F443186

General Info

Members Datasets Scaffolds Average Seq Length
434 239 433 153

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0131833|Ga0501034_0131833_1328_1873
Length 181
Sequence MSGGRRRNLFLWNAAAARLTLAALPSKGWRMSKELVVIRLPHAEGLPLPAYQSAGAAGMDLSAAVPEDRPLLLLPGRRALVDTGFILQIPEGYEGQVRPRSGLALKHGVTCLNTPGTIDSDYRGEVKVLLVNLGDEDFRVTRGMRIAQLVLAPVSRLAVREAAEPETTARGAGGFGSTGSS

Samples

Sample ID Description Type Environment
1 2643221734 Bosea sp. Root670 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
230 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
238 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
239 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 0
Rhizoplane 2.07
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10004117 3300005327 Bacteria 11920
2 Ga0070658_10635491 3300005327 Bacteria 926
3 Ga0070676_10037515 3300005328 Bacteria 2795
4 Ga0070676_10225598 3300005328 Bacteria 1239
5 Ga0070676_10248362 3300005328 Bacteria 1186
6 Ga0070683_100399641 3300005329 Bacteria 1310
7 Ga0070683_100630515 3300005329 Bacteria 1026
8 Ga0070690_100897954 3300005330 Bacteria 693
9 Ga0070677_10105477 3300005333 Bacteria 1250
10 Ga0068869_100049554 3300005334 Bacteria 3041
11 Ga0070680_100002580 3300005336 Bacteria 13414
12 Ga0070680_101232443 3300005336 Bacteria 647
13 Ga0068868_100200360 3300005338 Bacteria 1664
14 Ga0068868_100222700 3300005338 Bacteria 1580
15 Ga0068868_100410224 3300005338 Bacteria 1171
16 Ga0070689_100118306 3300005340 Bacteria 2114
17 Ga0070689_100582977 3300005340 Bacteria 967
18 Ga0070691_10002498 3300005341 Bacteria 8185
19 Ga0070661_100387712 3300005344 Bacteria 1102
20 Ga0070668_101117686 3300005347 Bacteria 712
21 Ga0070675_100039780 3300005354 Bacteria 3838
22 Ga0070675_100364669 3300005354 Bacteria 1283
23 Ga0070671_100652686 3300005355 Bacteria 911
24 Ga0070671_100940085 3300005355 Bacteria 756
25 Ga0070671_101699729 3300005355 Bacteria 560
26 Ga0070673_100101443 3300005364 Bacteria 2371
27 Ga0070673_100196652 3300005364 Bacteria 1735
28 Ga0070673_100555158 3300005364 Bacteria 1044
29 Ga0070659_100420312 3300005366 Bacteria 1130
30 Ga0070709_10066126 3300005434 Bacteria 2318
31 Ga0070714_101413921 3300005435 Bacteria 679
32 Ga0070713_100054621 3300005436 Bacteria 3315
33 Ga0070713_100327196 3300005436 Bacteria 1417
34 Ga0070713_100774613 3300005436 Unclassified 919
35 Ga0070708_100041603 3300005445 Bacteria 4029
36 Ga0070678_100016748 3300005456 Bacteria 4698
37 Ga0070678_100082573 3300005456 Bacteria 2440
38 Ga0070678_100207838 3300005456 Bacteria 1620
39 Ga0070678_100253477 3300005456 Bacteria 1477
40 Ga0070678_100358901 3300005456 Bacteria 1255
41 Ga0070662_100870604 3300005457 Bacteria 768
42 Ga0070681_10029792 3300005458 Bacteria 5478
43 Ga0070681_10806054 3300005458 Bacteria 856
44 Ga0070685_10568429 3300005466 Bacteria 812
45 Ga0070706_100190341 3300005467 Bacteria 1917
46 Ga0070698_100002456 3300005471 Bacteria 20448
