F443184

General Info

Members Datasets Scaffolds Average Seq Length
434 256 375 127

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0454408|Ga0501033_0454408_380_781
Length 133
Sequence VKRAGILNRHLAGALAELGHGDGVLVCDVGMPIPSGPRVVDLAFRAGVPAFAEVLDGLLEELVVEGALAAEEADAANPAAAALLRHRFADLGPGLELVPHARLKELSAGARLVVRTGEARPYANVLLRCGVFF

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221548 Streptomyces sp. Root55 Isolate Unclassified
6 2643221578 Streptomyces sp. Root63 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
13 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
14 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
15 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
16 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
17 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
18 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
19 2808606448 Streptomyces sp. 193411 Isolate Unclassified
20 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
21 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
22 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
23 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
24 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
25 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
26 2862574272 Streptomyces sp. AcE210 Isolate Nodule
27 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
28 2867428634 Streptomyces sp. RP5T Isolate Unclassified
29 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
30 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
31 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
32 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
33 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
34 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
35 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
36 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
37 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
38 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
39 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
40 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
41 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
42 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
43 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
44 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
45 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
46 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
47 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
48 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
49 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
50 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
51 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
52 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
53 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
54 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
107 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
116 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
117 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
118 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
119 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
241 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
242 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
243 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
244 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
248 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
249 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
252 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
253 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
254 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
255 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
256 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.25
Metatranscriptomes 1.15
Isolates 13.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 0.69
Rhizoplane 0.23
Rhizosphere 76.73
Stem 0
Stem Tuber 0
Unclassified 17.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10033934 3300002075 Bacteria 1040
2 JGI25153J46596_10113833 3300003215 Bacteria 618
3 rootH1_10032377 3300003316 Bacteria 3311
4 rootH2_10042051 3300003320 Bacteria 2070
5 rootL2_10056401 3300003322 Bacteria 1640
6 rootL2_10078854 3300003322 Bacteria 2794
7 rootH1_10015361 3300003323 Bacteria 6062
8 rootH1_10041793 3300003323 Bacteria 4151
9 Ga0006562J51391_1027451 3300003578 Bacteria 3920
10 Ga0006562J51391_1027452 3300003578 Bacteria 2211
11 Ga0006562J51391_1115102 3300003578 Bacteria 5940
12 Ga0006562J51391_1115105 3300003578 Bacteria 2060
13 Ga0006562J51391_1152979 3300003578 Bacteria 700
14 Ga0070668_102102616 3300005347 Bacteria 521
15 Ga0070709_11012787 3300005434 Bacteria 661
16 Ga0068855_100416178 3300005563 Bacteria 1471
17 Ga0068856_100233895 3300005614 Bacteria 1853
18 Ga0081455_10327561 3300005937 Bacteria 1088
19 Ga0075363_100010456 3300006048 Bacteria 4410
20 Ga0075367_10001800 3300006178 Bacteria 9432
21 Ga0105243_10873220 3300009148 Bacteria 893
22 Ga0105242_10968318 3300009176 Bacteria 856
23 Ga0105239_10421932 3300010375 Bacteria 1511
24 Ga0105246_10001746 3300011119 Bacteria 13005
25 Ga0157372_11268175 3300013307 Bacteria 851
26 Ga0182008_10005624 3300014497 Bacteria 7103
27 Ga0182007_10002128 3300015262 Bacteria 10112
28 Ga0183367_1006 3300015688 Bacteria 648044
29 Ga0209758_1016418 3300025297 Bacteria 3763
30 Ga0207709_10068524 3300025935 Bacteria 2243
31 Ga0207667_10490894 3300025949 Bacteria 1246
32 Ga0207712_10486918 3300025961 Bacteria 1052
33 Ga0207678_10198003 3300026067 Bacteria 1717
34 Ga0207702_10488427 3300026078 Bacteria 1199
35 Ga0209813_10052716 3300027866 Bacteria 1277
36 Ga0307517_10088716 3300028786 Bacteria 2553
37 Ga0307515_10000541 3300028794 Bacteria 88944
38 Ga0307515_10139861 3300028794 Bacteria 2604
39 Ga0307515_10165999 3300028794 Bacteria 2225
40 Ga0307511_10005628 3300030521 Bacteria 12715
41 Ga0307511_10307773 3300030521 Bacteria 710
42 Ga0307512_10001869 3300030522 Bacteria 28236
43 Ga0316180_1078211 3300030736 Bacteria 787
44 Ga0307513_10093571 3300031456 Bacteria 3054
45 Ga0307513_10265802 3300031456 Bacteria 1502
46 Ga0307513_10404778 3300031456 Bacteria 1098
