metagRoot

F443172

General Info

Members	Datasets	Scaffolds	Average Seq Length
434	268	434	125

Family's Representative Sequence

Representative Sequence	3300048088\|Ga0495602_0042794\|Ga0495602_0042794_2969_3421
Length	150
Sequence	MANPGFHNATVGYAEGSVSTQSEKGDDMGQPVVHFEVIGKDGEKLQSYYAELFDWKVDAGNEMGYGLVDREANSNADGIGLGGGIGQSPEGYGGHVTFYVEVPSVEEALSRAESLGGTRVMGPETIMGRMVLGQFTDPEGNVIGLIEGGS

Samples

	Sample ID	Description	Type	Environment
1	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
2	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
6	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
7	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
8	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
9	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
12	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
13	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
14	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
15	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
20	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
21	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
22	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
23	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
24	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
25	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
26	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
31	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
32	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
33	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
34	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
40	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
41	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
44	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
45	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
46	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
47	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
48	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
49	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
50	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
51	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
54	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
55	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
56	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
57	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
58	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
59	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
60	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
61	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
62	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
63	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
65	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
66	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
67	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
68	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
69	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
70	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
71	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
72	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
73	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
74	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
75	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
79	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
80	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
81	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
82	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
83	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
84	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
85	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
86	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
87	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
88	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
89	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
90	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
91	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
92	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
93	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
94	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
95	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
96	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
146	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
150	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
151	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
152	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
153	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
154	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
155	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
156	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
157	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
158	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
159	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
160	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
161	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
162	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
163	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
164	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
165	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
166	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
167	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
168	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
169	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
170	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
171	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
172	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
173	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
174	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
175	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
176	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
177	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
178	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
179	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
180	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
181	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
182	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
183	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
184	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
185	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
186	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
187	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
188	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
189	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
190	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
191	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
192	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
193	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
194	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
195	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
196	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
197	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
198	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
199	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
200	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
201	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
202	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
203	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
204	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
205	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
206	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
207	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
208	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
209	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
210	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
211	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
212	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
213	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
214	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
215	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
216	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
217	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
218	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
219	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
220	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
221	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
222	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
223	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
224	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
225	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
226	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
227	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
228	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
229	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
230	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
231	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
232	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
233	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
234	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
235	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
236	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
237	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
238	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
239	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
240	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
241	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
242	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
243	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
244	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
245	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
246	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
247	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
248	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
249	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
250	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
251	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
252	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
253	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
254	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
255	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
256	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
257	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
258	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
259	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
260	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
261	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
262	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
263	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
264	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
265	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
266	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
267	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
268	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.77
Metatranscriptomes	0.23
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.61
Nodule	0
Rhizoplane	14.75
Rhizosphere	82.49
Stem	0
Stem Tuber	0
Unclassified	1.15

