911 3300005577 Bacteria 1781
97 Ga0068854_100014954 3300005578 Bacteria 5127
98 Ga0068856_100067320 3300005614 Bacteria 3539
99 Ga0070702_100024659 3300005615 Bacteria 3212
100 Ga0070702_100435577 3300005615 Unclassified 947
101 Ga0068852_100064606 3300005616 Bacteria 3191
102 Ga0068852_100127696 3300005616 Bacteria 2337
103 Ga0068852_100129487 3300005616 Bacteria 2322
104 Ga0068852_100488057 3300005616 Bacteria 1225
105 Ga0068859_100000037 3300005617 Bacteria 165480
106 Ga0068859_100028143 3300005617 Bacteria 5635
107 Ga0068859_100096869 3300005617 Bacteria 3002
108 Ga0068859_100120669 3300005617 Bacteria 2688
109 Ga0068859_100155573 3300005617 Bacteria 2363
110 Ga0068859_100556884 3300005617 Bacteria 1241
111 Ga0068864_100004933 3300005618 Bacteria 10935
112 Ga0068864_100025936 3300005618 Bacteria 4939
113 Ga0068864_100062990 3300005618 Bacteria 3214
114 Ga0068864_100152290 3300005618 Bacteria 2096
115 Ga0068864_100242086 3300005618 Bacteria 1672
116 Ga0068864_100436140 3300005618 Bacteria 1251
117 Ga0068866_10201803 3300005718 Bacteria 1189
118 Ga0068861_100007849 3300005719 Bacteria 7339
119 Ga0068861_100270208 3300005719 Bacteria 1460
120 Ga0068861_100717598 3300005719 Bacteria 931
121 Ga0068851_10028130 3300005834 Bacteria 2775
122 Ga0068870_10038689 3300005840 Unclassified 2464
123 Ga0068863_100002211 3300005841 Bacteria 19321
124 Ga0068863_100005947 3300005841 Bacteria 11972
125 Ga0068863_100067910 3300005841 Unclassified 3372
126 Ga0068863_100633907 3300005841 Bacteria 1059
127 Ga0068863_100674340 3300005841 Bacteria 1026
128 Ga0068858_100096934 3300005842 Bacteria 2749
129 Ga0068858_100235124 3300005842 Bacteria 1738
130 Ga0068858_100250828 3300005842 Bacteria 1681
131 Ga0068860_100040280 3300005843 Bacteria 4466
132 Ga0068860_100045872 3300005843 Unclassified 4168
133 Ga0068860_100661646 3300005843 Bacteria 1053
134 Ga0068862_100009932 3300005844 Bacteria 7862
135 Ga0068862_100491361 3300005844 Bacteria 1163
136 Ga0068862_100502131 3300005844 Bacteria 1151
137 Ga0081539_10001239 3300005985 Bacteria 45441
138 Ga0070715_10031156 3300006163 Bacteria 2163
139 Ga0097621_100010400 3300006237 Bacteria 6808
140 Ga0097621_100049240 3300006237 Bacteria 3422
141 Ga0097621_100154709 3300006237 Bacteria 1967
142 Ga0097621_100337054 3300006237 Bacteria 1338
143 Ga0068871_100007843 3300006358 Bacteria 7649
144 Ga0068871_100130259 3300006358 Bacteria 2132
145 Ga0068871_100199199 3300006358 Bacteria 1728
146 Ga0068871_100359266 3300006358 Bacteria 1290
147 Ga0068871_100591265 3300006358 Bacteria 1009
148 Ga0075428_100017249 3300006844 Bacteria 7978
149 Ga0075428_100046302 3300006844 Bacteria 4778
150 Ga0075430_100083801 3300006846 Unclassified 2670
151 Ga0075429_100010519 3300006880 Bacteria 8001
152 Ga0068865_100465672 3300006881 Bacteria 1048
153 Ga0097620_100000037 3300006931 Bacteria 165480
154 Ga0097620_100028142 3300006931 Bacteria 5635
155 Ga0097620_100096868 3300006931 Bacteria 3002
156 Ga0097620_100120670 3300006931 Bacteria 2688
157 Ga0097620_100155564 3300006931 Bacteria 2363
158 Ga0097620_100556856 3300006931 Bacteria 1241
159 Ga0105251_10140404 3300009011 Bacteria 1093
160 Ga0111539_10037296 3300009094 Bacteria 5870
161 Ga0111539_10061142 3300009094 Bacteria 4462
162 Ga0111539_10127791 3300009094 Unclassified 2977
163 Ga0111539_10176563 3300009094 Bacteria 2495
164 Ga0111539_10293717 3300009094 Bacteria 1891
165 Ga0105245_10115700 3300009098 Bacteria 2499
166 Ga0105247_10045013 3300009101 Bacteria 2707
167 Ga0114129_10186992 3300009147 Bacteria 2814
168 Ga0114129_10485767 3300009147 Bacteria 1615
169 Ga0105243_10162607 3300009148 Bacteria 1926
170 Ga0105241_10000159 3300009174 Bacteria 49102
171 Ga0105241_10387149 3300009174 Bacteria 1223
172 Ga0105242_10031430 3300009176 Bacteria 4240
173 Ga0105242_10103348 3300009176 Bacteria 2417
174 Ga0105242_10209003 3300009176 Bacteria 1738
175 Ga0105242_10245117 3300009176 Bacteria 1612
176 Ga0105237_10014682 3300009545 Bacteria 8179
177 Ga0105249_10002398 3300009553 Bacteria 16284
178 Ga0105249_10007603 3300009553 Bacteria 9454
179 Ga0105249_10011245 3300009553 Bacteria 7857
180 Ga0105249_10013332 3300009553 Bacteria 7258
181 Ga0105249_10013878 3300009553 Bacteria 7121
182 Ga0105249_10019740 3300009553 Bacteria 6017
183 Ga0105249_10095125 3300009553 Bacteria 2793
184 Ga0105249_10304302 3300009553 Bacteria 1600
185 Ga0105249_10397742 3300009553 Bacteria 1407
186 Ga0105239_10026755 3300010375 Bacteria 6349
187 Ga0105239_10104621 3300010375 Bacteria 3134
188 Ga0105246_10352702 3300011119 Bacteria 1206
189 Ga0105246_10424774 3300011119 Bacteria 1110
190 Ga0157371_10033141 3300013102 Bacteria 3713
191 Ga0157371_10036031 3300013102 Bacteria 3543
192 Ga0157371_10078051 3300013102 Bacteria 2345
193 Ga0157371_10123926 3300013102 Bacteria 1838
194 Ga0157371_10137093 3300013102 Unclassified 1743
195 Ga0157371_10197257 3300013102 Bacteria 1442
196 Ga0157371_10441711 3300013102 Bacteria 956
197 Ga0157370_10108806 3300013104 Bacteria 2591
198 Ga0157370_10126478 3300013104 Bacteria 2385
199 Ga0157370_10294064 3300013104 Bacteria 1500
200 Ga0157369_10094314 3300013105 Bacteria 3194
201 Ga0157374_10005267 3300013296 Bacteria 10855
202 Ga0157374_10008926 3300013296 Bacteria 8591
203 Ga0157374_10040567 3300013296 Bacteria 4288
204 Ga0157374_10172910 3300013296 Bacteria 2108
205 Ga0157374_10436166 3300013296 Bacteria 1310
206 Ga0157378_10005941 3300013297 Bacteria 10698
207 Ga0157378_10051470 3300013297 Bacteria 3665
208 Ga0157378_10163319 3300013297 Bacteria 2084
209 Ga0157378_10216314 3300013297 Bacteria 1819
210 Ga0157378_10217250 3300013297 Bacteria 1816
211 Ga0163162_10000487 3300013306 Bacteria 36809
212 Ga0163162_10040506 3300013306 Bacteria 4659
213 Ga0163162_10074565 3300013306 Bacteria 3452
214 Ga0163162_10536691 3300013306 Bacteria 1299
215 Ga0157372_10065150 3300013307 Bacteria 4090
216 Ga0157372_10091773 3300013307 Bacteria 3454
217 Ga0157372_10092591 3300013307 Unclassified 3439
218 Ga0157372_10130491 3300013307 Unclassified 2891
219 Ga0157372_10494548 3300013307 Bacteria 1426