47 Ga0307513_10691961 3300031456 Bacteria 725
48 Ga0307509_10020123 3300031507 Bacteria 7583
49 Ga0307509_10021348 3300031507 Bacteria 7321
50 Ga0307509_10050714 3300031507 Bacteria 4442
51 Ga0307508_10010039 3300031616 Bacteria 8676
52 Ga0307508_10026670 3300031616 Bacteria 5236
53 Ga0307508_10094344 3300031616 Bacteria 2583
54 Ga0307508_10347378 3300031616 Bacteria 1075
55 Ga0307514_10011385 3300031649 Bacteria 7394
56 Ga0307514_10039711 3300031649 Bacteria 3716
57 Ga0307514_10159739 3300031649 Bacteria 1494
58 Ga0307514_10295256 3300031649 Bacteria 913
59 Ga0307514_10361942 3300031649 Bacteria 765
60 Ga0307514_10548584 3300031649 Bacteria 534
61 Ga0307516_10012032 3300031730 Bacteria 9354
62 Ga0307516_10630460 3300031730 Bacteria 727
63 Ga0307518_10096207 3300031838 Bacteria 2124
64 Ga0307518_10482637 3300031838 Bacteria 647
65 Ga0307409_100361691 3300031995 Bacteria 1373
66 Ga0307409_102232848 3300031995 Bacteria 577
67 Ga0307416_103104725 3300032002 Bacteria 556
68 Ga0307411_10699390 3300032005 Bacteria 883
69 Ga0307415_101147268 3300032126 Bacteria 730
70 Ga0307507_10021084 3300033179 Bacteria 7270
71 Ga0307507_10030364 3300033179 Bacteria 5702
72 Ga0307510_10054625 3300033180 Bacteria 4180
73 Ga0307510_10197715 3300033180 Bacteria 1549
74 Ga0307510_10200796 3300033180 Bacteria 1529
75 Ga0307510_10325073 3300033180 Bacteria 994
76 Ga0395900_0418434 3300037418 Bacteria 1301
77 Ga0395898_0013633 3300037466 Bacteria 8362
78 Ga0395898_1286672 3300037466 Bacteria 661
79 Ga0439436_0006262 3300041404 Bacteria 3654
80 Ga0439436_0022788 3300041404 Bacteria 1854
81 Ga0451795_1435310 3300041456 Bacteria 505
82 Ga0451833_1066800 3300041491 Bacteria 576
83 Ga0451841_1023373 3300041498 Bacteria 645
84 Ga0451851_1075388 3300041507 Bacteria 793
85 Ga0451843_1439762 3300041509 Bacteria 925
86 Ga0451853_0267097 3300041512 Bacteria 2612
87 Ga0451853_2399869 3300041512 Bacteria 2292
88 Ga0451853_3848033 3300041512 Bacteria 781
89 Ga0439433_0000374 3300041999 Bacteria 7964
90 Ga0439433_0055792 3300041999 Bacteria 936
91 Ga0439448_0028790 3300042005 Bacteria 1756
92 Ga0439449_0008214 3300042007 Bacteria 3968
93 Ga0439449_0010788 3300042007 Bacteria 3449
94 Ga0439449_0015193 3300042007 Bacteria 2892
95 Ga0439449_0032602 3300042007 Bacteria 1942
96 Ga0439449_0385402 3300042007 Bacteria 531
97 Ga0439450_015228 3300042008 Bacteria 1572
98 Ga0439457_000938 3300042014 Bacteria 8756
99 Ga0439457_035635 3300042014 Bacteria 1107
100 Ga0439462_0007297 3300042015 Bacteria 2763
101 Ga0439462_0150387 3300042015 Bacteria 654
102 Ga0450894_000192 3300042131 Bacteria 11052
103 Ga0450899_000333 3300042135 Bacteria 5189
104 Ga0450902_002248 3300042137 Bacteria 2728
105 Ga0450903_000720 3300042138 Bacteria 6569
106 Ga0450906_000155 3300042145 Bacteria 12702
107 Ga0439458_0004166 3300042157 Bacteria 3338
108 Ga0450909_077452 3300042185 Bacteria 536
109 Ga0466969_0148083 3300044656 Bacteria 1082
110 Ga0466972_0001016 3300044658 Bacteria 13446
111 Ga0466972_0029193 3300044658 Bacteria 2715
112 Ga0466972_0032749 3300044658 Bacteria 2551
113 Ga0466972_0054261 3300044658 Bacteria 1929
114 Ga0466972_0453503 3300044658 Bacteria 602
115 Ga0466965_0006945 3300044683 Bacteria 5180
116 Ga0466965_0064049 3300044683 Bacteria 1840
117 Ga0466965_0079002 3300044683 Bacteria 1662
118 Ga0466965_0598595 3300044683 Bacteria 626
119 Ga0466966_0009137 3300044684 Bacteria 6563
120 Ga0466966_0186926 3300044684 Bacteria 1256
121 Ga0466961_0005533 3300044693 Bacteria 7968
122 Ga0466961_0020626 3300044693 Bacteria 4241
123 Ga0466961_0130619 3300044693 Bacteria 1574
124 Ga0466963_0002312 3300044694 Bacteria 10611
125 Ga0466963_0026745 3300044694 Bacteria 3692
126 Ga0466963_0157494 3300044694 Bacteria 1579
127 Ga0466964_0022499 3300044706 Bacteria 2446
128 Ga0466964_0040571 3300044706 Bacteria 1880
129 Ga0466971_0009115 3300044719 Bacteria 4337
130 Ga0466971_0188436 3300044719 Bacteria 971
131 Ga0466968_0121410 3300044735 Bacteria 1182
132 Ga0466970_0001488 3300044765 Bacteria 11266
133 Ga0466970_0003950 3300044765 Bacteria 7267
134 Ga0466957_0076957 3300044842 Bacteria 2072
135 Ga0466960_0008432 3300044901 Bacteria 4221
136 Ga0466960_0552600 3300044901 Bacteria 679
137 Ga0466960_0943411 3300044901 Bacteria 528
138 Ga0466959_0004028 3300045049 Bacteria 9764
139 Ga0466958_0004295 3300045836 Bacteria 7504
140 Ga0466958_0236594 3300045836 Bacteria 1167
141 Ga0466967_0040080 3300045976 Bacteria 4031
142 Ga0466967_0104595 3300045976 Bacteria 2592
143 Ga0466967_0200345 3300045976 Bacteria 1890
144 Ga0495617_021479 3300046452 Bacteria 2179
145 Ga0495603_0000531 3300046455 Bacteria 21139
146 Ga0495603_0003456 3300046455 Bacteria 9393
147 Ga0495603_0023092 3300046455 Bacteria 3765
148 Ga0495603_0026475 3300046455 Bacteria 3503
149 Ga0495603_0074493 3300046455 Bacteria 1993
150 Ga0495603_0139045 3300046455 Bacteria 1413
151 Ga0495590_0048617 3300046457 Bacteria 1480
152 Ga0495629_0000707 3300046459 Bacteria 27008
153 Ga0495629_0002283 3300046459 Bacteria 14771
154 Ga0495629_0006011 3300046459 Bacteria 9028
155 Ga0495629_0330213 3300046459 Bacteria 1042
156 Ga0495629_0520511 3300046459 Bacteria 800
157 Ga0495638_0046410 3300046460 Bacteria 2729
158 Ga0495638_0368256 3300046460 Bacteria 754
159 Ga0495651_0012456 3300046462 Bacteria 6558
160 Ga0495651_0222480 3300046462 Bacteria 1305
161 Ga0495653_0781349 3300046463 Bacteria 575
162 Ga0495582_0040469 3300046473 Bacteria 2567
163 Ga0495582_0088584 3300046473 Bacteria 1724
164 Ga0495605_0012608 3300046474 Bacteria 4680
165 Ga0495639_0618410 3300046475 Bacteria 557
166 Ga0495662_0003473 3300046476 Bacteria 7984
167 Ga0495662_0032350 3300046476 Bacteria 2526
168 Ga0495664_0088115 3300046477 Bacteria 1865
169 Ga0495664_0097180 3300046477 Bacteria 1772
170 Ga0495584_0449034 3300046491 Bacteria 656
171 Ga0495585_0008411 3300046492 Bacteria 6255
172 Ga0495585_0012882 3300046492 Bacteria 4914
173 Ga0495585_0029855 3300046492 Bacteria 3102
174 Ga0495594_0000260 3300046499 Bacteria 25795
175 Ga0495594_0002727 3300046499 Bacteria 9162
176 Ga0495594_0085355 3300046499 Bacteria 1766
177 Ga0495594_0112504 3300046499 Bacteria 1535
178 Ga0495596_0009287 3300046500 Bacteria 4330
179 Ga0495607_0038172 3300046501 Bacteria 2879