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24747J21853_1022969	3300001978	Unclassified	687
2	JGI25405J52794_10058350	3300003911	Bacteria	833
3	Ga0070683_100896255	3300005329	Bacteria	851
4	Ga0070683_102078660	3300005329	Bacteria	546
5	Ga0070690_100197552	3300005330	Bacteria	1398
6	Ga0070690_100599783	3300005330	Bacteria	836
7	Ga0070670_100705947	3300005331	Bacteria	907
8	Ga0070680_100599173	3300005336	Unclassified	946
9	Ga0070682_100017237	3300005337	Bacteria	4209
10	Ga0070682_100159117	3300005337	Bacteria	1558
11	Ga0068868_100000008	3300005338	Bacteria	121926
12	Ga0070660_100321726	3300005339	Bacteria	1271
13	Ga0070689_100395104	3300005340	Bacteria	1168
14	Ga0070691_10058984	3300005341	Bacteria	1843
15	Ga0070691_10067558	3300005341	Bacteria	1729
16	Ga0070691_10350427	3300005341	Unclassified	820
17	Ga0070661_101148278	3300005344	Bacteria	648
18	Ga0070692_10042483	3300005345	Bacteria	2334
19	Ga0070668_100084454	3300005347	Bacteria	2494
20	Ga0070668_100123991	3300005347	Bacteria	2068
21	Ga0070671_101168493	3300005355	Bacteria	677
22	Ga0070674_100025098	3300005356	Bacteria	3876
23	Ga0070674_100037319	3300005356	Bacteria	3268
24	Ga0070673_100050446	3300005364	Bacteria	3254
25	Ga0070673_101076016	3300005364	Bacteria	751
26	Ga0070659_100017159	3300005366	Bacteria	5442
27	Ga0070659_100079660	3300005366	Bacteria	2614
28	Ga0070709_10105840	3300005434	Bacteria	1882
29	Ga0070709_10693860	3300005434	Bacteria	791
30	Ga0070709_10856849	3300005434	Bacteria	716
31	Ga0070714_100022572	3300005435	Bacteria	5160
32	Ga0070714_102247184	3300005435	Bacteria	531
33	Ga0070713_100140569	3300005436	Bacteria	2138
34	Ga0070713_100170069	3300005436	Bacteria	1952
35	Ga0070710_10077459	3300005437	Bacteria	1932
36	Ga0070710_10153449	3300005437	Unclassified	1422
37	Ga0070710_10197760	3300005437	Bacteria	1267
38	Ga0070710_10369442	3300005437	Unclassified	954
39	Ga0070701_10259298	3300005438	Bacteria	1053
40	Ga0070701_10268761	3300005438	Bacteria	1036
41	Ga0070711_100330904	3300005439	Bacteria	1219
42	Ga0070705_100015067	3300005440	Bacteria	3989
43	Ga0070705_100166105	3300005440	Bacteria	1480
44	Ga0070705_100423286	3300005440	Bacteria	992
45	Ga0070705_101130907	3300005440	Bacteria	642
46	Ga0070700_100290318	3300005441	Unclassified	1189
47	Ga0070708_100087938	3300005445	Bacteria	2824
48	Ga0070708_100836773	3300005445	Bacteria	865
49	Ga0070663_100257600	3300005455	Bacteria	1383
50	Ga0070678_100031124	3300005456	Bacteria	3676
51	Ga0070678_100083700	3300005456	Bacteria	2426
52	Ga0070678_100127808	3300005456	Bacteria	2014
53	Ga0070662_100085461	3300005457	Bacteria	2358
54	Ga0070681_10019928	3300005458	Bacteria	6719
55	Ga0070681_10548336	3300005458	Bacteria	1070
56	Ga0068867_100061182	3300005459	Bacteria	2795
57	Ga0068867_100877632	3300005459	Bacteria	805
58	Ga0070706_100048871	3300005467	Bacteria	3904
59	Ga0070698_100610269	3300005471	Bacteria	1031
60	Ga0070699_100039479	3300005518	Bacteria	4087
61	Ga0070679_100065195	3300005530	Bacteria	3630
62	Ga0070679_100164044	3300005530	Bacteria	2196
63	Ga0070684_100223795	3300005535	Bacteria	1717
64	Ga0070684_101327809	3300005535	Bacteria	677
65	Ga0070684_101742921	3300005535	Bacteria	588
66	Ga0068853_100200561	3300005539	Bacteria	1815
67	Ga0070695_100043429	3300005545	Bacteria	2858
68	Ga0070695_101035710	3300005545	Unclassified	669
69	Ga0070696_100045249	3300005546	Bacteria	3049
70	Ga0070696_100374199	3300005546	Bacteria	1108
71	Ga0070693_100016952	3300005547	Bacteria	3778
72	Ga0070693_100080569	3300005547	Bacteria	1940
73	Ga0070693_100249379	3300005547	Bacteria	1176
74	Ga0070665_100990091	3300005548	Bacteria	853
75	Ga0070665_101519918	3300005548	Bacteria	678
76	Ga0070704_100228548	3300005549	Bacteria	1516
77	Ga0068855_100093741	3300005563	Bacteria	3462
78	Ga0068857_100413317	3300005577	Bacteria	1257
79	Ga0068854_100050431	3300005578	Bacteria	2978
80	Ga0068856_100039808	3300005614	Bacteria	4615
81	Ga0068856_100346421	3300005614	Bacteria	1504
82	Ga0068856_100481650	3300005614	Bacteria	1262
83	Ga0068856_101215792	3300005614	Bacteria	770
84	Ga0070702_100109672	3300005615	Bacteria	1709
85	Ga0070702_101446083	3300005615	Bacteria	563
86	Ga0070702_101456345	3300005615	Bacteria	562
87	Ga0068852_100280701	3300005616	Unclassified	1605
88	Ga0068864_100519000	3300005618	Bacteria	1148
89	Ga0068866_10085591	3300005718	Bacteria	1704
90	Ga0068861_100156607	3300005719	Bacteria	1875
91	Ga0068861_100375734	3300005719	Bacteria	1254
92	Ga0081455_10002444	3300005937	Bacteria	22139
93	Ga0081455_10094874	3300005937	Bacteria	2409
94	Ga0081455_10208448	3300005937	Bacteria	1458
95	Ga0081540_1005740	3300005983	Bacteria	9200
96	Ga0081540_1006073	3300005983	Bacteria	8878
97	Ga0070717_10065445	3300006028	Bacteria	3022
98	Ga0075365_10027490	3300006038	Bacteria	3621
99	Ga0075364_10050380	3300006051	Bacteria	2718
100	Ga0075432_10027773	3300006058	Bacteria	1949
101	Ga0070715_10013812	3300006163	Bacteria	2975
102	Ga0070716_100730635	3300006173	Bacteria	759
103	Ga0070712_100029296	3300006175	Bacteria	3689
104	Ga0075367_10349056	3300006178	Bacteria	934
105	Ga0097621_100017415	3300006237	Bacteria	5455
106	Ga0068871_100175085	3300006358	Bacteria	1841
107	Ga0075428_100343113	3300006844	Bacteria	1603
108	Ga0075431_100943116	3300006847	Bacteria	831
109	Ga0075433_10000047	3300006852	Bacteria	50752
110	Ga0075433_10502159	3300006852	Bacteria	1067
111	Ga0075433_10747606	3300006852	Bacteria	855
112	Ga0075434_100808705	3300006871	Bacteria	953
113	Ga0068865_100096074	3300006881	Bacteria	2160
114	Ga0068865_100146332	3300006881	Unclassified	1787
115	Ga0068865_101877408	3300006881	Bacteria	542
116	Ga0075436_100002978	3300006914	Bacteria	11589
117	Ga0075435_100075041	3300007076	Bacteria	2768
118	Ga0075435_100635170	3300007076	Bacteria	926
119	Ga0105250_10286181	3300009092	Unclassified	710
120	Ga0105245_10203389	3300009098	Bacteria	1903
121	Ga0105245_10220765	3300009098	Bacteria	1829
122	Ga0105245_10872339	3300009098	Bacteria	941
123	Ga0105247_10000516	3300009101	Bacteria	31677
124	Ga0114129_10114316	3300009147	Bacteria	3721
125	Ga0105243_10121572	3300009148	Unclassified	2202
126	Ga0105243_10435794	3300009148	Bacteria	1226
127	Ga0105241_10051814	3300009174	Bacteria	3131
128	Ga0105241_10264634	3300009174	Bacteria	1462
129	Ga0105248_11396977	3300009177	Unclassified	792
130	Ga0105237_10778258	3300009545	Bacteria	964
131	Ga0105249_10062959	3300009553	Bacteria	3406
132	Ga0105239_10367697	3300010375	Bacteria	1625
133	Ga0105239_10538821	3300010375	Unclassified	1329
134	Ga0105239_10626821	3300010375	Unclassified	1227
135	Ga0105239_12132806	3300010375	Unclassified	651
136	Ga0105246_10697622	3300011119	Bacteria	889
137	Ga0105246_11510038	3300011119	Bacteria	631
138	Ga0157316_1001777	3300012510	Bacteria	1390
139	Ga0157371_10167629	3300013102	Bacteria	1569
140	Ga0157378_10070901	3300013297	Bacteria	3129
141	Ga0157378_11060476	3300013297	Unclassified	846
142	Ga0157378_11109106	3300013297	Unclassified	828
143	Ga0163162_10249006	3300013306	Bacteria	1909
144	Ga0163162_11340522	3300013306	Bacteria	813
145	Ga0157372_10050308	3300013307	Bacteria	4636
146	Ga0157375_10008980	3300013308	Bacteria	8747
147	Ga0157375_10195010	3300013308	Unclassified	2180
148	Ga0157375_10612812	3300013308	Bacteria	1247
149	Ga0157375_13130628	3300013308	Bacteria	552
150	Ga0163163_10085658	3300014325	Bacteria	3159
151	Ga0157380_10009946	3300014326	Bacteria	6825
152	Ga0157380_10030397	3300014326	Bacteria	4136
153	Ga0157377_10403279	3300014745	Unclassified	932
154	Ga0157376_10030574	3300014969	Bacteria	4301
155	Ga0157376_11104288	3300014969	Unclassified	819
156	Ga0182005_1274313	3300015265	Unclassified	528
157	Ga0163161_10000018	3300017792	Bacteria	228801
158	Ga0163161_10139343	3300017792	Bacteria	1836
159	Ga0206354_11111355	3300020081	Bacteria	603
160	Ga0207653_10022624	3300025885	Unclassified	1998
161	Ga0207692_10193165	3300025898	Bacteria	1193
162	Ga0207692_10222891	3300025898	Bacteria	1119
163	Ga0207692_10269555	3300025898	Unclassified	1026