220 Ga0157375_10027957 3300013308 Bacteria 5278
221 Ga0157375_10122996 3300013308 Bacteria 2707
222 Ga0157375_10128320 3300013308 Bacteria 2654
223 Ga0157375_10301424 3300013308 Bacteria 1766
224 Ga0157375_10350511 3300013308 Bacteria 1642
225 Ga0157375_10716578 3300013308 Bacteria 1153
226 Ga0163163_10021201 3300014325 Bacteria 6129
227 Ga0163163_10222122 3300014325 Bacteria 1938
228 Ga0163163_10768544 3300014325 Bacteria 1027
229 Ga0157380_10114931 3300014326 Bacteria 2269
230 Ga0157380_10133720 3300014326 Bacteria 2120
231 Ga0157377_10009832 3300014745 Bacteria 4712
232 Ga0157377_10017038 3300014745 Bacteria 3753
233 Ga0157377_10023905 3300014745 Bacteria 3244
234 Ga0157379_10108300 3300014968 Bacteria 2495
235 Ga0157379_10180401 3300014968 Bacteria 1908
236 Ga0157379_10357846 3300014968 Bacteria 1337
237 Ga0163161_10024460 3300017792 Bacteria 4266
238 Ga0163161_10256635 3300017792 Bacteria 1364
239 Ga0163161_10330084 3300017792 Bacteria 1208
240 Ga0213876_10003277 3300021384 Bacteria 9293
241 Ga0209050_1000989 3300025298 Bacteria 36106
242 Ga0209050_1015769 3300025298 Bacteria 3146
243 Ga0207697_10046053 3300025315 Bacteria 1795
244 Ga0207656_10017321 3300025321 Bacteria 2820
245 Ga0207656_10029626 3300025321 Bacteria 2256
246 Ga0207642_10013318 3300025899 Bacteria 2999
247 Ga0207710_10022069 3300025900 Bacteria 2730
248 Ga0207680_10000122 3300025903 Bacteria 36234
249 Ga0207647_10013155 3300025904 Bacteria 5749
250 Ga0207685_10266494 3300025905 Bacteria 835
251 Ga0207645_10006136 3300025907 Bacteria 8634
252 Ga0207645_10057362 3300025907 Bacteria 2486
253 Ga0207645_10143484 3300025907 Bacteria 1556
254 Ga0207643_10024812 3300025908 Bacteria 3309
255 Ga0207705_10036363 3300025909 Bacteria 3524
256 Ga0207654_10026288 3300025911 Bacteria 3150
257 Ga0207654_10127530 3300025911 Bacteria 1606
258 Ga0207707_10177414 3300025912 Bacteria 1861
259 Ga0207671_10003723 3300025914 Bacteria 15025
260 Ga0207662_10026054 3300025918 Bacteria 3372
261 Ga0207657_10017950 3300025919 Bacteria 6770
262 Ga0207649_10016300 3300025920 Bacteria 4186
263 Ga0207649_10224356 3300025920 Bacteria 1340
264 Ga0207652_10007852 3300025921 Bacteria 8566
265 Ga0207681_10060290 3300025923 Bacteria 2604
266 Ga0207681_10280673 3300025923 Bacteria 1311
267 Ga0207650_10166115 3300025925 Unclassified 1751
268 Ga0207650_10333127 3300025925 Unclassified 1245
269 Ga0207659_10123514 3300025926 Bacteria 1987
270 Ga0207659_10296946 3300025926 Bacteria 1326
271 Ga0207687_10197123 3300025927 Bacteria 1571
272 Ga0207644_10033175 3300025931 Bacteria 3606
273 Ga0207644_10045831 3300025931 Bacteria 3112
274 Ga0207644_10115728 3300025931 Bacteria 2034
275 Ga0207706_10010977 3300025933 Bacteria 8258
276 Ga0207706_10011207 3300025933 Bacteria 8174
277 Ga0207706_10018402 3300025933 Bacteria 6286
278 Ga0207706_10048987 3300025933 Bacteria 3735
279 Ga0207706_10053351 3300025933 Bacteria 3569
280 Ga0207686_10003640 3300025934 Bacteria 8256
281 Ga0207686_10285917 3300025934 Bacteria 1219
282 Ga0207670_10008678 3300025936 Bacteria 5752
283 Ga0207670_10064016 3300025936 Bacteria 2519
284 Ga0207670_10090931 3300025936 Bacteria 2157
285 Ga0207669_10057235 3300025937 Unclassified 2372
286 Ga0207704_10210976 3300025938 Bacteria 1429
287 Ga0207704_10368806 3300025938 Bacteria 1123
288 Ga0207691_10038497 3300025940 Bacteria 4426
289 Ga0207691_10113863 3300025940 Unclassified 2404
290 Ga0207689_10004378 3300025942 Bacteria 12849
291 Ga0207689_10004894 3300025942 Bacteria 12079
292 Ga0207689_10047182 3300025942 Bacteria 3558
293 Ga0207689_10127925 3300025942 Bacteria 2089
294 Ga0207689_10246664 3300025942 Bacteria 1477
295 Ga0207689_10479211 3300025942 Bacteria 1042
296 Ga0207661_10025253 3300025944 Bacteria 4514
297 Ga0207661_10214555 3300025944 Bacteria 1698
298 Ga0207661_10706899 3300025944 Bacteria 927
299 Ga0207679_10001478 3300025945 Bacteria 14731
300 Ga0207679_10473759 3300025945 Bacteria 1114
301 Ga0207679_10645335 3300025945 Bacteria 957
302 Ga0207667_10770511 3300025949 Bacteria 960
303 Ga0207651_10101337 3300025960 Bacteria 2137
304 Ga0207651_10178485 3300025960 Bacteria 1682
305 Ga0207712_10011304 3300025961 Bacteria 5683
306 Ga0207712_10029679 3300025961 Bacteria 3671
307 Ga0207712_10232842 3300025961 Bacteria 1480
308 Ga0207712_10260393 3300025961 Bacteria 1406
309 Ga0207712_10273103 3300025961 Bacteria 1376
310 Ga0207712_10294805 3300025961 Bacteria 1329
311 Ga0207668_10095268 3300025972 Bacteria 2197
312 Ga0207640_10035621 3300025981 Bacteria 3116
313 Ga0207658_10008077 3300025986 Bacteria 7170
314 Ga0207658_10080101 3300025986 Bacteria 2501
315 Ga0207658_10184369 3300025986 Bacteria 1730
316 Ga0207658_10598162 3300025986 Bacteria 991
317 Ga0207677_10006218 3300026023 Bacteria 6528
318 Ga0207677_10007560 3300026023 Bacteria 6027
319 Ga0207677_10139955 3300026023 Bacteria 1851
320 Ga0207677_10151466 3300026023 Bacteria 1790
321 Ga0207677_10340453 3300026023 Bacteria 1253
322 Ga0207703_10019895 3300026035 Bacteria 5247
323 Ga0207703_10087286 3300026035 Bacteria 2615
324 Ga0207703_10126933 3300026035 Bacteria 2198
325 Ga0207639_10260899 3300026041 Bacteria 1515
326 Ga0207639_10466649 3300026041 Bacteria 1148
327 Ga0207678_10018262 3300026067 Bacteria 6158
328 Ga0207708_10072753 3300026075 Bacteria 2634
329 Ga0207708_10314472 3300026075 Unclassified 1276
330 Ga0207641_10000121 3300026088 Bacteria 114943
331 Ga0207641_10001301 3300026088 Bacteria 24754
332 Ga0207641_10003302 3300026088 Bacteria 14350
333 Ga0207641_10035611 3300026088 Unclassified 4148
334 Ga0207641_10038120 3300026088 Bacteria 4018
335 Ga0207641_10258659 3300026088 Bacteria 1629
336 Ga0207641_10542648 3300026088 Bacteria 1133
337 Ga0207648_10013112 3300026089 Bacteria 7729
338 Ga0207648_10021837 3300026089 Bacteria 5750
339 Ga0207648_10034182 3300026089 Bacteria 4482
340 Ga0207648_10050449 3300026089 Bacteria 3639
341 Ga0207648_10072070 3300026089 Bacteria 3011
342 Ga0207648_10083816 3300026089 Bacteria 2780
343 Ga0207648_10161015 3300026089 Bacteria 1982