180 Ga0495607_0085290 3300046501 Bacteria 1725
181 Ga0495607_0098230 3300046501 Bacteria 1573
182 Ga0495583_0016696 3300046506 Bacteria 3934
183 Ga0495583_0283445 3300046506 Bacteria 660
184 Ga0495583_0325458 3300046506 Bacteria 608
185 Ga0495583_0356831 3300046506 Bacteria 576
186 Ga0495583_0434954 3300046506 Bacteria 514
187 Ga0495608_0401695 3300046511 Bacteria 838
188 Ga0495616_0009853 3300046513 Bacteria 5560
189 Ga0495618_0015177 3300046514 Bacteria 4700
190 Ga0495618_0111758 3300046514 Bacteria 1749
191 Ga0495620_0006156 3300046515 Bacteria 6614
192 Ga0495628_0018492 3300046516 Bacteria 5770
193 Ga0495628_0032171 3300046516 Bacteria 4237
194 Ga0495632_0541387 3300046519 Bacteria 500
195 Ga0495637_0141399 3300046520 Bacteria 913
196 Ga0495643_0053776 3300046522 Bacteria 2157
197 Ga0495644_0110460 3300046523 Bacteria 1043
198 Ga0495648_0216300 3300046524 Bacteria 948
199 Ga0495666_0303140 3300046526 Bacteria 722
200 Ga0495652_0017915 3300046529 Bacteria 6320
201 Ga0495652_0271219 3300046529 Bacteria 1247
202 Ga0495654_0176228 3300046530 Bacteria 929
203 Ga0495665_0304481 3300046531 Bacteria 816
204 Ga0495640_0040664 3300046533 Bacteria 3254
205 Ga0495640_0053048 3300046533 Bacteria 2781
206 Ga0495587_0004766 3300046536 Bacteria 8907
207 Ga0495609_0048325 3300046538 Bacteria 1902
208 Ga0495597_0259839 3300046542 Bacteria 680
209 Ga0495645_0025262 3300046543 Bacteria 4311
210 Ga0495622_0003092 3300046557 Bacteria 7893
211 Ga0495622_0009499 3300046557 Bacteria 4499
212 Ga0495622_0020377 3300046557 Bacteria 3087
213 Ga0495622_0053141 3300046557 Bacteria 1879
214 Ga0495633_0043965 3300046558 Bacteria 2118
215 Ga0495668_0011865 3300046616 Bacteria 5193
216 Ga0495634_0001005 3300046642 Bacteria 26553
217 Ga0495634_0048371 3300046642 Bacteria 2863
218 Ga0495634_0286956 3300046642 Bacteria 998
219 Ga0495611_0003229 3300046648 Bacteria 7212
220 Ga0495611_0034042 3300046648 Bacteria 2250
221 Ga0495611_0123085 3300046648 Bacteria 1209
222 Ga0495611_0254051 3300046648 Bacteria 814
223 Ga0495611_0284184 3300046648 Bacteria 764
224 Ga0495625_0020564 3300046660 Bacteria 5093
225 Ga0495625_0031424 3300046660 Bacteria 3949
226 Ga0495625_0043039 3300046660 Bacteria 3277
227 Ga0495625_0058688 3300046660 Bacteria 2733
228 Ga0495625_0274113 3300046660 Bacteria 1088
229 Ga0495625_0517940 3300046660 Bacteria 727
230 Ga0495635_0024236 3300046663 Bacteria 4230
231 Ga0495635_0245584 3300046663 Bacteria 1207
232 Ga0495661_0013603 3300046665 Bacteria 5463
233 Ga0495588_0002109 3300046674 Bacteria 8533
234 Ga0495588_0009466 3300046674 Bacteria 4503
235 Ga0495657_0001985 3300046675 Bacteria 17443
236 Ga0495657_0076576 3300046675 Bacteria 2172
237 Ga0495657_0130496 3300046675 Bacteria 1574
238 Ga0495599_0360009 3300046678 Bacteria 871
239 Ga0495623_0159427 3300046679 Bacteria 1327
240 Ga0495646_0029076 3300046680 Bacteria 3455
241 Ga0495646_0248268 3300046680 Bacteria 954
242 Ga0495613_0022990 3300046689 Bacteria 4645
243 Ga0495613_0103869 3300046689 Bacteria 2051
244 Ga0495613_0254569 3300046689 Bacteria 1224
245 Ga0495613_0445349 3300046689 Bacteria 878
246 Ga0495613_0459729 3300046689 Bacteria 861
247 Ga0495624_0013886 3300046690 Bacteria 5482
248 Ga0495670_0694701 3300046691 Bacteria 555
249 Ga0495670_0774626 3300046691 Bacteria 523
250 Ga0495671_0001899 3300046692 Bacteria 13419
251 Ga0495671_0226401 3300046692 Bacteria 905
252 Ga0495649_0018821 3300046694 Bacteria 3879
253 Ga0495649_0034524 3300046694 Bacteria 2783
254 Ga0495589_0004123 3300046794 Bacteria 7775
255 Ga0495589_0050139 3300046794 Bacteria 2065
256 Ga0495589_0072388 3300046794 Bacteria 1683
257 Ga0495600_0044056 3300046809 Bacteria 2911
258 Ga0495600_0053776 3300046809 Bacteria 2629
259 Ga0495660_0003952 3300046810 Bacteria 9055
260 Ga0495660_0049972 3300046810 Bacteria 2280
261 Ga0495660_0281959 3300046810 Bacteria 759
262 Ga0495581_0017820 3300047315 Bacteria 4127
263 Ga0495581_0451032 3300047315 Bacteria 749
264 Ga0495604_0000237 3300047317 Bacteria 49264
265 Ga0495604_0105742 3300047317 Bacteria 2059
266 Ga0495604_0245496 3300047317 Bacteria 1222
267 Ga0495636_0003544 3300047318 Bacteria 6052
268 Ga0495636_0097650 3300047318 Bacteria 1281
269 Ga0495636_0373389 3300047318 Bacteria 676
270 Ga0495674_0234659 3300047319 Bacteria 1513
271 Ga0495674_0592711 3300047319 Bacteria 879
272 Ga0495672_0140358 3300047320 Bacteria 1263
273 Ga0495676_0004323 3300047321 Bacteria 12982
274 Ga0495676_0008993 3300047321 Bacteria 9118
275 Ga0495676_0009988 3300047321 Bacteria 8624
276 Ga0495676_0016122 3300047321 Bacteria 6638
277 Ga0495676_0042694 3300047321 Bacteria 3719
278 Ga0495676_0396360 3300047321 Bacteria 916
279 Ga0495676_0533304 3300047321 Bacteria 768
280 Ga0495680_0165555 3300047322 Bacteria 1603
281 Ga0495683_0003480 3300047323 Bacteria 9177
282 Ga0495683_0020847 3300047323 Bacteria 3379
283 Ga0495683_0061458 3300047323 Bacteria 1860
284 Ga0495683_0124720 3300047323 Bacteria 1219
285 Ga0495687_000551 3300047443 Bacteria 44454
286 Ga0495687_003518 3300047443 Bacteria 11288
287 Ga0495687_015321 3300047443 Bacteria 3904
288 Ga0495687_019520 3300047443 Bacteria 3323
289 Ga0495687_055075 3300047443 Bacteria 1664
290 Ga0495687_096986 3300047443 Bacteria 1115
291 Ga0495687_112048 3300047443 Bacteria 1001
292 Ga0495675_0059662 3300047444 Bacteria 2419
293 Ga0495675_0692283 3300047444 Bacteria 571
294 Ga0495677_0016737 3300047445 Bacteria 2660
295 Ga0495677_0328115 3300047445 Bacteria 603
296 Ga0495685_009358 3300047447 Bacteria 3272
297 Ga0495685_041531 3300047447 Bacteria 1572
298 Ga0495685_253658 3300047447 Bacteria 558
299 Ga0495681_0000405 3300047470 Bacteria 33516
300 Ga0495684_0288047 3300047471 Bacteria 1183
301 Ga0495684_0682875 3300047471 Bacteria 683
302 Ga0495686_0061061 3300047472 Bacteria 2342
303 Ga0495593_0014064 3300047673 Bacteria 4555
304 Ga0495593_0116703 3300047673 Bacteria 1360
305 Ga0495602_0049382 3300048088 Bacteria 3769
306 Ga0495602_0626798 3300048088 Bacteria 737
307 Ga0495614_0000983 3300048089 Bacteria 12115
308 Ga0495614_0004229 3300048089 Bacteria 6468
309 Ga0495614_0095959 3300048089 Bacteria 1292
310 Ga0495614_0216615 3300048089 Bacteria 869
311 Ga0495678_028203 3300049459 Bacteria 2373