164	Ga0207642_10149691	3300025899	Unclassified	1241
165	Ga0207710_10000276	3300025900	Bacteria	41913
166	Ga0207680_10193556	3300025903	Bacteria	1382
167	Ga0207685_10422425	3300025905	Bacteria	688
168	Ga0207699_10206706	3300025906	Bacteria	1333
169	Ga0207645_10108254	3300025907	Bacteria	1798
170	Ga0207684_10028474	3300025910	Bacteria	4760
171	Ga0207654_10075309	3300025911	Bacteria	2017
172	Ga0207695_11083990	3300025913	Bacteria	681
173	Ga0207693_10013159	3300025915	Bacteria	6675
174	Ga0207693_10014565	3300025915	Bacteria	6319
175	Ga0207663_10125751	3300025916	Bacteria	1763
176	Ga0207663_10129860	3300025916	Bacteria	1739
177	Ga0207660_10757386	3300025917	Unclassified	792
178	Ga0207662_10125064	3300025918	Bacteria	1616
179	Ga0207657_10029923	3300025919	Bacteria	4949
180	Ga0207681_10542563	3300025923	Unclassified	956
181	Ga0207681_10842630	3300025923	Bacteria	767
182	Ga0207687_10160451	3300025927	Bacteria	1725
183	Ga0207687_10648082	3300025927	Bacteria	893
184	Ga0207700_10038191	3300025928	Bacteria	3484
185	Ga0207700_10055555	3300025928	Bacteria	2977
186	Ga0207664_10144757	3300025929	Bacteria	2014
187	Ga0207664_10359259	3300025929	Bacteria	1290
188	Ga0207664_11956815	3300025929	Bacteria	509
189	Ga0207690_10420966	3300025932	Bacteria	1068
190	Ga0207690_10523992	3300025932	Bacteria	961
191	Ga0207706_10013953	3300025933	Bacteria	7285
192	Ga0207686_11290451	3300025934	Unclassified	599
193	Ga0207670_10376104	3300025936	Bacteria	1130
194	Ga0207669_10018029	3300025937	Bacteria	3637
195	Ga0207669_10630559	3300025937	Bacteria	874
196	Ga0207704_10490552	3300025938	Bacteria	988
197	Ga0207704_10885886	3300025938	Bacteria	750
198	Ga0207665_10001453	3300025939	Bacteria	15941
199	Ga0207691_10431207	3300025940	Bacteria	1123
200	Ga0207689_10059853	3300025942	Bacteria	3133
201	Ga0207661_10197964	3300025944	Bacteria	1765
202	Ga0207661_10555398	3300025944	Bacteria	1052
203	Ga0207679_10412810	3300025945	Bacteria	1190
204	Ga0207679_10956952	3300025945	Bacteria	784
205	Ga0207679_11942853	3300025945	Bacteria	536
206	Ga0207667_12015493	3300025949	Unclassified	537
207	Ga0207651_10196290	3300025960	Bacteria	1614
208	Ga0207712_10309874	3300025961	Bacteria	1299
209	Ga0207712_10954529	3300025961	Unclassified	759
210	Ga0207712_11436216	3300025961	Bacteria	617
211	Ga0207668_10467906	3300025972	Bacteria	1079
212	Ga0207668_10685597	3300025972	Bacteria	899
213	Ga0207640_10227718	3300025981	Bacteria	1432
214	Ga0207677_10000751	3300026023	Bacteria	18691
215	Ga0207677_10350212	3300026023	Bacteria	1237
216	Ga0207677_10588867	3300026023	Bacteria	975
217	Ga0207639_10192882	3300026041	Bacteria	1741
218	Ga0207678_10003968	3300026067	Bacteria	13313
219	Ga0207708_10979570	3300026075	Bacteria	734
220	Ga0207702_10088586	3300026078	Bacteria	2704
221	Ga0207702_10507005	3300026078	Bacteria	1177
222	Ga0207702_11329800	3300026078	Bacteria	713
223	Ga0207702_11589802	3300026078	Bacteria	647
224	Ga0207648_10011438	3300026089	Bacteria	8359
225	Ga0207648_10081966	3300026089	Bacteria	2813
226	Ga0207676_10540028	3300026095	Bacteria	1112
227	Ga0207675_100010019	3300026118	Bacteria	8881
228	Ga0207675_100435851	3300026118	Bacteria	1296
229	Ga0207683_10001817	3300026121	Bacteria	18865
230	Ga0207683_10062902	3300026121	Bacteria	3269
231	Ga0207683_10172458	3300026121	Bacteria	1959
232	Ga0207698_10250386	3300026142	Unclassified	1621
233	Ga0210000_1026647	3300027462	Bacteria	897
234	Ga0209966_1035268	3300027695	Bacteria	1026
235	Ga0209974_10183570	3300027876	Bacteria	767
236	Ga0207428_10020923	3300027907	Bacteria	5547
237	Ga0268266_10995642	3300028379	Bacteria	811
238	Ga0268266_11017499	3300028379	Unclassified	802
239	Ga0268265_10018207	3300028380	Bacteria	4865
240	Ga0268265_10774410	3300028380	Bacteria	933
241	Ga0268264_10222448	3300028381	Bacteria	1738
242	Ga0268264_10573204	3300028381	Bacteria	1109
243	Ga0307408_100530391	3300031548	Unclassified	1036
244	Ga0307405_11027460	3300031731	Bacteria	705
245	Ga0307410_11718838	3300031852	Unclassified	556
246	Ga0307406_10039171	3300031901	Bacteria	2939
247	Ga0307409_100226847	3300031995	Bacteria	1690
248	Ga0307416_100388754	3300032002	Bacteria	1428
249	Ga0307416_102190639	3300032002	Bacteria	654
250	Ga0373930_0067744	3300034816	Bacteria	807
251	Ga0373948_0210067	3300034817	Bacteria	511
252	Ga0373938_0011691	3300034957	Bacteria	1637
253	Ga0373928_0035502	3300035084	Bacteria	1124
254	Ga0373929_0022177	3300035085	Bacteria	1294
255	Ga0373944_0181228	3300035089	Bacteria	755
256	Ga0373949_0025715	3300035090	Bacteria	1375
257	Ga0373936_0247265	3300035113	Bacteria	796
258	Ga0373939_0018775	3300035114	Bacteria	1858
259	Ga0373960_0047783	3300035121	Bacteria	1260
260	Ga0373943_0549759	3300035170	Bacteria	677
261	Ga0373961_0029235	3300035241	Bacteria	1525
262	Ga0373962_0030368	3300035242	Bacteria	1478
263	Ga0373931_0170675	3300035691	Bacteria	1281
264	Ga0373931_0182893	3300035691	Bacteria	1242
265	Ga0373927_0135277	3300035695	Bacteria	1611
266	Ga0373947_0029273	3300035725	Bacteria	3231
267	Ga0373937_0066358	3300036401	Bacteria	3323
268	Ga0395899_0026828	3300037312	Bacteria	4345
269	Ga0395899_0436790	3300037312	Unclassified	860
270	Ga0395900_0041527	3300037418	Bacteria	4741
271	Ga0395898_0025354	3300037466	Bacteria	5975
272	Ga0395898_0120907	3300037466	Bacteria	2509
273	Ga0395905_0022978	3300037471	Bacteria	5893
274	Ga0395905_0676751	3300037471	Bacteria	934
275	Ga0395901_0157789	3300038443	Bacteria	2382
276	Ga0395901_0295161	3300038443	Bacteria	1681
277	Ga0242420_056277	3300038996	Bacteria	777
278	Ga0451795_0910105	3300041456	Bacteria	644
279	Ga0451802_0591098	3300041460	Bacteria	1556
280	Ga0451847_0470698	3300041503	Unclassified	925
281	Ga0451853_3950848	3300041512	Unclassified	616
282	Ga0451853_4123673	3300041512	Bacteria	610
283	Ga0439455_0190120	3300042012	Bacteria	592
284	Ga0439459_0059998	3300042438	Bacteria	857
285	Ga0439464_0174743	3300042439	Bacteria	679
286	Ga0466966_0009738	3300044684	Bacteria	6367
287	Ga0466963_0803854	3300044694	Unclassified	663
288	Ga0466964_0010898	3300044706	Bacteria	3435
289	Ga0466960_0327821	3300044901	Bacteria	869
290	Ga0466958_0076332	3300045836	Bacteria	2057
291	Ga0466967_0989999	3300045976	Bacteria	837
292	Ga0495592_0036804	3300046454	Bacteria	3685
293	Ga0495592_0867306	3300046454	Unclassified	532
294	Ga0495603_0007182	3300046455	Bacteria	6689
295	Ga0495629_0034827	3300046459	Bacteria	3559
296	Ga0495629_0198439	3300046459	Bacteria	1388
297	Ga0495641_0009370	3300046461	Bacteria	5821
298	Ga0495651_0064169	3300046462	Bacteria	2807
299	Ga0495651_0180735	3300046462	Bacteria	1493
300	Ga0495580_0520850	3300046472	Bacteria	792
301	Ga0495582_0175416	3300046473	Bacteria	1221
302	Ga0495582_0340863	3300046473	Bacteria	863
303	Ga0495605_0183567	3300046474	Bacteria	919
304	Ga0495639_0253954	3300046475	Bacteria	870
305	Ga0495662_0001166	3300046476	Bacteria	12954
306	Ga0495584_0142292	3300046491	Bacteria	1218
307	Ga0495584_0334779	3300046491	Bacteria	769
308	Ga0495584_0473243	3300046491	Bacteria	638
309	Ga0495594_0000007	3300046499	Bacteria	160047
310	Ga0495594_0021917	3300046499	Bacteria	3413
311	Ga0495596_0294588	3300046500	Bacteria	631
312	Ga0495607_0319304	3300046501	Bacteria	725
313	Ga0495618_0238167	3300046514	Bacteria	1144
314	Ga0495618_0329763	3300046514	Unclassified	944
315	Ga0495628_0118427	3300046516	Bacteria	2033
316	Ga0495628_0522910	3300046516	Bacteria	854
317	Ga0495663_0131388	3300046525	Bacteria	845
318	Ga0495666_0011812	3300046526	Bacteria	4354
319	Ga0495642_0460989	3300046528	Bacteria	562
320	Ga0495652_0000003	3300046529	Bacteria	597094
321	Ga0495640_0023618	3300046533	Bacteria	4475
322	Ga0495587_0522332	3300046536	Bacteria	656
323	Ga0495609_0237809	3300046538	Bacteria	753
324	Ga0495609_0361342	3300046538	Bacteria	585
325	Ga0495621_0056954	3300046539	Bacteria	1410
326	Ga0495622_0000050	3300046557	Bacteria	106111
327	Ga0495634_0618349	3300046642	Unclassified	628
328	Ga0495611_0362281	3300046648	Bacteria	665
329	Ga0495635_0848204	3300046663	Unclassified	587