344 Ga0207676_10001252 3300026095 Bacteria 18907
345 Ga0207676_10019670 3300026095 Bacteria 4930
346 Ga0207676_10059186 3300026095 Bacteria 3024
347 Ga0207676_10062111 3300026095 Bacteria 2962
348 Ga0207676_10149543 3300026095 Bacteria 2010
349 Ga0207676_10317647 3300026095 Bacteria 1428
350 Ga0207674_10099858 3300026116 Bacteria 2884
351 Ga0207674_10125325 3300026116 Bacteria 2534
352 Ga0207674_10143504 3300026116 Bacteria 2347
353 Ga0207674_10490320 3300026116 Bacteria 1187
354 Ga0207674_10538060 3300026116 Bacteria 1128
355 Ga0207675_100002834 3300026118 Bacteria 17059
356 Ga0207675_100163159 3300026118 Unclassified 2127
357 Ga0207675_100230331 3300026118 Bacteria 1787
358 Ga0207675_100538636 3300026118 Bacteria 1165
359 Ga0207683_10027397 3300026121 Bacteria 4924
360 Ga0207683_10177190 3300026121 Bacteria 1932
361 Ga0207683_10291352 3300026121 Bacteria 1493
362 Ga0207698_10010111 3300026142 Bacteria 6043
363 Ga0207698_10092929 3300026142 Bacteria 2475
364 Ga0207698_10166809 3300026142 Bacteria 1934
365 Ga0207698_10402819 3300026142 Bacteria 1308
366 Ga0207428_10259459 3300027907 Bacteria 1294
367 Ga0268265_10093699 3300028380 Bacteria 2407
368 Ga0268265_10624474 3300028380 Bacteria 1033
369 Ga0268264_10002776 3300028381 Bacteria 15273
370 Ga0268264_10009484 3300028381 Bacteria 8061
371 Ga0265327_10094448 3300031251 Bacteria 1453
372 Ga0307513_10103815 3300031456 Bacteria 2858
373 Ga0307408_100152866 3300031548 Bacteria 1824
374 Ga0307405_10106209 3300031731 Bacteria 1893
375 Ga0307413_10265814 3300031824 Bacteria 1281
376 Ga0307410_10057241 3300031852 Bacteria 2654
377 Ga0307410_10166094 3300031852 Unclassified 1658
378 Ga0307412_10186807 3300031911 Unclassified 1564
379 Ga0307412_10234217 3300031911 Bacteria 1416
380 Ga0307409_100179625 3300031995 Bacteria 1872
381 Ga0307416_100076215 3300032002 Bacteria 2810
382 Ga0307411_10111758 3300032005 Bacteria 1957
383 Ga0373957_0135282 3300035120 Bacteria 1005
384 Ga0373955_0050147 3300035172 Bacteria 2269
385 Ga0395900_0063578 3300037418 Bacteria 3794
386 Ga0395898_0738358 3300037466 Bacteria 926
387 Ga0395905_0142802 3300037471 Bacteria 2252
388 Ga0395905_0179136 3300037471 Bacteria 1990
389 Ga0395905_0553647 3300037471 Bacteria 1051
390 Ga0436365_0257855 3300039437 Bacteria 16882
391 Ga0451807_1106349 3300041486 Bacteria 2724
392 Ga0439449_0131196 3300042007 Bacteria 931
393 Ga0439434_0118285 3300042435 Bacteria 862
394 Ga0451577_0006749 3300042876 Bacteria 11385
395 Ga0466972_0003123 3300044658 Bacteria 8223
396 Ga0466972_0041602 3300044658 Bacteria 2237
397 Ga0453684_0023448 3300044712 Bacteria 9087
398 Ga0495638_0000026 3300046460 Bacteria 347061
399 Ga0495645_0001484 3300046543 Bacteria 15885
400 Ga0495674_0196366 3300047319 Bacteria 1676
401 Ga0495672_0006383 3300047320 Bacteria 9154
402 Ga0495672_0018193 3300047320 Bacteria 4676
403 Ga0495672_0039599 3300047320 Bacteria 2865
404 Ga0495684_0078035 3300047471 Bacteria 2513
405 Ga0501033_0045202 3300049570 Bacteria 3278
406 Ga0501034_0000115 3300049571 Bacteria 146825
407 Ga0501034_0022202 3300049571 Bacteria 6467
408 Ga0501034_0045438 3300049571 Bacteria 4438
409 Ga0501072_0022114 3300049588 Bacteria 4933
410 Ga0501202_008691 3300049652 Bacteria 1855
411 Ga0501217_036387 3300049661 Bacteria 1236
412 Ga0501223_018630 3300049663 Bacteria 1365
413 Ga0501251_002910 3300049681 Unclassified 1685
414 Ga0501257_079276 3300049686 Bacteria 845
415 Ga0501259_000574 3300049688 Bacteria 5875
416 Ga0501261_003210 3300049690 Unclassified 2009
417 Ga0501225_0008673 3300049705 Bacteria 2912
418 Ga0501080_0218056 3300049742 Unclassified 1747
419 Ga0501083_0060821 3300049744 Bacteria 2523
420 Ga0501268_016461 3300049765 Bacteria 1225
421 Ga0501272_014472 3300049769 Unclassified 912
422 Ga0501044_0082359 3300049823 Bacteria 3256
423 Ga0501044_0105663 3300049823 Bacteria 2828
424 nmdc:mga0k408_129555_c1 3300050493 Bacteria 1497
425 nmdc:mga09592_72379_c1 3300050508 Bacteria 2927
426 nmdc:mga0qj67_82492_c1 3300050509 Bacteria 2578
427 nmdc:mga08y16_26624_c1 3300050511 Bacteria 6095
428 Ga0495601_0040891 3300053077 Bacteria 2905
429 Ga0495619_0120948 3300053085 Bacteria 1795
430 Ga0500641_0021226 3300053096 Bacteria 2472
431 Ga0500616_0000004 3300053153 Bacteria 1002714
432 Ga0500611_000006 3300053727 Bacteria 226069
433 Ga0466962_0047948 3300061719 Bacteria 2042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0040891 Ga0495601_0040891_1217_1924 213
2 3300025905 Ga0207685_10266494 Ga0207685_102664941 217
3 3300005458 Ga0070681_10112743 Ga0070681_101127434 233
4 3300005290 Ga0065712_10077595 Ga0065712_100775953 238
5 3300005331 Ga0070670_100179611 Ga0070670_1001796113 238
6 3300005354 Ga0070675_100345021 Ga0070675_1003450212 238
7 3300005543 Ga0070672_100242298 Ga0070672_1002422981 238
8 3300006844 Ga0075428_100046302 Ga0075428_1000463024 238
9 3300009094 Ga0111539_10037296 Ga0111539_100372964 238
10 3300014326 Ga0157380_10133720 Ga0157380_101337202 238
11 3300026075 Ga0207708_10072753 Ga0207708_100727532 240
12 3300049571 Ga0501034_0000115 Ga0501034_0000115_57866_58612 244
13 iso_pu_bacteria 2738541278 2738726427 244
14 3300005334 Ga0068869_100097612 Ga0068869_1000976121 245
15 3300005338 Ga0068868_100059382 Ga0068868_1000593825 245
16 3300005340 Ga0070689_100008386 Ga0070689_1000083865 245
17 3300005354 Ga0070675_100233950 Ga0070675_1002339502 245
18 3300005355 Ga0070671_100226883 Ga0070671_1002268832 245
19 3300005356 Ga0070674_100085724 Ga0070674_1000857243 245
20 3300005367 Ga0070667_100106771 Ga0070667_1001067712 245
21 3300005466 Ga0070685_10079922 Ga0070685_100799222 245
22 3300005535 Ga0070684_100021658 Ga0070684_1000216585 245
23 3300005539 Ga0068853_100717729 Ga0068853_1007177291 245
24 3300005543 Ga0070672_100072956 Ga0070672_1000729565 245
25 3300005564 Ga0070664_100515301 Ga0070664_1005153012 245
26 3300005577 Ga0068857_100013101 Ga0068857_1000131016 245
27 3300005616 Ga0068852_100129487 Ga0068852_1001294872 245
28 3300005617 Ga0068859_100028143 Ga0068859_1000281434 245
29 3300005618 Ga0068864_100152290 Ga0068864_1001522903 245