312 Ga0501031_0010569 3300049568 Bacteria 6009
313 Ga0501032_0649019 3300049569 Bacteria 670
314 Ga0501033_0045225 3300049570 Bacteria 3276
315 Ga0501033_0454408 3300049570 Bacteria 889
316 Ga0501034_0019007 3300049571 Bacteria 7038
317 Ga0501034_0100328 3300049571 Bacteria 2889
318 Ga0501034_0939196 3300049571 Bacteria 751
319 Ga0501036_0064527 3300049572 Bacteria 3099
320 Ga0501036_0077854 3300049572 Bacteria 2805
321 Ga0501037_0164986 3300049573 Bacteria 1578
322 Ga0501038_0078604 3300049574 Bacteria 2783
323 Ga0501038_0164667 3300049574 Bacteria 1799
324 Ga0501038_0786002 3300049574 Bacteria 708
325 Ga0501039_0013134 3300049575 Bacteria 6330
326 Ga0501039_0105274 3300049575 Bacteria 2203
327 Ga0501042_0057458 3300049578 Bacteria 2776
328 Ga0501043_0005286 3300049579 Bacteria 10439
329 Ga0501043_0010991 3300049579 Bacteria 7089
330 Ga0501046_0009034 3300049580 Bacteria 8640
331 Ga0501046_0133272 3300049580 Bacteria 1883
332 Ga0501046_0686000 3300049580 Bacteria 722
333 Ga0501047_0010964 3300049581 Bacteria 8575
334 Ga0501047_0161679 3300049581 Bacteria 2111
335 Ga0501048_0005432 3300049582 Bacteria 9687
336 Ga0501069_0734413 3300049585 Bacteria 596
337 Ga0501070_0011738 3300049586 Bacteria 7399
338 Ga0501070_0074095 3300049586 Bacteria 2818
339 Ga0501070_0228570 3300049586 Bacteria 1525
340 Ga0501071_1582547 3300049587 Bacteria 506
341 Ga0501073_0086460 3300049589 Bacteria 2181
342 Ga0501074_0001433 3300049590 Bacteria 15931
343 Ga0501035_0002152 3300049822 Bacteria 19561
344 Ga0501035_0104328 3300049822 Bacteria 2486
345 Ga0501035_0495975 3300049822 Bacteria 1005
346 Ga0501035_0599127 3300049822 Bacteria 898
347 Ga0501044_0003227 3300049823 Bacteria 18356
348 Ga0501044_0086449 3300049823 Bacteria 3167
349 Ga0501044_0148965 3300049823 Bacteria 2323
350 Ga0501044_0160857 3300049823 Bacteria 2222
351 Ga0501044_0589914 3300049823 Bacteria 1005
352 Ga0501044_0721034 3300049823 Bacteria 881
353 Ga0501045_0082042 3300049824 Bacteria 2378
354 nmdc:mga03n38_198930_c1 3300050490 Bacteria 1036
355 nmdc:mga06z11_202100_c1 3300050494 Bacteria 1155
356 nmdc:mga04h51_5012_c1 3300050495 Bacteria 3345
357 nmdc:mga07m45_114380_c1 3300050496 Bacteria 1555
358 Ga0495619_0091595 3300053085 Bacteria 2058
359 Ga0500578_0171187 3300053086 Bacteria 1343
360 Ga0500578_0248610 3300053086 Bacteria 1072
361 Ga0500640_139752 3300053095 Bacteria 942
362 Ga0500553_180257 3300053101 Bacteria 759
363 Ga0500560_001798 3300053107 Bacteria 3867
364 Ga0500572_024459 3300053111 Bacteria 1630
365 Ga0500652_186102 3300053131 Bacteria 849
366 Ga0500573_0079124 3300053140 Bacteria 1870
367 Ga0500600_0110318 3300053149 Bacteria 1436
368 Ga0500600_0223667 3300053149 Bacteria 866
369 Ga0500600_0376296 3300053149 Bacteria 573
370 Ga0500633_0063865 3300053160 Bacteria 1301
371 Ga0500634_0238847 3300053161 Bacteria 765
372 Ga0466962_0007455 3300061719 Bacteria 5249
373 Ga0466962_0040470 3300061719 Bacteria 2231
374 Ga0466962_0125007 3300061719 Bacteria 1242
375 Ga0466962_0478235 3300061719 Bacteria 629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0028790 Ga0439448_0028790_370_759 112
2 3300042137 Ga0450902_002248 Ga0450902_002248_521_910 112
3 3300042138 Ga0450903_000720 Ga0450903_000720_2180_2569 112
4 3300042157 Ga0439458_0004166 Ga0439458_0004166_2798_3187 112
5 3300044658 Ga0466972_0029193 Ga0466972_0029193_1449_1838 112
6 3300044693 Ga0466961_0130619 Ga0466961_0130619_495_884 112
7 3300044901 Ga0466960_0008432 Ga0466960_0008432_2095_2484 112
8 3300046491 Ga0495584_0449034 Ga0495584_0449034_264_608 113
9 3300044683 Ga0466965_0598595 Ga0466965_0598595_200_592 114
10 3300003322 rootL2_10056401 rootL2_100564013 116
11 3300028786 Ga0307517_10088716 Ga0307517_100887163 117
12 3300028794 Ga0307515_10000541 Ga0307515_1000054129 117
13 3300031507 Ga0307509_10020123 Ga0307509_100201233 117
14 3300031616 Ga0307508_10094344 Ga0307508_100943442 117
15 3300031730 Ga0307516_10630460 Ga0307516_106304602 117
16 3300033179 Ga0307507_10030364 Ga0307507_100303643 117
17 3300033180 Ga0307510_10325073 Ga0307510_103250731 117
18 3300044694 Ga0466963_0026745 Ga0466963_0026745_1969_2358 117
19 3300044706 Ga0466964_0040571 Ga0466964_0040571_1011_1400 117
20 3300045976 Ga0466967_0040080 Ga0466967_0040080_1597_1986 117
21 3300046459 Ga0495629_0006011 Ga0495629_0006011_5168_5560 117
22 3300046519 Ga0495632_0541387 Ga0495632_0541387_78_470 117
23 3300046660 Ga0495625_0058688 Ga0495625_0058688_933_1325 117
24 3300046674 Ga0495588_0009466 Ga0495588_0009466_1846_2238 117
25 3300046692 Ga0495671_0001899 Ga0495671_0001899_9649_10041 117
26 3300047470 Ga0495681_0000405 Ga0495681_0000405_14929_15321 117
27 3300048089 Ga0495614_0095959 Ga0495614_0095959_115_507 117
28 3300053107 Ga0500560_001798 Ga0500560_001798_3288_3680 117
29 3300053131 Ga0500652_186102 Ga0500652_186102_281_673 117
30 3300053160 Ga0500633_0063865 Ga0500633_0063865_540_932 117
31 3300061719 Ga0466962_0478235 Ga0466962_0478235_191_580 117
32 3300049580 Ga0501046_0686000 Ga0501046_0686000_203_592 120
33 3300049823 Ga0501044_0003227 Ga0501044_0003227_2025_2414 120
34 iso_pu_bacteria 2912723979 2912724879 122
35 3300049570 Ga0501033_0045225 Ga0501033_0045225_2796_3185 124
36 3300049571 Ga0501034_0019007 Ga0501034_0019007_6474_6863 124
37 3300049572 Ga0501036_0077854 Ga0501036_0077854_259_648 124
38 3300049574 Ga0501038_0786002 Ga0501038_0786002_178_567 124
39 3300049579 Ga0501043_0010991 Ga0501043_0010991_830_1219 124
40 3300049581 Ga0501047_0161679 Ga0501047_0161679_1444_1833 124
41 3300049586 Ga0501070_0011738 Ga0501070_0011738_1079_1468 124
42 3300049589 Ga0501073_0086460 Ga0501073_0086460_283_672 124
43 3300049590 Ga0501074_0001433 Ga0501074_0001433_9614_10003 124
44 3300049822 Ga0501035_0002152 Ga0501035_0002152_5957_6346 124
45 3300049823 Ga0501044_0721034 Ga0501044_0721034_301_690 124
46 3300053085 Ga0495619_0091595 Ga0495619_0091595_839_1216 125
47 iso_pu_bacteria 2547132111 2547406962 125
48 iso_pu_bacteria 2582581313 2585309218 125
49 iso_pu_bacteria 2582581314 2585319796 125
50 iso_pu_bacteria 2616644814 2616697686 125
51 iso_pu_bacteria 2643221548 2643762148 125
52 iso_pu_bacteria 2643221578 2643901856 125
53 iso_pu_bacteria 2643221647 2644263232 125
54 iso_pu_bacteria 2643221673 2644408002 125