330	Ga0495588_0002365	3300046674	Bacteria	8069
331	Ga0495657_0005385	3300046675	Bacteria	10121
332	Ga0495599_0091102	3300046678	Bacteria	1902
333	Ga0495669_0091198	3300046684	Bacteria	1407
334	Ga0495613_0410312	3300046689	Bacteria	923
335	Ga0495670_0526575	3300046691	Bacteria	643
336	Ga0495589_0316297	3300046794	Unclassified	722
337	Ga0495589_0316337	3300046794	Bacteria	722
338	Ga0495600_0317636	3300046809	Bacteria	980
339	Ga0495581_0250746	3300047315	Bacteria	1035
340	Ga0495674_0000020	3300047319	Bacteria	178465
341	Ga0495676_0013636	3300047321	Bacteria	7296
342	Ga0495676_0027331	3300047321	Bacteria	4893
343	Ga0495680_0000952	3300047322	Bacteria	32176
344	Ga0495680_0022229	3300047322	Bacteria	5290
345	Ga0495680_0100046	3300047322	Bacteria	2161
346	Ga0495675_0049003	3300047444	Bacteria	2686
347	Ga0495685_008795	3300047447	Bacteria	3363
348	Ga0495684_0130343	3300047471	Bacteria	1889
349	Ga0495684_0137169	3300047471	Bacteria	1836
350	Ga0495684_0726341	3300047471	Unclassified	656
351	Ga0495684_0811683	3300047471	Unclassified	610
352	Ga0495602_0042794	3300048088	Bacteria	4123
353	Ga0496100_0000012	3300048903	Bacteria	182426
354	Ga0496100_0132114	3300048903	Bacteria	1760
355	Ga0496100_0222772	3300048903	Unclassified	1385
356	Ga0496100_0252219	3300048903	Bacteria	1305
357	Ga0496101_0000010	3300048904	Bacteria	281990
358	Ga0496101_0191152	3300048904	Bacteria	1580
359	Ga0496101_0377907	3300048904	Bacteria	1114
360	Ga0496102_0049806	3300048905	Bacteria	3812
361	Ga0496102_0057039	3300048905	Bacteria	3564
362	Ga0496102_0201278	3300048905	Bacteria	1877
363	Ga0496102_0404860	3300048905	Bacteria	1282
364	Ga0496102_0590016	3300048905	Bacteria	1034
365	Ga0496102_0644302	3300048905	Bacteria	983
366	Ga0496103_0056676	3300048906	Unclassified	2433
367	Ga0496103_0132766	3300048906	Bacteria	1590
368	Ga0496104_0000002	3300048907	Bacteria	686017
369	Ga0496104_0000461	3300048907	Bacteria	35063
370	Ga0496104_0001925	3300048907	Bacteria	17988
371	Ga0496104_0409349	3300048907	Bacteria	1269
372	Ga0496105_0000001	3300048908	Bacteria	1328178
373	Ga0496105_0000673	3300048908	Bacteria	22964
374	Ga0496105_0201922	3300048908	Bacteria	1622
375	Ga0496105_0233094	3300048908	Bacteria	1496
376	Ga0496105_0860614	3300048908	Bacteria	685
377	Ga0496106_0000017	3300048909	Bacteria	181561
378	Ga0496106_0644804	3300048909	Bacteria	846
379	Ga0496106_0649817	3300048909	Unclassified	843
380	Ga0496107_0000012	3300048910	Bacteria	181629
381	Ga0496107_0063673	3300048910	Bacteria	2672
382	Ga0496108_0001139	3300048911	Bacteria	20752
383	Ga0496108_0014399	3300048911	Bacteria	6457
384	Ga0496109_0007510	3300048912	Bacteria	9234
385	Ga0496109_0019323	3300048912	Bacteria	6004
386	Ga0496109_0209409	3300048912	Unclassified	1834
387	Ga0496109_0210845	3300048912	Bacteria	1827
388	Ga0496109_0576650	3300048912	Bacteria	1060
389	Ga0496110_0005455	3300048913	Bacteria	9976
390	Ga0496110_0039931	3300048913	Bacteria	4089
391	Ga0496110_0040529	3300048913	Bacteria	4058
392	Ga0496110_0102137	3300048913	Bacteria	2571
393	Ga0496110_0602507	3300048913	Bacteria	996
394	Ga0496111_0000183	3300048914	Bacteria	28637
395	Ga0496111_0061989	3300048914	Bacteria	2711
396	Ga0496111_0222245	3300048914	Bacteria	1403
397	Ga0496111_0379932	3300048914	Bacteria	1045
398	Ga0496111_0388043	3300048914	Bacteria	1032
399	Ga0496111_1150915	3300048914	Bacteria	551
400	Ga0496112_0008015	3300048915	Bacteria	9423
401	Ga0496112_0021354	3300048915	Bacteria	6156
402	Ga0496112_0185117	3300048915	Bacteria	2046
403	Ga0496112_0253127	3300048915	Bacteria	1712
404	Ga0496113_0001248	3300048916	Bacteria	13999
405	Ga0496113_0331023	3300048916	Bacteria	1221
406	Ga0496114_0000003	3300048917	Bacteria	630981
407	Ga0496114_0183598	3300048917	Bacteria	1827
408	Ga0496114_0253029	3300048917	Bacteria	1550
409	Ga0496114_0297479	3300048917	Bacteria	1425
410	Ga0496114_1404426	3300048917	Bacteria	585
411	Ga0496115_0000020	3300048918	Bacteria	171995
412	Ga0496115_0000036	3300048918	Bacteria	127774
413	Ga0496115_0160498	3300048918	Bacteria	1857
414	Ga0496115_0388827	3300048918	Bacteria	1133
415	Ga0496119_0023695	3300048922	Bacteria	4342
416	Ga0496120_0164310	3300048923	Bacteria	1103
417	Ga0501079_0392284	3300049741	Bacteria	1089
418	nmdc:mga00v17_15658_c1	3300050491	Bacteria	4259
419	nmdc:mga0yw44_140896_c1	3300050492	Bacteria	1567
420	nmdc:mga06z11_297813_c1	3300050494	Bacteria	958
421	nmdc:mga05p37_203551_c1	3300050507	Bacteria	2396
422	nmdc:mga05p37_612068_c1	3300050507	Bacteria	1227
423	nmdc:mga05p37_985782_c1	3300050507	Bacteria	897
424	nmdc:mga06r32_127446_c1	3300050510	Bacteria	2515
425	nmdc:mga08y16_109464_c1	3300050511	Bacteria	2877
426	nmdc:mga0n895_103702_c1	3300050512	Bacteria	2856
427	nmdc:mga0rr50_39280_c1	3300050513	Bacteria	3432
428	nmdc:mga08x19_6507_c1	3300050514	Bacteria	6919
429	nmdc:mga0a205_137409_c1	3300050515	Bacteria	2345
430	Ga0495601_0675053	3300053077	Bacteria	660
431	Ga0495612_0000083	3300053078	Bacteria	42444
432	Ga0495655_0133594	3300053083	Bacteria	766
433	Ga0495595_0229847	3300053084	Bacteria	927
434	Ga0500566_0240568	3300053094	Unclassified	887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005347	Ga0070668_100084454	Ga0070668_1000844542	109
2	3300005356	Ga0070674_100025098	Ga0070674_1000250982	109
3	3300005459	Ga0068867_100061182	Ga0068867_1000611822	109
4	3300006881	Ga0068865_100096074	Ga0068865_1000960742	109
5	3300010375	Ga0105239_12132806	Ga0105239_121328061	109
6	3300013306	Ga0163162_11340522	Ga0163162_113405221	109
7	3300025937	Ga0207669_10018029	Ga0207669_100180292	109
8	3300025972	Ga0207668_10685597	Ga0207668_106855972	109
9	3300026089	Ga0207648_10081966	Ga0207648_100819662	109
10	3300050507	nmdc:mga05p37_612068_c1	nmdc:mga05p37_612068_c1_217_585	109
11	3300035089	Ga0373944_0181228	Ga0373944_0181228_225_596	110
12	3300035113	Ga0373936_0247265	Ga0373936_0247265_151_522	110
13	3300035170	Ga0373943_0549759	Ga0373943_0549759_95_466	110
14	3300035695	Ga0373927_0135277	Ga0373927_0135277_487_858	110
15	3300035725	Ga0373947_0029273	Ga0373947_0029273_2835_3206	110
16	3300046455	Ga0495603_0007182	Ga0495603_0007182_1346_1717	110
17	3300046461	Ga0495641_0009370	Ga0495641_0009370_3662_4033	110
18	3300046472	Ga0495580_0520850	Ga0495580_0520850_211_582	110
19	3300046473	Ga0495582_0175416	Ga0495582_0175416_805_1176	110
20	3300046475	Ga0495639_0253954	Ga0495639_0253954_208_579	110
21	3300046499	Ga0495594_0021917	Ga0495594_0021917_2764_3135	110
22	3300046526	Ga0495666_0011812	Ga0495666_0011812_2683_3054	110
23	3300046674	Ga0495588_0002365	Ga0495588_0002365_5499_5870	110
24	3300047315	Ga0495581_0250746	Ga0495581_0250746_594_965	110
25	3300047321	Ga0495676_0027331	Ga0495676_0027331_3338_3709	110
26	3300046501	Ga0495607_0319304	Ga0495607_0319304_15_368	116
27	3300048913	Ga0496110_0102137	Ga0496110_0102137_30_452	116
28	3300041512	Ga0451853_3950848	Ga0451853_3950848_249_602	117
29	3300046528	Ga0495642_0460989	Ga0495642_0460989_19_399	118
30	3300005983	Ga0081540_1005740	Ga0081540_10057408	119
31	3300014326	Ga0157380_10009946	Ga0157380_100099463	119
32	3300046459	Ga0495629_0198439	Ga0495629_0198439_164_535	119
33	3300005366	Ga0070659_100017159	Ga0070659_1000171595	120
34	3300005437	Ga0070710_10369442	Ga0070710_103694422	120
35	3300005545	Ga0070695_101035710	Ga0070695_1010357101	120
36	3300005937	Ga0081455_10094874	Ga0081455_100948742	120
37	3300006852	Ga0075433_10502159	Ga0075433_105021592	120
38	3300006881	Ga0068865_101877408	Ga0068865_1018774082	120
39	3300010375	Ga0105239_10626821	Ga0105239_106268211	120
40	3300025898	Ga0207692_10269555	Ga0207692_102695552	120
41	3300025932	Ga0207690_10523992	Ga0207690_105239922	120
42	3300025938	Ga0207704_10885886	Ga0207704_108858862	120
43	3300025961	Ga0207712_10954529	Ga0207712_109545292	120
44	3300028380	Ga0268265_10774410	Ga0268265_107744101	120
45	3300046454	Ga0495592_0036804	Ga0495592_0036804_1150_1512	120
46	3300046459	Ga0495629_0034827	Ga0495629_0034827_1719_2081	120
47	3300046473	Ga0495582_0340863	Ga0495582_0340863_432_794	120