30 3300006358 Ga0068871_100359266 Ga0068871_1003592661 245
31 3300006931 Ga0097620_100028142 Ga0097620_1000281424 245
32 3300009094 Ga0111539_10127791 Ga0111539_101277912 245
33 3300013102 Ga0157371_10137093 Ga0157371_101370932 245
34 3300013296 Ga0157374_10005267 Ga0157374_100052674 245
35 3300013307 Ga0157372_10065150 Ga0157372_100651504 245
36 3300013307 Ga0157372_10130491 Ga0157372_101304912 245
37 3300013308 Ga0157375_10027957 Ga0157375_100279575 245
38 3300014325 Ga0163163_10021201 Ga0163163_100212011 245
39 3300014326 Ga0157380_10114931 Ga0157380_101149312 245
40 3300014745 Ga0157377_10023905 Ga0157377_100239052 245
41 3300014968 Ga0157379_10180401 Ga0157379_101804012 245
42 3300025904 Ga0207647_10013155 Ga0207647_100131554 245
43 3300025911 Ga0207654_10127530 Ga0207654_101275302 245
44 3300025920 Ga0207649_10016300 Ga0207649_100163003 245
45 3300025933 Ga0207706_10018402 Ga0207706_100184025 245
46 3300025936 Ga0207670_10008678 Ga0207670_100086784 245
47 3300025937 Ga0207669_10057235 Ga0207669_100572353 245
48 3300025938 Ga0207704_10368806 Ga0207704_103688061 245
49 3300025940 Ga0207691_10038497 Ga0207691_100384972 245
50 3300025942 Ga0207689_10004378 Ga0207689_1000437812 245
51 3300025944 Ga0207661_10025253 Ga0207661_100252532 245
52 3300025945 Ga0207679_10001478 Ga0207679_100014789 245
53 3300025945 Ga0207679_10473759 Ga0207679_104737592 245
54 3300025960 Ga0207651_10178485 Ga0207651_101784852 245
55 3300026023 Ga0207677_10006218 Ga0207677_100062184 245
56 3300026035 Ga0207703_10126933 Ga0207703_101269331 245
57 3300026067 Ga0207678_10018262 Ga0207678_100182624 245
58 3300026095 Ga0207676_10001252 Ga0207676_100012524 245
59 3300026116 Ga0207674_10099858 Ga0207674_100998583 245
60 3300028380 Ga0268265_10624474 Ga0268265_106244742 245
61 3300037471 Ga0395905_0142802 Ga0395905_0142802_904_1641 245
62 3300003320 rootH2_10033469 rootH2_100334697 246
63 3300005331 Ga0070670_100054859 Ga0070670_1000548592 246
64 3300005334 Ga0068869_100137477 Ga0068869_1001374771 246
65 3300005354 Ga0070675_100111077 Ga0070675_1001110772 246
66 3300005365 Ga0070688_100024204 Ga0070688_1000242043 246
67 3300005441 Ga0070700_100060570 Ga0070700_1000605702 246
68 3300005457 Ga0070662_100077016 Ga0070662_1000770162 246
69 3300005466 Ga0070685_10062041 Ga0070685_100620412 246
70 3300005543 Ga0070672_100023983 Ga0070672_1000239833 246
71 3300005549 Ga0070704_100063417 Ga0070704_1000634172 246
72 3300005577 Ga0068857_100048938 Ga0068857_1000489384 246
73 3300005577 Ga0068857_100208911 Ga0068857_1002089112 246
74 3300005617 Ga0068859_100155573 Ga0068859_1001555732 246
75 3300005618 Ga0068864_100004933 Ga0068864_10000493310 246
76 3300005719 Ga0068861_100007849 Ga0068861_1000078496 246
77 3300005841 Ga0068863_100633907 Ga0068863_1006339072 246
78 3300005844 Ga0068862_100009932 Ga0068862_1000099322 246
79 3300006931 Ga0097620_100155564 Ga0097620_1001555642 246
80 3300009094 Ga0111539_10061142 Ga0111539_100611423 246
81 3300009553 Ga0105249_10011245 Ga0105249_100112455 246
82 3300009553 Ga0105249_10095125 Ga0105249_100951252 246
83 3300013102 Ga0157371_10123926 Ga0157371_101239261 246
84 3300013306 Ga0163162_10074565 Ga0163162_100745653 246
85 3300013307 Ga0157372_10092591 Ga0157372_100925913 246
86 3300014745 Ga0157377_10009832 Ga0157377_100098323 246
87 3300017792 Ga0163161_10256635 Ga0163161_102566352 246
88 3300021384 Ga0213876_10003277 Ga0213876_100032776 246
89 3300025315 Ga0207697_10046053 Ga0207697_100460532 246
90 3300025925 Ga0207650_10333127 Ga0207650_103331272 246
91 3300025933 Ga0207706_10053351 Ga0207706_100533512 246
92 3300025938 Ga0207704_10210976 Ga0207704_102109761 246
93 3300025942 Ga0207689_10479211 Ga0207689_104792112 246
94 3300025960 Ga0207651_10101337 Ga0207651_101013372 246
95 3300025961 Ga0207712_10294805 Ga0207712_102948051 246
96 3300026023 Ga0207677_10340453 Ga0207677_103404531 246
97 3300026088 Ga0207641_10542648 Ga0207641_105426481 246
98 3300026089 Ga0207648_10072070 Ga0207648_100720702 246
99 3300026095 Ga0207676_10019670 Ga0207676_100196704 246
100 3300026116 Ga0207674_10143504 Ga0207674_101435042 246
101 3300026118 Ga0207675_100002834 Ga0207675_10000283412 246
102 3300027907 Ga0207428_10259459 Ga0207428_102594592 246
103 3300031251 Ga0265327_10094448 Ga0265327_100944481 246
104 3300035120 Ga0373957_0135282 Ga0373957_0135282_86_892 246
105 3300035172 Ga0373955_0050147 Ga0373955_0050147_1321_2127 246
106 3300039437 Ga0436365_0257855 Ga0436365_0257855_2387_3166 246
107 3300042007 Ga0439449_0131196 Ga0439449_0131196_95_835 246
108 3300044658 Ga0466972_0041602 Ga0466972_0041602_1146_1889 246
109 3300046543 Ga0495645_0001484 Ga0495645_0001484_7755_8561 246
110 3300047319 Ga0495674_0196366 Ga0495674_0196366_213_1019 246
111 3300047471 Ga0495684_0078035 Ga0495684_0078035_155_961 246
112 3300049570 Ga0501033_0045202 Ga0501033_0045202_771_1514 246
113 3300049571 Ga0501034_0022202 Ga0501034_0022202_1780_2523 246
114 3300049571 Ga0501034_0045438 Ga0501034_0045438_1650_2393 246
115 3300049652 Ga0501202_008691 Ga0501202_008691_976_1719 246
116 3300049681 Ga0501251_002910 Ga0501251_002910_490_1233 246
117 3300049686 Ga0501257_079276 Ga0501257_079276_77_820 246
118 3300049688 Ga0501259_000574 Ga0501259_000574_714_1457 246
119 3300049690 Ga0501261_003210 Ga0501261_003210_469_1212 246
120 3300049705 Ga0501225_0008673 Ga0501225_0008673_2080_2865 246
121 3300049742 Ga0501080_0218056 Ga0501080_0218056_500_1243 246
122 3300049765 Ga0501268_016461 Ga0501268_016461_132_875 246
123 3300049823 Ga0501044_0082359 Ga0501044_0082359_370_1113 246
124 3300049823 Ga0501044_0105663 Ga0501044_0105663_1114_1857 246
125 3300050511 nmdc:mga08y16_26624_c1 nmdc:mga08y16_26624_c1_1309_2049 246
126 3300053085 Ga0495619_0120948 Ga0495619_0120948_360_1166 246
127 3300005328 Ga0070676_10017640 Ga0070676_100176402 247
128 3300005331 Ga0070670_100028383 Ga0070670_1000283832 247
129 3300005334 Ga0068869_100317890 Ga0068869_1003178902 247
130 3300005336 Ga0070680_100098332 Ga0070680_1000983323 247
131 3300005338 Ga0068868_100009496 Ga0068868_1000094965 247