55 iso_pu_bacteria 2643221678 2644436535 125
56 iso_pu_bacteria 2643221682 2644459074 125
57 iso_pu_bacteria 2643221714 2644625622 125
58 iso_pu_bacteria 2784132148 2784587996 125
59 iso_pu_bacteria 2784746763 2785344138 125
60 iso_pu_bacteria 2784746768 2785368755 125
61 iso_pu_bacteria 2786546132 2786669861 125
62 iso_pu_bacteria 2802429296 2804849034 125
63 iso_pu_bacteria 2808606359 2808841427 125
64 iso_pu_bacteria 2808606375 2808919992 125
65 iso_pu_bacteria 2808606448 2809231601 125
66 iso_pu_bacteria 2811994879 2812358821 125
67 iso_pu_bacteria 2811994917 2812481107 125
68 iso_pu_bacteria 2818991463 2819699450 125
69 iso_pu_bacteria 2852635781 2852641892 125
70 iso_pu_bacteria 2862281513 2862287960 125
71 iso_pu_bacteria 2862382967 2862392966 125
72 iso_pu_bacteria 2862574272 2862579852 125
73 iso_pu_bacteria 2863404153 2863405398 125
74 iso_pu_bacteria 2867428634 2867438029 125
75 iso_pu_bacteria 2873151551 2873153395 125
76 iso_pu_bacteria 2875391855 2875397777 125
77 iso_pu_bacteria 2877676314 2877681758 125
78 iso_pu_bacteria 2912715099 2912720738 125
79 iso_pu_bacteria 2919468124 2919473564 125
80 iso_pu_bacteria 2946045630 2946046735 125
81 iso_pu_bacteria 2946064051 2946067050 125
82 iso_pu_bacteria 2946072368 2946075355 125
83 iso_pu_bacteria 2947224130 2947230179 125
84 iso_pu_bacteria 2954002825 2954003403 125
85 iso_pu_bacteria 2954380949 2954386906 125
86 iso_pu_bacteria 2954673503 2954676290 125
87 iso_pu_bacteria 2954682443 2954687879 125
88 iso_pu_bacteria 2954691527 2954697716 125
89 iso_pu_bacteria 2954701450 2954704500 125
90 iso_pu_bacteria 2954711539 2954716851 125
91 iso_pu_bacteria 2954721474 2954726799 125
92 iso_pu_bacteria 2954731030 2954734996 125
93 iso_pu_bacteria 2954740390 2954745722 125
94 iso_pu_bacteria 2954749733 2954753868 125
95 iso_pu_bacteria 2954759201 2954764696 125
96 iso_pu_bacteria 2966598605 2966599751 125
97 iso_pu_bacteria 2990059506 2990065797 125
98 iso_pu_bacteria 3006493962 3006501493 125
99 iso_pu_bacteria 8008558824 8008559679 125
100 iso_pu_bacteria 8008574985 8008579420 125
101 iso_pu_bacteria 8023623736 8023631008 125
102 iso_pu_bacteria 8025413630 8025418449 125
103 iso_pu_bacteria 8048406513 8048409354 125
104 iso_pu_bacteria 8055172936 8055179345 125
105 3300037418 Ga0395900_0418434 Ga0395900_0418434_897_1277 126
106 3300037466 Ga0395898_0013633 Ga0395898_0013633_4343_4723 126
107 3300044901 Ga0466960_0943411 Ga0466960_0943411_69_449 126
108 3300049822 Ga0501035_0599127 Ga0501035_0599127_380_760 126
109 3300049823 Ga0501044_0589914 Ga0501044_0589914_589_969 126
110 3300031456 Ga0307513_10265802 Ga0307513_102658023 127
111 3300003316 rootH1_10032377 rootH1_100323773 128
112 3300002075 JGI24738J21930_10033934 JGI24738J21930_100339342 129
113 3300003215 JGI25153J46596_10113833 JGI25153J46596_101138331 129
114 3300003320 rootH2_10042051 rootH2_100420512 129
115 3300003322 rootL2_10078854 rootL2_100788542 129
116 3300003323 rootH1_10015361 rootH1_100153613 129
117 3300003323 rootH1_10041793 rootH1_100417933 129
118 3300003578 Ga0006562J51391_1027451 Ga0006562J51391_10274514 129
119 3300003578 Ga0006562J51391_1027452 Ga0006562J51391_10274522 129
120 3300003578 Ga0006562J51391_1115102 Ga0006562J51391_11151022 129
121 3300003578 Ga0006562J51391_1115105 Ga0006562J51391_11151052 129
122 3300003578 Ga0006562J51391_1152979 Ga0006562J51391_11529792 129
123 3300005347 Ga0070668_102102616 Ga0070668_1021026161 129
124 3300005434 Ga0070709_11012787 Ga0070709_110127871 129
125 3300005563 Ga0068855_100416178 Ga0068855_1004161782 129
126 3300005614 Ga0068856_100233895 Ga0068856_1002338953 129
127 3300005937 Ga0081455_10327561 Ga0081455_103275612 129
128 3300006048 Ga0075363_100010456 Ga0075363_1000104563 129
129 3300006178 Ga0075367_10001800 Ga0075367_100018009 129
130 3300009148 Ga0105243_10873220 Ga0105243_108732202 129
131 3300009176 Ga0105242_10968318 Ga0105242_109683181 129
132 3300010375 Ga0105239_10421932 Ga0105239_104219322 129
133 3300011119 Ga0105246_10001746 Ga0105246_100017464 129
134 3300013307 Ga0157372_11268175 Ga0157372_112681752 129
135 3300014497 Ga0182008_10005624 Ga0182008_100056241 129
136 3300015262 Ga0182007_10002128 Ga0182007_100021286 129
137 3300015688 Ga0183367_1006 Ga0183367_1006317 129
138 3300025297 Ga0209758_1016418 Ga0209758_10164183 129
139 3300025935 Ga0207709_10068524 Ga0207709_100685243 129
140 3300025949 Ga0207667_10490894 Ga0207667_104908941 129
141 3300025961 Ga0207712_10486918 Ga0207712_104869182 129
142 3300026067 Ga0207678_10198003 Ga0207678_101980031 129
143 3300026078 Ga0207702_10488427 Ga0207702_104884272 129
144 3300027866 Ga0209813_10052716 Ga0209813_100527162 129
145 3300028794 Ga0307515_10139861 Ga0307515_101398614 129
146 3300028794 Ga0307515_10165999 Ga0307515_101659992 129
147 3300030521 Ga0307511_10005628 Ga0307511_1000562810 129
148 3300030521 Ga0307511_10307773 Ga0307511_103077732 129
149 3300030522 Ga0307512_10001869 Ga0307512_100018696 129
150 3300030736 Ga0316180_1078211 Ga0316180_10782111 129
151 3300031456 Ga0307513_10093571 Ga0307513_100935712 129
152 3300031456 Ga0307513_10404778 Ga0307513_104047782 129
153 3300031456 Ga0307513_10691961 Ga0307513_106919611 129
154 3300031507 Ga0307509_10021348 Ga0307509_100213486 129
155 3300031507 Ga0307509_10050714 Ga0307509_100507143 129
156 3300031616 Ga0307508_10010039 Ga0307508_100100397 129
157 3300031616 Ga0307508_10026670 Ga0307508_100266703 129
158 3300031616 Ga0307508_10347378 Ga0307508_103473782 129
159 3300031649 Ga0307514_10011385 Ga0307514_1001138510 129
160 3300031649 Ga0307514_10039711 Ga0307514_100397113 129
161 3300031649 Ga0307514_10159739 Ga0307514_101597391 129
162 3300031649 Ga0307514_10295256 Ga0307514_102952561 129
163 3300031649 Ga0307514_10361942 Ga0307514_103619422 129
164 3300031649 Ga0307514_10548584 Ga0307514_105485841 129
165 3300031730 Ga0307516_10012032 Ga0307516_100120321 129
166 3300031838 Ga0307518_10096207 Ga0307518_100962072 129
167 3300031838 Ga0307518_10482637 Ga0307518_104826372 129
168 3300031995 Ga0307409_100361691 Ga0307409_1003616912 129
169 3300031995 Ga0307409_102232848 Ga0307409_1022328482 129
170 3300032002 Ga0307416_103104725 Ga0307416_1031047251 129
171 3300032005 Ga0307411_10699390 Ga0307411_106993902 129