48	3300046476	Ga0495662_0001166	Ga0495662_0001166_2403_2780	120
49	3300046514	Ga0495618_0238167	Ga0495618_0238167_284_661	120
50	3300046529	Ga0495652_0000003	Ga0495652_0000003_189219_189581	120
51	3300046678	Ga0495599_0091102	Ga0495599_0091102_577_939	120
52	3300046684	Ga0495669_0091198	Ga0495669_0091198_811_1173	120
53	3300046689	Ga0495613_0410312	Ga0495613_0410312_496_858	120
54	3300047321	Ga0495676_0013636	Ga0495676_0013636_6361_6723	120
55	3300047471	Ga0495684_0726341	Ga0495684_0726341_241_603	120
56	3300047471	Ga0495684_0811683	Ga0495684_0811683_219_581	120
57	3300048903	Ga0496100_0000012	Ga0496100_0000012_93419_93781	120
58	3300048904	Ga0496101_0000010	Ga0496101_0000010_188424_188786	120
59	3300048909	Ga0496106_0000017	Ga0496106_0000017_93131_93493	120
60	3300048910	Ga0496107_0000012	Ga0496107_0000012_88063_88425	120
61	3300048916	Ga0496113_0331023	Ga0496113_0331023_621_1019	120
62	3300048917	Ga0496114_0253029	Ga0496114_0253029_256_618	120
63	3300048918	Ga0496115_0000020	Ga0496115_0000020_149377_149739	120
64	3300053077	Ga0495601_0675053	Ga0495601_0675053_81_443	120
65	3300053094	Ga0500566_0240568	Ga0500566_0240568_352_714	120
66	3300005548	Ga0070665_100990091	Ga0070665_1009900912	121
67	3300005718	Ga0068866_10085591	Ga0068866_100855912	121
68	3300005719	Ga0068861_100375734	Ga0068861_1003757343	121
69	3300005937	Ga0081455_10208448	Ga0081455_102084482	121
70	3300006038	Ga0075365_10027490	Ga0075365_100274901	121
71	3300006051	Ga0075364_10050380	Ga0075364_100503803	121
72	3300013308	Ga0157375_10008980	Ga0157375_100089805	121
73	3300013308	Ga0157375_13130628	Ga0157375_131306281	121
74	3300025899	Ga0207642_10149691	Ga0207642_101496911	121
75	3300026118	Ga0207675_100435851	Ga0207675_1004358513	121
76	3300028379	Ga0268266_10995642	Ga0268266_109956422	121
77	3300046533	Ga0495640_0023618	Ga0495640_0023618_3759_4202	121
78	3300046675	Ga0495657_0005385	Ga0495657_0005385_7720_8085	121
79	3300047319	Ga0495674_0000020	Ga0495674_0000020_19523_19966	121
80	3300047444	Ga0495675_0049003	Ga0495675_0049003_1715_2161	121
81	3300048912	Ga0496109_0209409	Ga0496109_0209409_1437_1802	121
82	3300048917	Ga0496114_0000003	Ga0496114_0000003_148276_148641	121
83	3300048918	Ga0496115_0000036	Ga0496115_0000036_121127_121492	121
84	3300050491	nmdc:mga00v17_15658_c1	nmdc:mga00v17_15658_c1_1386_1754	121
85	3300050492	nmdc:mga0yw44_140896_c1	nmdc:mga0yw44_140896_c1_859_1227	121
86	3300005329	Ga0070683_100896255	Ga0070683_1008962552	122
87	3300005341	Ga0070691_10058984	Ga0070691_100589843	122
88	3300005344	Ga0070661_101148278	Ga0070661_1011482782	122
89	3300005434	Ga0070709_10856849	Ga0070709_108568492	122
90	3300005437	Ga0070710_10153449	Ga0070710_101534492	122
91	3300005440	Ga0070705_100015067	Ga0070705_1000150673	122
92	3300005445	Ga0070708_100087938	Ga0070708_1000879383	122
93	3300005458	Ga0070681_10548336	Ga0070681_105483362	122
94	3300005467	Ga0070706_100048871	Ga0070706_1000488714	122
95	3300005471	Ga0070698_100610269	Ga0070698_1006102692	122
96	3300005518	Ga0070699_100039479	Ga0070699_1000394793	122
97	3300005535	Ga0070684_100223795	Ga0070684_1002237953	122
98	3300005577	Ga0068857_100413317	Ga0068857_1004133172	122
99	3300005614	Ga0068856_101215792	Ga0068856_1012157922	122
100	3300009098	Ga0105245_10872339	Ga0105245_108723392	122
101	3300009545	Ga0105237_10778258	Ga0105237_107782582	122
102	3300013306	Ga0163162_10249006	Ga0163162_102490061	122
103	3300015265	Ga0182005_1274313	Ga0182005_12743131	122
104	3300025898	Ga0207692_10222891	Ga0207692_102228912	122
105	3300025910	Ga0207684_10028474	Ga0207684_100284744	122
106	3300025923	Ga0207681_10842630	Ga0207681_108426301	122
107	3300025927	Ga0207687_10648082	Ga0207687_106480822	122
108	3300025961	Ga0207712_11436216	Ga0207712_114362162	122
109	3300026078	Ga0207702_11329800	Ga0207702_113298002	122
110	3300044694	Ga0466963_0803854	Ga0466963_0803854_121_501	122
111	3300046499	Ga0495594_0000007	Ga0495594_0000007_55280_55648	122
112	3300046536	Ga0495587_0522332	Ga0495587_0522332_274_645	122
113	3300046557	Ga0495622_0000050	Ga0495622_0000050_102837_103205	122
114	3300046642	Ga0495634_0618349	Ga0495634_0618349_185_556	122
115	3300046663	Ga0495635_0848204	Ga0495635_0848204_114_485	122
116	3300048905	Ga0496102_0644302	Ga0496102_0644302_551_922	122
117	3300048907	Ga0496104_0000002	Ga0496104_0000002_487837_488205	122
118	3300048908	Ga0496105_0000001	Ga0496105_0000001_839974_840342	122
119	3300048913	Ga0496110_0039931	Ga0496110_0039931_1456_1827	122
120	3300048914	Ga0496111_0222245	Ga0496111_0222245_747_1118	122
121	3300048922	Ga0496119_0023695	Ga0496119_0023695_2097_2465	122
122	3300048923	Ga0496120_0164310	Ga0496120_0164310_602_970	122
123	3300050507	nmdc:mga05p37_985782_c1	nmdc:mga05p37_985782_c1_376_756	122
124	3300005338	Ga0068868_100000008	Ga0068868_10000000876	123
125	3300005440	Ga0070705_101130907	Ga0070705_1011309072	123
126	3300005535	Ga0070684_101742921	Ga0070684_1017429211	123
127	3300006852	Ga0075433_10000047	Ga0075433_1000004755	123
128	3300009101	Ga0105247_10000516	Ga0105247_100005163	123
129	3300017792	Ga0163161_10000018	Ga0163161_1000001854	123
130	3300025900	Ga0207710_10000276	Ga0207710_1000027635	123
131	3300026023	Ga0207677_10000751	Ga0207677_1000075116	123
132	3300026078	Ga0207702_11589802	Ga0207702_115898022	123
133	3300031901	Ga0307406_10039171	Ga0307406_100391714	123
134	3300036401	Ga0373937_0066358	Ga0373937_0066358_1610_1981	123
135	3300037312	Ga0395899_0436790	Ga0395899_0436790_167_538	123
136	3300037466	Ga0395898_0120907	Ga0395898_0120907_1919_2290	123
137	3300037471	Ga0395905_0676751	Ga0395905_0676751_258_629	123
138	3300038443	Ga0395901_0295161	Ga0395901_0295161_913_1284	123
139	3300046454	Ga0495592_0867306	Ga0495592_0867306_151_522	123
140	3300046462	Ga0495651_0064169	Ga0495651_0064169_1631_2002	123
141	3300046462	Ga0495651_0180735	Ga0495651_0180735_207_578	123
142	3300046514	Ga0495618_0329763	Ga0495618_0329763_147_521	123
143	3300046516	Ga0495628_0118427	Ga0495628_0118427_409_783	123
144	3300046516	Ga0495628_0522910	Ga0495628_0522910_449_820	123
145	3300046539	Ga0495621_0056954	Ga0495621_0056954_841_1212	123
146	3300046794	Ga0495589_0316297	Ga0495589_0316297_177_548	123
147	3300046809	Ga0495600_0317636	Ga0495600_0317636_556_927	123
148	3300047322	Ga0495680_0000952	Ga0495680_0000952_2256_2627	123
149	3300047322	Ga0495680_0022229	Ga0495680_0022229_1031_1402	123
150	3300047322	Ga0495680_0100046	Ga0495680_0100046_1484_1855	123
151	3300047447	Ga0495685_008795	Ga0495685_008795_427_798	123
152	3300047471	Ga0495684_0130343	Ga0495684_0130343_978_1352	123
153	3300047471	Ga0495684_0137169	Ga0495684_0137169_1405_1776	123
154	3300048088	Ga0495602_0042794	Ga0495602_0042794_2969_3421	123
155	3300048905	Ga0496102_0590016	Ga0496102_0590016_512_883	123
156	3300048914	Ga0496111_0379932	Ga0496111_0379932_414_785	123
157	3300048915	Ga0496112_0253127	Ga0496112_0253127_788_1159	123
158	3300049741	Ga0501079_0392284	Ga0501079_0392284_616_990	123
159	3300053078	Ga0495612_0000083	Ga0495612_0000083_13634_14008	123
160	3300053084	Ga0495595_0229847	Ga0495595_0229847_309_680	123
161	3300031995	Ga0307409_100226847	Ga0307409_1002268472	124
162	3300032002	Ga0307416_100388754	Ga0307416_1003887543	124
163	3300037312	Ga0395899_0026828	Ga0395899_0026828_2603_2977	124
164	3300037418	Ga0395900_0041527	Ga0395900_0041527_1975_2349	124
165	3300037466	Ga0395898_0025354	Ga0395898_0025354_1227_1601	124
166	3300037471	Ga0395905_0022978	Ga0395905_0022978_4293_4667	124
167	3300038443	Ga0395901_0157789	Ga0395901_0157789_1975_2349	124
168	3300046491	Ga0495584_0473243	Ga0495584_0473243_244_618	124
169	3300046500	Ga0495596_0294588	Ga0495596_0294588_70_444	124
170	3300046794	Ga0495589_0316337	Ga0495589_0316337_324_698	124
171	3300053083	Ga0495655_0133594	Ga0495655_0133594_267_641	124
172	3300003911	JGI25405J52794_10058350	JGI25405J52794_100583502	125
173	3300005937	Ga0081455_10002444	Ga0081455_100024442	125
174	3300006058	Ga0075432_10027773	Ga0075432_100277732	125