132 3300005353 Ga0070669_100094480 Ga0070669_1000944802 247
133 3300005364 Ga0070673_100342332 Ga0070673_1003423322 247
134 3300005457 Ga0070662_100009279 Ga0070662_1000092795 247
135 3300005459 Ga0068867_100116884 Ga0068867_1001168842 247
136 3300005539 Ga0068853_100117173 Ga0068853_1001171732 247
137 3300005544 Ga0070686_100129766 Ga0070686_1001297662 247
138 3300005578 Ga0068854_100014954 Ga0068854_1000149544 247
139 3300005617 Ga0068859_100556884 Ga0068859_1005568842 247
140 3300005618 Ga0068864_100436140 Ga0068864_1004361403 247
141 3300006881 Ga0068865_100465672 Ga0068865_1004656721 247
142 3300006931 Ga0097620_100556856 Ga0097620_1005568562 247
143 3300009011 Ga0105251_10140404 Ga0105251_101404042 247
144 3300009553 Ga0105249_10013332 Ga0105249_1001333210 247
145 3300013296 Ga0157374_10040567 Ga0157374_100405673 247
146 3300013296 Ga0157374_10172910 Ga0157374_101729102 247
147 3300013297 Ga0157378_10163319 Ga0157378_101633193 247
148 3300013297 Ga0157378_10216314 Ga0157378_102163142 247
149 3300013306 Ga0163162_10040506 Ga0163162_100405065 247
150 3300013307 Ga0157372_10494548 Ga0157372_104945482 247
151 3300013308 Ga0157375_10301424 Ga0157375_103014242 247
152 3300014325 Ga0163163_10222122 Ga0163163_102221222 247
153 3300014745 Ga0157377_10017038 Ga0157377_100170383 247
154 3300017792 Ga0163161_10024460 Ga0163161_100244601 247
155 3300025907 Ga0207645_10006136 Ga0207645_100061364 247
156 3300025925 Ga0207650_10166115 Ga0207650_101661152 247
157 3300025933 Ga0207706_10011207 Ga0207706_100112074 247
158 3300025933 Ga0207706_10048987 Ga0207706_100489872 247
159 3300025942 Ga0207689_10127925 Ga0207689_101279253 247
160 3300025944 Ga0207661_10706899 Ga0207661_107068991 247
161 3300025945 Ga0207679_10645335 Ga0207679_106453351 247
162 3300025981 Ga0207640_10035621 Ga0207640_100356213 247
163 3300026023 Ga0207677_10007560 Ga0207677_100075604 247
164 3300026089 Ga0207648_10083816 Ga0207648_100838162 247
165 3300026095 Ga0207676_10317647 Ga0207676_103176472 247
166 3300031548 Ga0307408_100152866 Ga0307408_1001528661 247
167 3300031731 Ga0307405_10106209 Ga0307405_101062091 247
168 3300031824 Ga0307413_10265814 Ga0307413_102658141 247
169 3300031852 Ga0307410_10057241 Ga0307410_100572412 247
170 3300031911 Ga0307412_10234217 Ga0307412_102342171 247
171 3300031995 Ga0307409_100179625 Ga0307409_1001796251 247
172 3300032002 Ga0307416_100076215 Ga0307416_1000762152 247
173 3300032005 Ga0307411_10111758 Ga0307411_101117581 247
174 3300042876 Ga0451577_0006749 Ga0451577_0006749_4935_5678 247
175 3300047320 Ga0495672_0039599 Ga0495672_0039599_2037_2780 247
176 3300049661 Ga0501217_036387 Ga0501217_036387_468_1211 247
177 3300049663 Ga0501223_018630 Ga0501223_018630_101_844 247
178 3300049744 Ga0501083_0060821 Ga0501083_0060821_220_1038 247
179 3300049769 Ga0501272_014472 Ga0501272_014472_124_867 247
180 3300061719 Ga0466962_0047948 Ga0466962_0047948_953_1699 247
181 3300003203 JGI25406J46586_10025354 JGI25406J46586_100253542 248
182 3300003320 rootH2_10078432 rootH2_100784324 248
183 3300005327 Ga0070658_10021180 Ga0070658_100211805 248
184 3300005327 Ga0070658_10065042 Ga0070658_100650424 248
185 3300005328 Ga0070676_10123255 Ga0070676_101232551 248
186 3300005330 Ga0070690_100108479 Ga0070690_1001084792 248
187 3300005330 Ga0070690_100513221 Ga0070690_1005132211 248
188 3300005331 Ga0070670_100049198 Ga0070670_1000491982 248
189 3300005334 Ga0068869_100204058 Ga0068869_1002040582 248
190 3300005335 Ga0070666_10000149 Ga0070666_1000014922 248
191 3300005336 Ga0070680_100220726 Ga0070680_1002207262 248
192 3300005337 Ga0070682_100019909 Ga0070682_1000199091 248
193 3300005338 Ga0068868_100591052 Ga0068868_1005910521 248
194 3300005340 Ga0070689_100057510 Ga0070689_1000575102 248
195 3300005340 Ga0070689_100080372 Ga0070689_1000803723 248
196 3300005340 Ga0070689_100185554 Ga0070689_1001855542 248
197 3300005344 Ga0070661_100334101 Ga0070661_1003341012 248
198 3300005353 Ga0070669_100067477 Ga0070669_1000674773 248
199 3300005353 Ga0070669_100295021 Ga0070669_1002950212 248
200 3300005353 Ga0070669_100301641 Ga0070669_1003016412 248
201 3300005354 Ga0070675_100135906 Ga0070675_1001359062 248
202 3300005354 Ga0070675_100253172 Ga0070675_1002531722 248
203 3300005355 Ga0070671_100042218 Ga0070671_1000422182 248
204 3300005355 Ga0070671_100114613 Ga0070671_1001146132 248
205 3300005356 Ga0070674_100335462 Ga0070674_1003354622 248
206 3300005364 Ga0070673_100122738 Ga0070673_1001227382 248
207 3300005364 Ga0070673_100194370 Ga0070673_1001943701 248
208 3300005364 Ga0070673_100318391 Ga0070673_1003183912 248
209 3300005365 Ga0070688_100064967 Ga0070688_1000649672 248
210 3300005367 Ga0070667_100012652 Ga0070667_1000126522 248
211 3300005367 Ga0070667_100088981 Ga0070667_1000889812 248
212 3300005367 Ga0070667_100662572 Ga0070667_1006625721 248
213 3300005441 Ga0070700_100188230 Ga0070700_1001882302 248
214 3300005456 Ga0070678_100219182 Ga0070678_1002191822 248
215 3300005456 Ga0070678_100605277 Ga0070678_1006052772 248
216 3300005457 Ga0070662_100130688 Ga0070662_1001306881 248
217 3300005458 Ga0070681_10156932 Ga0070681_101569322 248
218 3300005459 Ga0068867_100041345 Ga0068867_1000413452 248
219 3300005459 Ga0068867_100047671 Ga0068867_1000476712 248
220 3300005459 Ga0068867_100194056 Ga0068867_1001940562 248
221 3300005466 Ga0070685_10043185 Ga0070685_100431852 248
222 3300005466 Ga0070685_10073491 Ga0070685_100734912 248
223 3300005471 Ga0070698_100011420 Ga0070698_1000114209 248
224 3300005471 Ga0070698_100022946 Ga0070698_1000229464 248
225 3300005530 Ga0070679_100005519 Ga0070679_1000055198 248
226 3300005539 Ga0068853_100111609 Ga0068853_1001116092 248
227 3300005539 Ga0068853_100251741 Ga0068853_1002517412 248
228 3300005543 Ga0070672_100135674 Ga0070672_1001356742 248
229 3300005543 Ga0070672_100443126 Ga0070672_1004431261 248
230 3300005544 Ga0070686_100246251 Ga0070686_1002462512 248
231 3300005547 Ga0070693_100162900 Ga0070693_1001629001 248
232 3300005549 Ga0070704_100091482 Ga0070704_1000914822 248