172 3300032126 Ga0307415_101147268 Ga0307415_1011472682 129
173 3300033179 Ga0307507_10021084 Ga0307507_100210844 129
174 3300033180 Ga0307510_10054625 Ga0307510_100546253 129
175 3300033180 Ga0307510_10197715 Ga0307510_101977152 129
176 3300033180 Ga0307510_10200796 Ga0307510_102007962 129
177 3300037466 Ga0395898_1286672 Ga0395898_1286672_231_620 129
178 3300041404 Ga0439436_0006262 Ga0439436_0006262_1123_1512 129
179 3300041404 Ga0439436_0022788 Ga0439436_0022788_878_1267 129
180 3300041456 Ga0451795_1435310 Ga0451795_1435310_54_449 129
181 3300041491 Ga0451833_1066800 Ga0451833_1066800_97_492 129
182 3300041498 Ga0451841_1023373 Ga0451841_1023373_179_574 129
183 3300041507 Ga0451851_1075388 Ga0451851_1075388_207_596 129
184 3300041509 Ga0451843_1439762 Ga0451843_1439762_459_848 129
185 3300041512 Ga0451853_0267097 Ga0451853_0267097_80_469 129
186 3300041512 Ga0451853_2399869 Ga0451853_2399869_148_537 129
187 3300041512 Ga0451853_3848033 Ga0451853_3848033_376_765 129
188 3300041999 Ga0439433_0000374 Ga0439433_0000374_2461_2850 129
189 3300041999 Ga0439433_0055792 Ga0439433_0055792_172_561 129
190 3300042007 Ga0439449_0008214 Ga0439449_0008214_3449_3838 129
191 3300042007 Ga0439449_0010788 Ga0439449_0010788_765_1154 129
192 3300042007 Ga0439449_0015193 Ga0439449_0015193_1430_1819 129
193 3300042007 Ga0439449_0032602 Ga0439449_0032602_888_1277 129
194 3300042007 Ga0439449_0385402 Ga0439449_0385402_131_520 129
195 3300042008 Ga0439450_015228 Ga0439450_015228_198_590 129
196 3300042014 Ga0439457_000938 Ga0439457_000938_8027_8416 129
197 3300042014 Ga0439457_035635 Ga0439457_035635_685_1074 129
198 3300042015 Ga0439462_0007297 Ga0439462_0007297_2082_2471 129
199 3300042015 Ga0439462_0150387 Ga0439462_0150387_86_475 129
200 3300042131 Ga0450894_000192 Ga0450894_000192_9325_9714 129
201 3300042135 Ga0450899_000333 Ga0450899_000333_2285_2674 129
202 3300042145 Ga0450906_000155 Ga0450906_000155_4942_5331 129
203 3300042185 Ga0450909_077452 Ga0450909_077452_102_491 129
204 3300044656 Ga0466969_0148083 Ga0466969_0148083_180_569 129
205 3300044658 Ga0466972_0001016 Ga0466972_0001016_8753_9142 129
206 3300044658 Ga0466972_0032749 Ga0466972_0032749_125_514 129
207 3300044658 Ga0466972_0054261 Ga0466972_0054261_316_705 129
208 3300044658 Ga0466972_0453503 Ga0466972_0453503_146_535 129
209 3300044683 Ga0466965_0006945 Ga0466965_0006945_3090_3479 129
210 3300044683 Ga0466965_0064049 Ga0466965_0064049_1226_1615 129
211 3300044683 Ga0466965_0079002 Ga0466965_0079002_223_612 129
212 3300044684 Ga0466966_0009137 Ga0466966_0009137_1956_2345 129
213 3300044684 Ga0466966_0186926 Ga0466966_0186926_765_1154 129
214 3300044693 Ga0466961_0005533 Ga0466961_0005533_2013_2402 129
215 3300044693 Ga0466961_0020626 Ga0466961_0020626_741_1130 129
216 3300044694 Ga0466963_0002312 Ga0466963_0002312_4067_4456 129
217 3300044694 Ga0466963_0157494 Ga0466963_0157494_195_584 129
218 3300044706 Ga0466964_0022499 Ga0466964_0022499_2013_2402 129
219 3300044719 Ga0466971_0009115 Ga0466971_0009115_2308_2697 129
220 3300044719 Ga0466971_0188436 Ga0466971_0188436_337_726 129
221 3300044735 Ga0466968_0121410 Ga0466968_0121410_65_454 129
222 3300044765 Ga0466970_0001488 Ga0466970_0001488_10830_11219 129
223 3300044765 Ga0466970_0003950 Ga0466970_0003950_1927_2316 129
224 3300044842 Ga0466957_0076957 Ga0466957_0076957_1627_2016 129
225 3300044901 Ga0466960_0552600 Ga0466960_0552600_102_491 129
226 3300045049 Ga0466959_0004028 Ga0466959_0004028_5100_5489 129
227 3300045836 Ga0466958_0004295 Ga0466958_0004295_4935_5324 129
228 3300045836 Ga0466958_0236594 Ga0466958_0236594_537_926 129
229 3300045976 Ga0466967_0104595 Ga0466967_0104595_2105_2494 129
230 3300045976 Ga0466967_0200345 Ga0466967_0200345_19_408 129
231 3300046452 Ga0495617_021479 Ga0495617_021479_1771_2160 129
232 3300046455 Ga0495603_0000531 Ga0495603_0000531_20692_21081 129
233 3300046455 Ga0495603_0003456 Ga0495603_0003456_8514_8903 129
234 3300046455 Ga0495603_0023092 Ga0495603_0023092_254_643 129
235 3300046455 Ga0495603_0026475 Ga0495603_0026475_2301_2690 129
236 3300046455 Ga0495603_0074493 Ga0495603_0074493_1507_1896 129
237 3300046455 Ga0495603_0139045 Ga0495603_0139045_286_675 129
238 3300046457 Ga0495590_0048617 Ga0495590_0048617_884_1273 129
239 3300046459 Ga0495629_0000707 Ga0495629_0000707_5177_5566 129
240 3300046459 Ga0495629_0002283 Ga0495629_0002283_8561_8950 129
241 3300046459 Ga0495629_0330213 Ga0495629_0330213_249_638 129
242 3300046459 Ga0495629_0520511 Ga0495629_0520511_58_447 129
243 3300046460 Ga0495638_0046410 Ga0495638_0046410_217_606 129
244 3300046460 Ga0495638_0368256 Ga0495638_0368256_19_408 129
245 3300046462 Ga0495651_0012456 Ga0495651_0012456_2017_2406 129
246 3300046462 Ga0495651_0222480 Ga0495651_0222480_134_523 129
247 3300046463 Ga0495653_0781349 Ga0495653_0781349_52_441 129
248 3300046473 Ga0495582_0040469 Ga0495582_0040469_365_754 129
249 3300046473 Ga0495582_0088584 Ga0495582_0088584_1229_1618 129
250 3300046474 Ga0495605_0012608 Ga0495605_0012608_2689_3078 129
251 3300046475 Ga0495639_0618410 Ga0495639_0618410_24_413 129
252 3300046476 Ga0495662_0003473 Ga0495662_0003473_5460_5849 129
253 3300046476 Ga0495662_0032350 Ga0495662_0032350_594_983 129
254 3300046477 Ga0495664_0088115 Ga0495664_0088115_788_1177 129
255 3300046477 Ga0495664_0097180 Ga0495664_0097180_65_454 129
256 3300046492 Ga0495585_0008411 Ga0495585_0008411_512_901 129
257 3300046492 Ga0495585_0012882 Ga0495585_0012882_868_1257 129
258 3300046492 Ga0495585_0029855 Ga0495585_0029855_1995_2384 129
259 3300046499 Ga0495594_0000260 Ga0495594_0000260_1088_1477 129
260 3300046499 Ga0495594_0002727 Ga0495594_0002727_289_678 129
261 3300046499 Ga0495594_0085355 Ga0495594_0085355_50_439 129
262 3300046499 Ga0495594_0112504 Ga0495594_0112504_923_1312 129
263 3300046500 Ga0495596_0009287 Ga0495596_0009287_658_1047 129
264 3300046501 Ga0495607_0038172 Ga0495607_0038172_2195_2584 129
265 3300046501 Ga0495607_0085290 Ga0495607_0085290_689_1078 129
266 3300046501 Ga0495607_0098230 Ga0495607_0098230_833_1222 129
267 3300046506 Ga0495583_0016696 Ga0495583_0016696_3313_3702 129
268 3300046506 Ga0495583_0283445 Ga0495583_0283445_244_633 129