175	3300006178	Ga0075367_10349056	Ga0075367_103490562	125
176	3300006844	Ga0075428_100343113	Ga0075428_1003431132	125
177	3300006847	Ga0075431_100943116	Ga0075431_1009431162	125
178	3300006852	Ga0075433_10747606	Ga0075433_107476062	125
179	3300006871	Ga0075434_100808705	Ga0075434_1008087051	125
180	3300006914	Ga0075436_100002978	Ga0075436_1000029784	125
181	3300007076	Ga0075435_100635170	Ga0075435_1006351702	125
182	3300009147	Ga0114129_10114316	Ga0114129_101143163	125
183	3300010375	Ga0105239_10367697	Ga0105239_103676972	125
184	3300027462	Ga0210000_1026647	Ga0210000_10266472	125
185	3300027695	Ga0209966_1035268	Ga0209966_10352681	125
186	3300027876	Ga0209974_10183570	Ga0209974_101835702	125
187	3300027907	Ga0207428_10020923	Ga0207428_100209235	125
188	3300028381	Ga0268264_10222448	Ga0268264_102224481	125
189	3300031548	Ga0307408_100530391	Ga0307408_1005303911	125
190	3300031731	Ga0307405_11027460	Ga0307405_110274601	125
191	3300031852	Ga0307410_11718838	Ga0307410_117188381	125
192	3300032002	Ga0307416_102190639	Ga0307416_1021906391	125
193	3300035691	Ga0373931_0182893	Ga0373931_0182893_271_648	125
194	3300041456	Ga0451795_0910105	Ga0451795_0910105_66_446	125
195	3300041460	Ga0451802_0591098	Ga0451802_0591098_958_1338	125
196	3300041503	Ga0451847_0470698	Ga0451847_0470698_199_579	125
197	3300042012	Ga0439455_0190120	Ga0439455_0190120_42_419	125
198	3300042438	Ga0439459_0059998	Ga0439459_0059998_358_735	125
199	3300042439	Ga0439464_0174743	Ga0439464_0174743_167_544	125
200	3300044684	Ga0466966_0009738	Ga0466966_0009738_5090_5467	125
201	3300044901	Ga0466960_0327821	Ga0466960_0327821_25_402	125
202	3300045836	Ga0466958_0076332	Ga0466958_0076332_56_433	125
203	3300046474	Ga0495605_0183567	Ga0495605_0183567_79_459	125
204	3300046491	Ga0495584_0334779	Ga0495584_0334779_19_399	125
205	3300050494	nmdc:mga06z11_297813_c1	nmdc:mga06z11_297813_c1_552_929	125
206	3300050507	nmdc:mga05p37_203551_c1	nmdc:mga05p37_203551_c1_1934_2311	125
207	3300050510	nmdc:mga06r32_127446_c1	nmdc:mga06r32_127446_c1_2101_2478	125
208	3300050511	nmdc:mga08y16_109464_c1	nmdc:mga08y16_109464_c1_1149_1526	125
209	3300050512	nmdc:mga0n895_103702_c1	nmdc:mga0n895_103702_c1_1331_1708	125
210	3300050513	nmdc:mga0rr50_39280_c1	nmdc:mga0rr50_39280_c1_1704_2081	125
211	3300050514	nmdc:mga08x19_6507_c1	nmdc:mga08x19_6507_c1_4874_5251	125
212	3300050515	nmdc:mga0a205_137409_c1	nmdc:mga0a205_137409_c1_617_994	125
213	3300025898	Ga0207692_10193165	Ga0207692_101931652	126
214	3300044706	Ga0466964_0010898	Ga0466964_0010898_2759_3139	126
215	3300045976	Ga0466967_0989999	Ga0466967_0989999_301_681	126
216	3300001978	JGI24747J21853_1022969	JGI24747J21853_10229691	127
217	3300005329	Ga0070683_102078660	Ga0070683_1020786602	127
218	3300005330	Ga0070690_100197552	Ga0070690_1001975522	127
219	3300005330	Ga0070690_100599783	Ga0070690_1005997832	127
220	3300005331	Ga0070670_100705947	Ga0070670_1007059472	127
221	3300005336	Ga0070680_100599173	Ga0070680_1005991732	127
222	3300005337	Ga0070682_100017237	Ga0070682_1000172372	127
223	3300005337	Ga0070682_100159117	Ga0070682_1001591172	127
224	3300005339	Ga0070660_100321726	Ga0070660_1003217261	127
225	3300005340	Ga0070689_100395104	Ga0070689_1003951041	127
226	3300005341	Ga0070691_10067558	Ga0070691_100675582	127
227	3300005341	Ga0070691_10350427	Ga0070691_103504271	127
228	3300005345	Ga0070692_10042483	Ga0070692_100424832	127
229	3300005347	Ga0070668_100123991	Ga0070668_1001239912	127
230	3300005355	Ga0070671_101168493	Ga0070671_1011684932	127
231	3300005356	Ga0070674_100037319	Ga0070674_1000373192	127
232	3300005364	Ga0070673_100050446	Ga0070673_1000504465	127
233	3300005364	Ga0070673_101076016	Ga0070673_1010760162	127
234	3300005366	Ga0070659_100079660	Ga0070659_1000796603	127
235	3300005434	Ga0070709_10105840	Ga0070709_101058402	127
236	3300005434	Ga0070709_10693860	Ga0070709_106938602	127
237	3300005435	Ga0070714_100022572	Ga0070714_1000225723	127
238	3300005435	Ga0070714_102247184	Ga0070714_1022471841	127
239	3300005436	Ga0070713_100140569	Ga0070713_1001405693	127
240	3300005436	Ga0070713_100170069	Ga0070713_1001700692	127
241	3300005437	Ga0070710_10077459	Ga0070710_100774592	127
242	3300005437	Ga0070710_10197760	Ga0070710_101977602	127
243	3300005438	Ga0070701_10259298	Ga0070701_102592982	127
244	3300005438	Ga0070701_10268761	Ga0070701_102687612	127
245	3300005439	Ga0070711_100330904	Ga0070711_1003309042	127
246	3300005440	Ga0070705_100166105	Ga0070705_1001661052	127
247	3300005440	Ga0070705_100423286	Ga0070705_1004232862	127
248	3300005441	Ga0070700_100290318	Ga0070700_1002903182	127
249	3300005445	Ga0070708_100836773	Ga0070708_1008367731	127
250	3300005455	Ga0070663_100257600	Ga0070663_1002576001	127
251	3300005456	Ga0070678_100031124	Ga0070678_1000311243	127
252	3300005456	Ga0070678_100083700	Ga0070678_1000837002	127
253	3300005456	Ga0070678_100127808	Ga0070678_1001278082	127
254	3300005457	Ga0070662_100085461	Ga0070662_1000854612	127
255	3300005458	Ga0070681_10019928	Ga0070681_100199284	127
256	3300005459	Ga0068867_100877632	Ga0068867_1008776321	127
257	3300005530	Ga0070679_100065195	Ga0070679_1000651953	127
258	3300005530	Ga0070679_100164044	Ga0070679_1001640442	127
259	3300005535	Ga0070684_101327809	Ga0070684_1013278092	127
260	3300005539	Ga0068853_100200561	Ga0068853_1002005612	127
261	3300005545	Ga0070695_100043429	Ga0070695_1000434292	127
262	3300005546	Ga0070696_100045249	Ga0070696_1000452493	127
263	3300005546	Ga0070696_100374199	Ga0070696_1003741992	127
264	3300005547	Ga0070693_100016952	Ga0070693_1000169525	127
265	3300005547	Ga0070693_100080569	Ga0070693_1000805693	127
266	3300005547	Ga0070693_100249379	Ga0070693_1002493791	127
267	3300005548	Ga0070665_101519918	Ga0070665_1015199182	127
268	3300005549	Ga0070704_100228548	Ga0070704_1002285482	127
269	3300005563	Ga0068855_100093741	Ga0068855_1000937412	127
270	3300005578	Ga0068854_100050431	Ga0068854_1000504312	127
271	3300005614	Ga0068856_100039808	Ga0068856_1000398083	127
272	3300005614	Ga0068856_100346421	Ga0068856_1003464212	127
273	3300005614	Ga0068856_100481650	Ga0068856_1004816502	127
274	3300005615	Ga0070702_100109672	Ga0070702_1001096723	127
275	3300005615	Ga0070702_101446083	Ga0070702_1014460832	127
276	3300005615	Ga0070702_101456345	Ga0070702_1014563451	127
277	3300005616	Ga0068852_100280701	Ga0068852_1002807013	127
278	3300005618	Ga0068864_100519000	Ga0068864_1005190002	127
279	3300005719	Ga0068861_100156607	Ga0068861_1001566072	127
280	3300005983	Ga0081540_1006073	Ga0081540_10060735	127
281	3300006028	Ga0070717_10065445	Ga0070717_100654451	127
282	3300006163	Ga0070715_10013812	Ga0070715_100138123	127
283	3300006173	Ga0070716_100730635	Ga0070716_1007306351	127
284	3300006175	Ga0070712_100029296	Ga0070712_1000292962	127
285	3300006237	Ga0097621_100017415	Ga0097621_1000174153	127
286	3300006358	Ga0068871_100175085	Ga0068871_1001750851	127
287	3300006881	Ga0068865_100146332	Ga0068865_1001463322	127
288	3300007076	Ga0075435_100075041	Ga0075435_1000750412	127
289	3300009092	Ga0105250_10286181	Ga0105250_102861812	127
290	3300009098	Ga0105245_10203389	Ga0105245_102033892	127
291	3300009098	Ga0105245_10220765	Ga0105245_102207652	127
292	3300009148	Ga0105243_10121572	Ga0105243_101215721	127
293	3300009148	Ga0105243_10435794	Ga0105243_104357942	127
294	3300009174	Ga0105241_10051814	Ga0105241_100518144	127
295	3300009174	Ga0105241_10264634	Ga0105241_102646342	127
296	3300009177	Ga0105248_11396977	Ga0105248_113969771	127
297	3300009553	Ga0105249_10062959	Ga0105249_100629592	127
298	3300010375	Ga0105239_10538821	Ga0105239_105388212	127
299	3300011119	Ga0105246_10697622	Ga0105246_106976222	127
300	3300011119	Ga0105246_11510038	Ga0105246_115100381	127
301	3300012510	Ga0157316_1001777	Ga0157316_10017772	127
302	3300013102	Ga0157371_10167629	Ga0157371_101676292	127
303	3300013297	Ga0157378_10070901	Ga0157378_100709012	127
304	3300013297	Ga0157378_11060476	Ga0157378_110604762	127
305	3300013297	Ga0157378_11109106	Ga0157378_111091062	127