233 3300005564 Ga0070664_100172135 Ga0070664_1001721353 248
234 3300005564 Ga0070664_100261013 Ga0070664_1002610133 248
235 3300005577 Ga0068857_100153559 Ga0068857_1001535592 248
236 3300005614 Ga0068856_100067320 Ga0068856_1000673203 248
237 3300005615 Ga0070702_100024659 Ga0070702_1000246593 248
238 3300005615 Ga0070702_100435577 Ga0070702_1004355772 248
239 3300005616 Ga0068852_100064606 Ga0068852_1000646064 248
240 3300005616 Ga0068852_100127696 Ga0068852_1001276962 248
241 3300005616 Ga0068852_100488057 Ga0068852_1004880571 248
242 3300005617 Ga0068859_100000037 Ga0068859_10000003781 248
243 3300005617 Ga0068859_100096869 Ga0068859_1000968693 248
244 3300005617 Ga0068859_100120669 Ga0068859_1001206692 248
245 3300005618 Ga0068864_100025936 Ga0068864_1000259364 248
246 3300005618 Ga0068864_100062990 Ga0068864_1000629902 248
247 3300005618 Ga0068864_100242086 Ga0068864_1002420862 248
248 3300005718 Ga0068866_10201803 Ga0068866_102018031 248
249 3300005719 Ga0068861_100270208 Ga0068861_1002702082 248
250 3300005719 Ga0068861_100717598 Ga0068861_1007175981 248
251 3300005834 Ga0068851_10028130 Ga0068851_100281302 248
252 3300005840 Ga0068870_10038689 Ga0068870_100386892 248
253 3300005841 Ga0068863_100002211 Ga0068863_10000221113 248
254 3300005841 Ga0068863_100005947 Ga0068863_1000059479 248
255 3300005841 Ga0068863_100067910 Ga0068863_1000679102 248
256 3300005841 Ga0068863_100674340 Ga0068863_1006743401 248
257 3300005842 Ga0068858_100096934 Ga0068858_1000969342 248
258 3300005842 Ga0068858_100235124 Ga0068858_1002351242 248
259 3300005842 Ga0068858_100250828 Ga0068858_1002508282 248
260 3300005843 Ga0068860_100040280 Ga0068860_1000402802 248
261 3300005843 Ga0068860_100045872 Ga0068860_1000458722 248
262 3300005843 Ga0068860_100661646 Ga0068860_1006616462 248
263 3300005844 Ga0068862_100491361 Ga0068862_1004913612 248
264 3300005844 Ga0068862_100502131 Ga0068862_1005021312 248
265 3300005985 Ga0081539_10001239 Ga0081539_100012395 248
266 3300006163 Ga0070715_10031156 Ga0070715_100311562 248
267 3300006237 Ga0097621_100010400 Ga0097621_1000104007 248
268 3300006237 Ga0097621_100049240 Ga0097621_1000492403 248
269 3300006237 Ga0097621_100154709 Ga0097621_1001547092 248
270 3300006237 Ga0097621_100337054 Ga0097621_1003370542 248
271 3300006358 Ga0068871_100007843 Ga0068871_1000078432 248
272 3300006358 Ga0068871_100130259 Ga0068871_1001302592 248
273 3300006358 Ga0068871_100199199 Ga0068871_1001991992 248
274 3300006358 Ga0068871_100591265 Ga0068871_1005912651 248
275 3300006844 Ga0075428_100017249 Ga0075428_1000172494 248
276 3300006846 Ga0075430_100083801 Ga0075430_1000838013 248
277 3300006880 Ga0075429_100010519 Ga0075429_1000105197 248
278 3300006931 Ga0097620_100000037 Ga0097620_10000003781 248
279 3300006931 Ga0097620_100096868 Ga0097620_1000968682 248
280 3300006931 Ga0097620_100120670 Ga0097620_1001206702 248
281 3300009094 Ga0111539_10176563 Ga0111539_101765632 248
282 3300009094 Ga0111539_10293717 Ga0111539_102937172 248
283 3300009098 Ga0105245_10115700 Ga0105245_101157002 248
284 3300009101 Ga0105247_10045013 Ga0105247_100450132 248
285 3300009147 Ga0114129_10186992 Ga0114129_101869922 248
286 3300009147 Ga0114129_10485767 Ga0114129_104857672 248
287 3300009148 Ga0105243_10162607 Ga0105243_101626071 248
288 3300009174 Ga0105241_10000159 Ga0105241_1000015937 248
289 3300009174 Ga0105241_10387149 Ga0105241_103871492 248
290 3300009176 Ga0105242_10031430 Ga0105242_100314302 248
291 3300009176 Ga0105242_10103348 Ga0105242_101033484 248
292 3300009176 Ga0105242_10209003 Ga0105242_102090032 248
293 3300009176 Ga0105242_10245117 Ga0105242_102451172 248
294 3300009545 Ga0105237_10014682 Ga0105237_100146824 248
295 3300009553 Ga0105249_10002398 Ga0105249_100023983 248
296 3300009553 Ga0105249_10007603 Ga0105249_100076033 248
297 3300009553 Ga0105249_10013878 Ga0105249_100138783 248
298 3300009553 Ga0105249_10019740 Ga0105249_100197403 248
299 3300009553 Ga0105249_10304302 Ga0105249_103043022 248
300 3300009553 Ga0105249_10397742 Ga0105249_103977421 248
301 3300010375 Ga0105239_10026755 Ga0105239_100267552 248
302 3300010375 Ga0105239_10104621 Ga0105239_101046213 248
303 3300011119 Ga0105246_10352702 Ga0105246_103527021 248
304 3300011119 Ga0105246_10424774 Ga0105246_104247741 248
305 3300013102 Ga0157371_10033141 Ga0157371_100331412 248
306 3300013102 Ga0157371_10036031 Ga0157371_100360312 248
307 3300013102 Ga0157371_10078051 Ga0157371_100780513 248
308 3300013102 Ga0157371_10197257 Ga0157371_101972572 248
309 3300013102 Ga0157371_10441711 Ga0157371_104417111 248
310 3300013104 Ga0157370_10108806 Ga0157370_101088064 248
311 3300013104 Ga0157370_10126478 Ga0157370_101264782 248
312 3300013104 Ga0157370_10294064 Ga0157370_102940642 248
313 3300013105 Ga0157369_10094314 Ga0157369_100943143 248
314 3300013296 Ga0157374_10008926 Ga0157374_100089266 248
315 3300013296 Ga0157374_10436166 Ga0157374_104361661 248
316 3300013297 Ga0157378_10005941 Ga0157378_100059415 248
317 3300013297 Ga0157378_10051470 Ga0157378_100514702 248
318 3300013297 Ga0157378_10217250 Ga0157378_102172502 248
319 3300013306 Ga0163162_10000487 Ga0163162_1000048718 248
320 3300013306 Ga0163162_10536691 Ga0163162_105366912 248
321 3300013307 Ga0157372_10091773 Ga0157372_100917732 248
322 3300013308 Ga0157375_10122996 Ga0157375_101229961 248
323 3300013308 Ga0157375_10128320 Ga0157375_101283203 248
324 3300013308 Ga0157375_10350511 Ga0157375_103505111 248
325 3300013308 Ga0157375_10716578 Ga0157375_107165782 248
326 3300014325 Ga0163163_10768544 Ga0163163_107685442 248
327 3300014968 Ga0157379_10108300 Ga0157379_101083003 248
328 3300014968 Ga0157379_10357846 Ga0157379_103578462 248
329 3300017792 Ga0163161_10330084 Ga0163161_103300842 248
330 3300025298 Ga0209050_1000989 Ga0209050_100098926 248
331 3300025298 Ga0209050_1015769 Ga0209050_10157693 248
332 3300025321 Ga0207656_10017321 Ga0207656_100173213 248
333 3300025321 Ga0207656_10029626 Ga0207656_100296262 248
334 3300025899 Ga0207642_10013318 Ga0207642_100133182 248