269 3300046506 Ga0495583_0325458 Ga0495583_0325458_77_466 129
270 3300046506 Ga0495583_0356831 Ga0495583_0356831_31_420 129
271 3300046506 Ga0495583_0434954 Ga0495583_0434954_115_504 129
272 3300046511 Ga0495608_0401695 Ga0495608_0401695_343_732 129
273 3300046513 Ga0495616_0009853 Ga0495616_0009853_72_461 129
274 3300046514 Ga0495618_0015177 Ga0495618_0015177_1808_2197 129
275 3300046514 Ga0495618_0111758 Ga0495618_0111758_1341_1730 129
276 3300046515 Ga0495620_0006156 Ga0495620_0006156_3065_3454 129
277 3300046516 Ga0495628_0018492 Ga0495628_0018492_378_767 129
278 3300046516 Ga0495628_0032171 Ga0495628_0032171_1470_1859 129
279 3300046520 Ga0495637_0141399 Ga0495637_0141399_243_632 129
280 3300046522 Ga0495643_0053776 Ga0495643_0053776_272_661 129
281 3300046523 Ga0495644_0110460 Ga0495644_0110460_427_816 129
282 3300046524 Ga0495648_0216300 Ga0495648_0216300_317_706 129
283 3300046526 Ga0495666_0303140 Ga0495666_0303140_38_427 129
284 3300046529 Ga0495652_0017915 Ga0495652_0017915_3885_4274 129
285 3300046529 Ga0495652_0271219 Ga0495652_0271219_703_1092 129
286 3300046530 Ga0495654_0176228 Ga0495654_0176228_114_503 129
287 3300046531 Ga0495665_0304481 Ga0495665_0304481_281_670 129
288 3300046533 Ga0495640_0040664 Ga0495640_0040664_293_682 129
289 3300046533 Ga0495640_0053048 Ga0495640_0053048_2248_2637 129
290 3300046536 Ga0495587_0004766 Ga0495587_0004766_4899_5288 129
291 3300046538 Ga0495609_0048325 Ga0495609_0048325_807_1196 129
292 3300046542 Ga0495597_0259839 Ga0495597_0259839_131_520 129
293 3300046543 Ga0495645_0025262 Ga0495645_0025262_1013_1402 129
294 3300046557 Ga0495622_0003092 Ga0495622_0003092_83_472 129
295 3300046557 Ga0495622_0009499 Ga0495622_0009499_494_883 129
296 3300046557 Ga0495622_0020377 Ga0495622_0020377_506_895 129
297 3300046557 Ga0495622_0053141 Ga0495622_0053141_1269_1658 129
298 3300046558 Ga0495633_0043965 Ga0495633_0043965_627_1016 129
299 3300046616 Ga0495668_0011865 Ga0495668_0011865_144_533 129
300 3300046642 Ga0495634_0001005 Ga0495634_0001005_10876_11265 129
301 3300046642 Ga0495634_0048371 Ga0495634_0048371_1009_1398 129
302 3300046642 Ga0495634_0286956 Ga0495634_0286956_333_722 129
303 3300046648 Ga0495611_0003229 Ga0495611_0003229_5997_6386 129
304 3300046648 Ga0495611_0034042 Ga0495611_0034042_280_669 129
305 3300046648 Ga0495611_0123085 Ga0495611_0123085_289_678 129
306 3300046648 Ga0495611_0254051 Ga0495611_0254051_42_431 129
307 3300046648 Ga0495611_0284184 Ga0495611_0284184_280_669 129
308 3300046660 Ga0495625_0020564 Ga0495625_0020564_1923_2312 129
309 3300046660 Ga0495625_0031424 Ga0495625_0031424_2725_3117 129
310 3300046660 Ga0495625_0043039 Ga0495625_0043039_793_1182 129
311 3300046660 Ga0495625_0274113 Ga0495625_0274113_646_1035 129
312 3300046660 Ga0495625_0517940 Ga0495625_0517940_62_451 129
313 3300046663 Ga0495635_0024236 Ga0495635_0024236_782_1171 129
314 3300046663 Ga0495635_0245584 Ga0495635_0245584_128_517 129
315 3300046665 Ga0495661_0013603 Ga0495661_0013603_4853_5242 129
316 3300046674 Ga0495588_0002109 Ga0495588_0002109_4769_5158 129
317 3300046675 Ga0495657_0001985 Ga0495657_0001985_3275_3664 129
318 3300046675 Ga0495657_0076576 Ga0495657_0076576_307_696 129
319 3300046675 Ga0495657_0130496 Ga0495657_0130496_452_841 129
320 3300046678 Ga0495599_0360009 Ga0495599_0360009_51_440 129
321 3300046679 Ga0495623_0159427 Ga0495623_0159427_518_907 129
322 3300046680 Ga0495646_0029076 Ga0495646_0029076_3036_3425 129
323 3300046680 Ga0495646_0248268 Ga0495646_0248268_105_494 129
324 3300046689 Ga0495613_0022990 Ga0495613_0022990_4172_4561 129
325 3300046689 Ga0495613_0103869 Ga0495613_0103869_1469_1858 129
326 3300046689 Ga0495613_0254569 Ga0495613_0254569_549_938 129
327 3300046689 Ga0495613_0445349 Ga0495613_0445349_153_542 129
328 3300046689 Ga0495613_0459729 Ga0495613_0459729_388_777 129
329 3300046690 Ga0495624_0013886 Ga0495624_0013886_4087_4476 129
330 3300046691 Ga0495670_0694701 Ga0495670_0694701_136_525 129
331 3300046691 Ga0495670_0774626 Ga0495670_0774626_64_453 129
332 3300046692 Ga0495671_0226401 Ga0495671_0226401_191_580 129
333 3300046694 Ga0495649_0018821 Ga0495649_0018821_2690_3079 129
334 3300046694 Ga0495649_0034524 Ga0495649_0034524_1342_1731 129
335 3300046794 Ga0495589_0004123 Ga0495589_0004123_3591_3980 129
336 3300046794 Ga0495589_0050139 Ga0495589_0050139_970_1359 129
337 3300046794 Ga0495589_0072388 Ga0495589_0072388_1246_1635 129
338 3300046809 Ga0495600_0044056 Ga0495600_0044056_1928_2317 129
339 3300046809 Ga0495600_0053776 Ga0495600_0053776_2015_2404 129
340 3300046810 Ga0495660_0003952 Ga0495660_0003952_5009_5398 129
341 3300046810 Ga0495660_0049972 Ga0495660_0049972_259_648 129
342 3300046810 Ga0495660_0281959 Ga0495660_0281959_40_429 129
343 3300047315 Ga0495581_0017820 Ga0495581_0017820_3235_3624 129
344 3300047315 Ga0495581_0451032 Ga0495581_0451032_299_688 129
345 3300047317 Ga0495604_0000237 Ga0495604_0000237_11030_11419 129
346 3300047317 Ga0495604_0105742 Ga0495604_0105742_1653_2042 129
347 3300047317 Ga0495604_0245496 Ga0495604_0245496_793_1182 129
348 3300047318 Ga0495636_0003544 Ga0495636_0003544_5465_5854 129
349 3300047318 Ga0495636_0097650 Ga0495636_0097650_398_787 129
350 3300047318 Ga0495636_0373389 Ga0495636_0373389_249_638 129
351 3300047319 Ga0495674_0234659 Ga0495674_0234659_242_631 129
352 3300047319 Ga0495674_0592711 Ga0495674_0592711_475_864 129
353 3300047320 Ga0495672_0140358 Ga0495672_0140358_759_1148 129
354 3300047321 Ga0495676_0004323 Ga0495676_0004323_5095_5484 129
355 3300047321 Ga0495676_0008993 Ga0495676_0008993_8704_9093 129
356 3300047321 Ga0495676_0009988 Ga0495676_0009988_3489_3878 129
357 3300047321 Ga0495676_0016122 Ga0495676_0016122_1692_2081 129
358 3300047321 Ga0495676_0042694 Ga0495676_0042694_2498_2887 129
359 3300047321 Ga0495676_0396360 Ga0495676_0396360_257_646 129
360 3300047321 Ga0495676_0533304 Ga0495676_0533304_313_702 129
361 3300047322 Ga0495680_0165555 Ga0495680_0165555_219_608 129
362 3300047323 Ga0495683_0003480 Ga0495683_0003480_3658_4047 129
363 3300047323 Ga0495683_0020847 Ga0495683_0020847_1269_1658 129
364 3300047323 Ga0495683_0061458 Ga0495683_0061458_1198_1587 129
365 3300047323 Ga0495683_0124720 Ga0495683_0124720_502_891 129