306	3300013307	Ga0157372_10050308	Ga0157372_100503086	127
307	3300013308	Ga0157375_10195010	Ga0157375_101950104	127
308	3300013308	Ga0157375_10612812	Ga0157375_106128122	127
309	3300014325	Ga0163163_10085658	Ga0163163_100856585	127
310	3300014326	Ga0157380_10030397	Ga0157380_100303975	127
311	3300014745	Ga0157377_10403279	Ga0157377_104032792	127
312	3300014969	Ga0157376_10030574	Ga0157376_100305744	127
313	3300014969	Ga0157376_11104288	Ga0157376_111042881	127
314	3300017792	Ga0163161_10139343	Ga0163161_101393433	127
315	3300020081	Ga0206354_11111355	Ga0206354_111113551	127
316	3300025885	Ga0207653_10022624	Ga0207653_100226243	127
317	3300025903	Ga0207680_10193556	Ga0207680_101935562	127
318	3300025905	Ga0207685_10422425	Ga0207685_104224251	127
319	3300025906	Ga0207699_10206706	Ga0207699_102067062	127
320	3300025907	Ga0207645_10108254	Ga0207645_101082542	127
321	3300025911	Ga0207654_10075309	Ga0207654_100753092	127
322	3300025913	Ga0207695_11083990	Ga0207695_110839901	127
323	3300025915	Ga0207693_10013159	Ga0207693_100131594	127
324	3300025915	Ga0207693_10014565	Ga0207693_100145655	127
325	3300025916	Ga0207663_10125751	Ga0207663_101257512	127
326	3300025916	Ga0207663_10129860	Ga0207663_101298603	127
327	3300025917	Ga0207660_10757386	Ga0207660_107573861	127
328	3300025918	Ga0207662_10125064	Ga0207662_101250642	127
329	3300025919	Ga0207657_10029923	Ga0207657_100299236	127
330	3300025923	Ga0207681_10542563	Ga0207681_105425632	127
331	3300025927	Ga0207687_10160451	Ga0207687_101604512	127
332	3300025928	Ga0207700_10038191	Ga0207700_100381912	127
333	3300025928	Ga0207700_10055555	Ga0207700_100555552	127
334	3300025929	Ga0207664_10144757	Ga0207664_101447573	127
335	3300025929	Ga0207664_10359259	Ga0207664_103592592	127
336	3300025929	Ga0207664_11956815	Ga0207664_119568151	127
337	3300025932	Ga0207690_10420966	Ga0207690_104209662	127
338	3300025933	Ga0207706_10013953	Ga0207706_100139532	127
339	3300025934	Ga0207686_11290451	Ga0207686_112904511	127
340	3300025936	Ga0207670_10376104	Ga0207670_103761042	127
341	3300025937	Ga0207669_10630559	Ga0207669_106305591	127
342	3300025938	Ga0207704_10490552	Ga0207704_104905521	127
343	3300025939	Ga0207665_10001453	Ga0207665_100014532	127
344	3300025940	Ga0207691_10431207	Ga0207691_104312072	127
345	3300025942	Ga0207689_10059853	Ga0207689_100598532	127
346	3300025944	Ga0207661_10197964	Ga0207661_101979641	127
347	3300025944	Ga0207661_10555398	Ga0207661_105553982	127
348	3300025945	Ga0207679_10412810	Ga0207679_104128102	127
349	3300025945	Ga0207679_10956952	Ga0207679_109569521	127
350	3300025945	Ga0207679_11942853	Ga0207679_119428531	127
351	3300025949	Ga0207667_12015493	Ga0207667_120154931	127
352	3300025960	Ga0207651_10196290	Ga0207651_101962902	127
353	3300025961	Ga0207712_10309874	Ga0207712_103098742	127
354	3300025972	Ga0207668_10467906	Ga0207668_104679062	127
355	3300025981	Ga0207640_10227718	Ga0207640_102277182	127
356	3300026023	Ga0207677_10350212	Ga0207677_103502122	127
357	3300026023	Ga0207677_10588867	Ga0207677_105888672	127
358	3300026041	Ga0207639_10192882	Ga0207639_101928822	127
359	3300026067	Ga0207678_10003968	Ga0207678_1000396812	127
360	3300026075	Ga0207708_10979570	Ga0207708_109795702	127
361	3300026078	Ga0207702_10088586	Ga0207702_100885863	127
362	3300026078	Ga0207702_10507005	Ga0207702_105070052	127
363	3300026089	Ga0207648_10011438	Ga0207648_100114387	127
364	3300026095	Ga0207676_10540028	Ga0207676_105400282	127
365	3300026118	Ga0207675_100010019	Ga0207675_10001001912	127
366	3300026121	Ga0207683_10001817	Ga0207683_1000181710	127
367	3300026121	Ga0207683_10062902	Ga0207683_100629022	127
368	3300026121	Ga0207683_10172458	Ga0207683_101724582	127
369	3300026142	Ga0207698_10250386	Ga0207698_102503862	127
370	3300028379	Ga0268266_11017499	Ga0268266_110174992	127
371	3300028380	Ga0268265_10018207	Ga0268265_100182073	127
372	3300028381	Ga0268264_10573204	Ga0268264_105732042	127
373	3300034816	Ga0373930_0067744	Ga0373930_0067744_322_705	127
374	3300034817	Ga0373948_0210067	Ga0373948_0210067_80_463	127
375	3300034957	Ga0373938_0011691	Ga0373938_0011691_612_995	127
376	3300035084	Ga0373928_0035502	Ga0373928_0035502_174_557	127
377	3300035085	Ga0373929_0022177	Ga0373929_0022177_291_674	127
378	3300035090	Ga0373949_0025715	Ga0373949_0025715_908_1291	127
379	3300035114	Ga0373939_0018775	Ga0373939_0018775_55_438	127
380	3300035121	Ga0373960_0047783	Ga0373960_0047783_296_679	127
381	3300035241	Ga0373961_0029235	Ga0373961_0029235_1095_1478	127
382	3300035242	Ga0373962_0030368	Ga0373962_0030368_98_481	127
383	3300035691	Ga0373931_0170675	Ga0373931_0170675_217_600	127
384	3300038996	Ga0242420_056277	Ga0242420_056277_147_530	127
385	3300041512	Ga0451853_4123673	Ga0451853_4123673_156_539	127
386	3300046491	Ga0495584_0142292	Ga0495584_0142292_32_415	127
387	3300046525	Ga0495663_0131388	Ga0495663_0131388_170_580	127
388	3300046538	Ga0495609_0237809	Ga0495609_0237809_124_534	127
389	3300046538	Ga0495609_0361342	Ga0495609_0361342_127_510	127
390	3300046648	Ga0495611_0362281	Ga0495611_0362281_200_583	127
391	3300046691	Ga0495670_0526575	Ga0495670_0526575_91_474	127
392	3300048903	Ga0496100_0132114	Ga0496100_0132114_1282_1665	127
393	3300048903	Ga0496100_0222772	Ga0496100_0222772_272_655	127
394	3300048903	Ga0496100_0252219	Ga0496100_0252219_837_1220	127
395	3300048904	Ga0496101_0191152	Ga0496101_0191152_1038_1421	127
396	3300048904	Ga0496101_0377907	Ga0496101_0377907_447_830	127
397	3300048905	Ga0496102_0049806	Ga0496102_0049806_3198_3581	127
398	3300048905	Ga0496102_0057039	Ga0496102_0057039_2656_3039	127
399	3300048905	Ga0496102_0201278	Ga0496102_0201278_809_1192	127
400	3300048905	Ga0496102_0404860	Ga0496102_0404860_155_538	127
401	3300048906	Ga0496103_0056676	Ga0496103_0056676_26_409	127
402	3300048906	Ga0496103_0132766	Ga0496103_0132766_1029_1412	127
403	3300048907	Ga0496104_0000461	Ga0496104_0000461_31859_32242	127
404	3300048907	Ga0496104_0001925	Ga0496104_0001925_17361_17744	127
405	3300048907	Ga0496104_0409349	Ga0496104_0409349_369_752	127
406	3300048908	Ga0496105_0000673	Ga0496105_0000673_2950_3333	127
407	3300048908	Ga0496105_0201922	Ga0496105_0201922_855_1238	127
408	3300048908	Ga0496105_0233094	Ga0496105_0233094_787_1170	127
409	3300048908	Ga0496105_0860614	Ga0496105_0860614_87_470	127
410	3300048909	Ga0496106_0644804	Ga0496106_0644804_340_723	127
411	3300048909	Ga0496106_0649817	Ga0496106_0649817_324_707	127
412	3300048910	Ga0496107_0063673	Ga0496107_0063673_1999_2382	127
413	3300048911	Ga0496108_0001139	Ga0496108_0001139_17490_17873	127
414	3300048911	Ga0496108_0014399	Ga0496108_0014399_2241_2624	127
415	3300048912	Ga0496109_0007510	Ga0496109_0007510_411_794	127
416	3300048912	Ga0496109_0019323	Ga0496109_0019323_870_1253	127
417	3300048912	Ga0496109_0210845	Ga0496109_0210845_1149_1532	127
418	3300048912	Ga0496109_0576650	Ga0496109_0576650_475_858	127
419	3300048913	Ga0496110_0005455	Ga0496110_0005455_6221_6604	127
420	3300048913	Ga0496110_0040529	Ga0496110_0040529_3232_3615	127
421	3300048913	Ga0496110_0602507	Ga0496110_0602507_224_607	127
422	3300048914	Ga0496111_0000183	Ga0496111_0000183_6190_6573	127
423	3300048914	Ga0496111_0061989	Ga0496111_0061989_357_740	127
424	3300048914	Ga0496111_0388043	Ga0496111_0388043_465_848	127
425	3300048914	Ga0496111_1150915	Ga0496111_1150915_30_413	127
426	3300048915	Ga0496112_0008015	Ga0496112_0008015_4803_5186	127
427	3300048915	Ga0496112_0021354	Ga0496112_0021354_3834_4217	127
428	3300048915	Ga0496112_0185117	Ga0496112_0185117_930_1313	127
429	3300048916	Ga0496113_0001248	Ga0496113_0001248_6184_6567	127
430	3300048917	Ga0496114_0183598	Ga0496114_0183598_51_434	127
431	3300048917	Ga0496114_0297479	Ga0496114_0297479_424_807	127
432	3300048917	Ga0496114_1404426	Ga0496114_1404426_117_500	127
433	3300048918	Ga0496115_0160498	Ga0496115_0160498_192_575	127
434	3300048918	Ga0496115_0388827	Ga0496115_0388827_390_773	127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