335 3300025900 Ga0207710_10022069 Ga0207710_100220692 248
336 3300025903 Ga0207680_10000122 Ga0207680_1000012220 248
337 3300025907 Ga0207645_10057362 Ga0207645_100573621 248
338 3300025907 Ga0207645_10143484 Ga0207645_101434843 248
339 3300025908 Ga0207643_10024812 Ga0207643_100248122 248
340 3300025909 Ga0207705_10036363 Ga0207705_100363632 248
341 3300025911 Ga0207654_10026288 Ga0207654_100262882 248
342 3300025912 Ga0207707_10177414 Ga0207707_101774142 248
343 3300025914 Ga0207671_10003723 Ga0207671_100037238 248
344 3300025918 Ga0207662_10026054 Ga0207662_100260542 248
345 3300025919 Ga0207657_10017950 Ga0207657_100179502 248
346 3300025920 Ga0207649_10224356 Ga0207649_102243561 248
347 3300025921 Ga0207652_10007852 Ga0207652_100078523 248
348 3300025923 Ga0207681_10060290 Ga0207681_100602902 248
349 3300025923 Ga0207681_10280673 Ga0207681_102806731 248
350 3300025926 Ga0207659_10123514 Ga0207659_101235142 248
351 3300025926 Ga0207659_10296946 Ga0207659_102969462 248
352 3300025927 Ga0207687_10197123 Ga0207687_101971231 248
353 3300025931 Ga0207644_10033175 Ga0207644_100331753 248
354 3300025931 Ga0207644_10045831 Ga0207644_100458312 248
355 3300025931 Ga0207644_10115728 Ga0207644_101157281 248
356 3300025933 Ga0207706_10010977 Ga0207706_100109776 248
357 3300025934 Ga0207686_10003640 Ga0207686_100036402 248
358 3300025934 Ga0207686_10285917 Ga0207686_102859172 248
359 3300025936 Ga0207670_10064016 Ga0207670_100640162 248
360 3300025936 Ga0207670_10090931 Ga0207670_100909313 248
361 3300025940 Ga0207691_10113863 Ga0207691_101138632 248
362 3300025942 Ga0207689_10004894 Ga0207689_100048949 248
363 3300025942 Ga0207689_10047182 Ga0207689_100471822 248
364 3300025942 Ga0207689_10246664 Ga0207689_102466643 248
365 3300025944 Ga0207661_10214555 Ga0207661_102145552 248
366 3300025949 Ga0207667_10770511 Ga0207667_107705111 248
367 3300025961 Ga0207712_10011304 Ga0207712_100113043 248
368 3300025961 Ga0207712_10029679 Ga0207712_100296794 248
369 3300025961 Ga0207712_10232842 Ga0207712_102328421 248
370 3300025961 Ga0207712_10260393 Ga0207712_102603931 248
371 3300025961 Ga0207712_10273103 Ga0207712_102731031 248
372 3300025972 Ga0207668_10095268 Ga0207668_100952682 248
373 3300025986 Ga0207658_10008077 Ga0207658_100080775 248
374 3300025986 Ga0207658_10080101 Ga0207658_100801013 248
375 3300025986 Ga0207658_10184369 Ga0207658_101843691 248
376 3300025986 Ga0207658_10598162 Ga0207658_105981621 248
377 3300026023 Ga0207677_10139955 Ga0207677_101399552 248
378 3300026023 Ga0207677_10151466 Ga0207677_101514663 248
379 3300026035 Ga0207703_10019895 Ga0207703_100198952 248
380 3300026035 Ga0207703_10087286 Ga0207703_100872862 248
381 3300026041 Ga0207639_10260899 Ga0207639_102608992 248
382 3300026041 Ga0207639_10466649 Ga0207639_104666491 248
383 3300026075 Ga0207708_10314472 Ga0207708_103144722 248
384 3300026088 Ga0207641_10000121 Ga0207641_1000012131 248
385 3300026088 Ga0207641_10001301 Ga0207641_1000130121 248
386 3300026088 Ga0207641_10003302 Ga0207641_100033025 248
387 3300026088 Ga0207641_10035611 Ga0207641_100356112 248
388 3300026088 Ga0207641_10038120 Ga0207641_100381203 248
389 3300026088 Ga0207641_10258659 Ga0207641_102586593 248
390 3300026089 Ga0207648_10013112 Ga0207648_100131121 248
391 3300026089 Ga0207648_10021837 Ga0207648_100218374 248
392 3300026089 Ga0207648_10034182 Ga0207648_100341822 248
393 3300026089 Ga0207648_10050449 Ga0207648_100504493 248
394 3300026089 Ga0207648_10161015 Ga0207648_101610152 248
395 3300026095 Ga0207676_10059186 Ga0207676_100591862 248
396 3300026095 Ga0207676_10062111 Ga0207676_100621114 248
397 3300026095 Ga0207676_10149543 Ga0207676_101495433 248
398 3300026116 Ga0207674_10125325 Ga0207674_101253252 248
399 3300026116 Ga0207674_10490320 Ga0207674_104903201 248
400 3300026116 Ga0207674_10538060 Ga0207674_105380601 248
401 3300026118 Ga0207675_100163159 Ga0207675_1001631592 248
402 3300026118 Ga0207675_100230331 Ga0207675_1002303312 248
403 3300026118 Ga0207675_100538636 Ga0207675_1005386362 248
404 3300026121 Ga0207683_10027397 Ga0207683_100273973 248
405 3300026121 Ga0207683_10177190 Ga0207683_101771902 248
406 3300026121 Ga0207683_10291352 Ga0207683_102913521 248
407 3300026142 Ga0207698_10010111 Ga0207698_100101112 248
408 3300026142 Ga0207698_10092929 Ga0207698_100929292 248
409 3300026142 Ga0207698_10166809 Ga0207698_101668092 248
410 3300026142 Ga0207698_10402819 Ga0207698_104028192 248
411 3300028380 Ga0268265_10093699 Ga0268265_100936992 248
412 3300028381 Ga0268264_10002776 Ga0268264_100027763 248
413 3300028381 Ga0268264_10009484 Ga0268264_100094844 248
414 3300031456 Ga0307513_10103815 Ga0307513_101038153 248
415 3300031852 Ga0307410_10166094 Ga0307410_101660942 248
416 3300031911 Ga0307412_10186807 Ga0307412_101868072 248
417 3300037418 Ga0395900_0063578 Ga0395900_0063578_105_851 248
418 3300037466 Ga0395898_0738358 Ga0395898_0738358_63_809 248
419 3300037471 Ga0395905_0179136 Ga0395905_0179136_549_1298 248
420 3300037471 Ga0395905_0553647 Ga0395905_0553647_73_981 248
421 3300041486 Ga0451807_1106349 Ga0451807_1106349_1693_2442 248
422 3300042435 Ga0439434_0118285 Ga0439434_0118285_21_827 248
423 3300044658 Ga0466972_0003123 Ga0466972_0003123_4560_5324 248
424 3300044712 Ga0453684_0023448 Ga0453684_0023448_3596_4342 248
425 3300046460 Ga0495638_0000026 Ga0495638_0000026_57688_58482 248
426 3300047320 Ga0495672_0006383 Ga0495672_0006383_4421_5236 248
427 3300047320 Ga0495672_0018193 Ga0495672_0018193_2544_3359 248
428 3300049588 Ga0501072_0022114 Ga0501072_0022114_3424_4245 248
429 3300050493 nmdc:mga0k408_129555_c1 nmdc:mga0k408_129555_c1_470_1228 248
430 3300050508 nmdc:mga09592_72379_c1 nmdc:mga09592_72379_c1_2120_2887 248
431 3300050509 nmdc:mga0qj67_82492_c1 nmdc:mga0qj67_82492_c1_1727_2494 248
432 3300053096 Ga0500641_0021226 Ga0500641_0021226_531_1295 248
433 3300053153 Ga0500616_0000004 Ga0500616_0000004_174371_175165 248
434 3300053727 Ga0500611_000006 Ga0500611_000006_52330_53136 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