366 3300047443 Ga0495687_000551 Ga0495687_000551_6906_7295 129
367 3300047443 Ga0495687_003518 Ga0495687_003518_8711_9100 129
368 3300047443 Ga0495687_015321 Ga0495687_015321_3367_3756 129
369 3300047443 Ga0495687_019520 Ga0495687_019520_2745_3134 129
370 3300047443 Ga0495687_055075 Ga0495687_055075_728_1117 129
371 3300047443 Ga0495687_096986 Ga0495687_096986_471_860 129
372 3300047443 Ga0495687_112048 Ga0495687_112048_568_957 129
373 3300047444 Ga0495675_0059662 Ga0495675_0059662_1969_2358 129
374 3300047444 Ga0495675_0692283 Ga0495675_0692283_28_417 129
375 3300047445 Ga0495677_0016737 Ga0495677_0016737_1020_1409 129
376 3300047445 Ga0495677_0328115 Ga0495677_0328115_82_471 129
377 3300047447 Ga0495685_009358 Ga0495685_009358_421_810 129
378 3300047447 Ga0495685_041531 Ga0495685_041531_124_513 129
379 3300047447 Ga0495685_253658 Ga0495685_253658_103_492 129
380 3300047471 Ga0495684_0288047 Ga0495684_0288047_21_410 129
381 3300047471 Ga0495684_0682875 Ga0495684_0682875_221_610 129
382 3300047472 Ga0495686_0061061 Ga0495686_0061061_442_831 129
383 3300047673 Ga0495593_0014064 Ga0495593_0014064_3887_4276 129
384 3300047673 Ga0495593_0116703 Ga0495593_0116703_948_1337 129
385 3300048088 Ga0495602_0049382 Ga0495602_0049382_1236_1625 129
386 3300048088 Ga0495602_0626798 Ga0495602_0626798_169_558 129
387 3300048089 Ga0495614_0000983 Ga0495614_0000983_41_430 129
388 3300048089 Ga0495614_0004229 Ga0495614_0004229_2142_2531 129
389 3300048089 Ga0495614_0216615 Ga0495614_0216615_137_526 129
390 3300049459 Ga0495678_028203 Ga0495678_028203_1260_1649 129
391 3300049568 Ga0501031_0010569 Ga0501031_0010569_2729_3118 129
392 3300049569 Ga0501032_0649019 Ga0501032_0649019_240_629 129
393 3300049570 Ga0501033_0454408 Ga0501033_0454408_380_781 129
394 3300049571 Ga0501034_0100328 Ga0501034_0100328_2277_2666 129
395 3300049571 Ga0501034_0939196 Ga0501034_0939196_264_665 129
396 3300049572 Ga0501036_0064527 Ga0501036_0064527_469_858 129
397 3300049573 Ga0501037_0164986 Ga0501037_0164986_601_1002 129
398 3300049574 Ga0501038_0078604 Ga0501038_0078604_107_496 129
399 3300049574 Ga0501038_0164667 Ga0501038_0164667_1308_1697 129
400 3300049575 Ga0501039_0013134 Ga0501039_0013134_5661_6050 129
401 3300049575 Ga0501039_0105274 Ga0501039_0105274_37_426 129
402 3300049578 Ga0501042_0057458 Ga0501042_0057458_2339_2728 129
403 3300049579 Ga0501043_0005286 Ga0501043_0005286_2847_3236 129
404 3300049580 Ga0501046_0009034 Ga0501046_0009034_5524_5913 129
405 3300049580 Ga0501046_0133272 Ga0501046_0133272_336_737 129
406 3300049581 Ga0501047_0010964 Ga0501047_0010964_3255_3656 129
407 3300049582 Ga0501048_0005432 Ga0501048_0005432_234_623 129
408 3300049585 Ga0501069_0734413 Ga0501069_0734413_51_440 129
409 3300049586 Ga0501070_0074095 Ga0501070_0074095_131_520 129
410 3300049586 Ga0501070_0228570 Ga0501070_0228570_763_1152 129
411 3300049587 Ga0501071_1582547 Ga0501071_1582547_98_487 129
412 3300049822 Ga0501035_0104328 Ga0501035_0104328_1940_2329 129
413 3300049822 Ga0501035_0495975 Ga0501035_0495975_177_566 129
414 3300049823 Ga0501044_0086449 Ga0501044_0086449_2109_2498 129
415 3300049823 Ga0501044_0148965 Ga0501044_0148965_1282_1671 129
416 3300049823 Ga0501044_0160857 Ga0501044_0160857_1372_1773 129
417 3300049824 Ga0501045_0082042 Ga0501045_0082042_1256_1645 129
418 3300050490 nmdc:mga03n38_198930_c1 nmdc:mga03n38_198930_c1_167_562 129
419 3300050494 nmdc:mga06z11_202100_c1 nmdc:mga06z11_202100_c1_395_784 129
420 3300050495 nmdc:mga04h51_5012_c1 nmdc:mga04h51_5012_c1_2576_2965 129
421 3300050496 nmdc:mga07m45_114380_c1 nmdc:mga07m45_114380_c1_653_1042 129
422 3300053086 Ga0500578_0171187 Ga0500578_0171187_878_1267 129
423 3300053086 Ga0500578_0248610 Ga0500578_0248610_661_1050 129
424 3300053095 Ga0500640_139752 Ga0500640_139752_31_420 129
425 3300053101 Ga0500553_180257 Ga0500553_180257_274_663 129
426 3300053111 Ga0500572_024459 Ga0500572_024459_32_421 129
427 3300053140 Ga0500573_0079124 Ga0500573_0079124_497_886 129
428 3300053149 Ga0500600_0110318 Ga0500600_0110318_141_530 129
429 3300053149 Ga0500600_0223667 Ga0500600_0223667_426_815 129
430 3300053149 Ga0500600_0376296 Ga0500600_0376296_110_499 129
431 3300053161 Ga0500634_0238847 Ga0500634_0238847_351_740 129
432 3300061719 Ga0466962_0007455 Ga0466962_0007455_2905_3294 129
433 3300061719 Ga0466962_0040470 Ga0466962_0040470_461_850 129
434 3300061719 Ga0466962_0125007 Ga0466962_0125007_681_1070 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05025

RbsD_FucU

RbsD / FucU transport protein family

1

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ogc-assembly1.cif.gz_A the structure of bacillus subtilis rbsd complexed with d-ribose 0.9118 5 129
1ogc-assembly1.cif.gz_A the structure of bacillus subtilis rbsd complexed with d-ribose 0.8785 5 129
3p12-assembly1.cif.gz_D crystal structure of d-ribose pyranase sa240 0.8722 7 127
3mvk-assembly5.cif.gz_D the crystal structure of fucu from bifidobacterium longum to 1.65a 0.8244 9 129
3p12-assembly1.cif.gz_D crystal structure of d-ribose pyranase sa240 0.8222 7 127
ID Description Score Start End Superfamily
1ogcA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9263 8 126 3.40.1650.10
1ogcA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9045 8 126 3.40.1650.10
3p12A01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8515 8 125 3.40.1650.10
2wcvA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8156 9 126 3.40.1650.10
af_D4ACG8_1_149_3.40.1650.10 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.813 11 129 3.40.1650.10
ID Description Score Start End GO Terms
AF-A0A7Z9CVP0-F1-model_v4 deleted 0.9478 61 129
AF-S4MF17-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9468 40 129 GO:0005829
GO:0016872
GO:0019303
GO:0048029
GO:0062193
AF-A0A396QGB1-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9364 55 129 GO:0005996
GO:0048029
GO:0062193
AF-A0A370IEQ9-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9348 11 129 GO:0005829
GO:0016872
GO:0019303
GO:0048029
GO:0062193
AF-A0A1I3HQR8-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9318 55 129 GO:0005829
GO:0016872
GO:0019303
GO:0048029
GO:0062193

Feature Viewer

pLDDT pTM Quality
85.09 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map