145

0.89 PF18029

Glyoxalase_6

Glyoxalase-like domain

32

146

0.85 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3oxh-assembly1.cif.gz_A	mycobacterium tuberculosis kinase inhibitor homolog rv0577	0.7994	2	121
2r6u-assembly2.cif.gz_B	crystal structure of gene product rha04853 from rhodococcus sp. rha1	0.7963	1	124
2r6u-assembly2.cif.gz_B	crystal structure of gene product rha04853 from rhodococcus sp. rha1	0.7904	1	124
2r6u-assembly2.cif.gz_D	crystal structure of gene product rha04853 from rhodococcus sp. rha1	0.771	1	124
2r6u-assembly2.cif.gz_D	crystal structure of gene product rha04853 from rhodococcus sp. rha1	0.7492	1	124

ID	Description	Score	Start	End	Superfamily
3oxhA02	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8238	5	123	3.10.180.10
af_Q59ST1_26_339_3.40.50.1580	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain	0.811	105	121	3.40.50.1580
af_P9WKQ3_98_165_3.30.720.110	Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;	0.8064	71	127	3.30.720.110
2r6uB01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8019	4	124	3.10.180.10
2r6uB01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.7958	4	124	3.10.180.10

ID	Description	Score	Start	End
AF-A0A2W5XV32-F1-model_v4	Glyoxalase	0.9665	1	124
AF-A0A7V8YAP9-F1-model_v4	VOC family protein	0.9426	1	122
AF-A0A1G0SLC4-F1-model_v4	VOC domain-containing protein	0.9383	1	127
AF-A0A537KZ15-F1-model_v4	VOC domain-containing protein	0.9382	1	121
AF-A0A7V8YAP9-F1-model_v4	VOC family protein	0.9347	1	122

Feature Viewer

pLDDT	pTM	Quality
92.56	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F443172

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

145

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

32

146

0.85

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map