101

193

0.91

PF08241

Methyltransf_11

Methyltransferase domain

102

197

0.88

PF03848

TehB

Tellurite resistance protein TehB

66

193

0.8

PF13489

Methyltransf_23

Methyltransferase domain

74

242

0.76

PF13847

Methyltransf_31

Methyltransferase domain

95

238

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8988 32 146
4kri-assembly2.cif.gz_B haemonchus contortus phospholethanolamine n-methyltransferase 2 in complex with phosphomonomethylethanolamine and s-adenosylhomocysteine 0.8604 31 145
4kri-assembly1.cif.gz_A haemonchus contortus phospholethanolamine n-methyltransferase 2 in complex with phosphomonomethylethanolamine and s-adenosylhomocysteine 0.8603 31 145
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.8433 28 246
6gkz-assembly2.cif.gz_C crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8406 28 146
ID Description Score Start End Superfamily
af_Q4CMB6_37_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8929 29 94 3.40.50.150
3egeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8928 32 146 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8785 33 145 3.40.50.150
af_Q9TYP1_15_268_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8733 29 143 3.40.50.150
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8693 27 248 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3M9N4G5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9662 1 245 GO:0008168
GO:0032259
AF-A0A3D0N0U3-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9626 97 246
AF-A0A520A6I0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9624 68 246 GO:0008168
GO:0032259
AF-A0A7M3N1L8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9614 2 248 GO:0008168
GO:0032259
AF-A0A2D5JLW0-F1-model_v4 SAM-dependent methyltransferase 0.9613 2 247 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.87 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map