47 Ga0070699_100077722 3300005518 Bacteria 2889
48 Ga0070679_100005182 3300005530 Bacteria 12062
49 Ga0070684_100402896 3300005535 Bacteria 1261
50 Ga0070697_100032373 3300005536 Bacteria 4207
51 Ga0070697_100802042 3300005536 Bacteria 833
52 Ga0068853_100467795 3300005539 Bacteria 1187
53 Ga0068853_100572814 3300005539 Bacteria 1071
54 Ga0068853_100992578 3300005539 Bacteria 808
55 Ga0068853_101106480 3300005539 Bacteria 764
56 Ga0070672_101208240 3300005543 Bacteria 674
57 Ga0070696_100212741 3300005546 Bacteria 1448
58 Ga0070696_100363817 3300005546 Bacteria 1123
59 Ga0070693_100905641 3300005547 Bacteria 661
60 Ga0070665_100023165 3300005548 Bacteria 6254
61 Ga0070665_100028269 3300005548 Bacteria 5647
62 Ga0070665_100132302 3300005548 Bacteria 2497
63 Ga0070665_100794386 3300005548 Bacteria 959
64 Ga0070665_100866976 3300005548 Bacteria 916
65 Ga0070665_101098270 3300005548 Bacteria 807
66 Ga0068855_100066359 3300005563 Bacteria 4207
67 Ga0068855_100313733 3300005563 Bacteria 1734
68 Ga0068855_100785719 3300005563 Bacteria 1013
69 Ga0070664_100462730 3300005564 Bacteria 1165
70 Ga0068857_100026622 3300005577 Bacteria 5097
71 Ga0068857_100209157 3300005577 Bacteria 1780
72 Ga0068857_100688441 3300005577 Bacteria 971
73 Ga0068854_101124032 3300005578 Bacteria 701
74 Ga0068856_100005899 3300005614 Bacteria 12065
75 Ga0068856_100229932 3300005614 Bacteria 1870
76 Ga0068856_100253213 3300005614 Bacteria 1776
77 Ga0068852_100633632 3300005616 Bacteria 1075
78 Ga0068852_102114260 3300005616 Bacteria 585
79 Ga0068859_100040531 3300005617 Bacteria 4675
80 Ga0068859_101172488 3300005617 Bacteria 846
81 Ga0068864_100469684 3300005618 Bacteria 1206
82 Ga0068864_100691246 3300005618 Bacteria 996
83 Ga0068864_101352722 3300005618 Bacteria 713
84 Ga0068861_100233225 3300005719 Bacteria 1562
85 Ga0068861_100566426 3300005719 Bacteria 1037
86 Ga0068851_10605926 3300005834 Bacteria 667
87 Ga0068870_10040147 3300005840 Bacteria 2425
88 Ga0068870_10412074 3300005840 Bacteria 882
89 Ga0068860_100346549 3300005843 Bacteria 1461
90 Ga0068860_100639955 3300005843 Bacteria 1071
91 Ga0068862_100406208 3300005844 Bacteria 1275
92 Ga0068862_100465741 3300005844 Bacteria 1194
93 Ga0081455_10001094 3300005937 Bacteria 34022
94 Ga0081455_10004620 3300005937 Bacteria 15371
95 Ga0081455_10029189 3300005937 Bacteria 5031
96 Ga0081455_10087762 3300005937 Bacteria 2530
97 Ga0081540_1061149 3300005983 Bacteria 1797
98 Ga0081539_10002511 3300005985 Bacteria 25649
99 Ga0070717_10166454 3300006028 Bacteria 1915
100 Ga0075365_10410867 3300006038 Bacteria 955
101 Ga0075363_100062891 3300006048 Bacteria 2002
102 Ga0075363_100348951 3300006048 Bacteria 864
103 Ga0075364_10197835 3300006051 Bacteria 1362
104 Ga0070715_10421371 3300006163 Bacteria 747
105 Ga0075362_10022167 3300006177 Bacteria 2673
106 Ga0075362_10050920 3300006177 Bacteria 1853
107 Ga0075362_10067027 3300006177 Bacteria 1633
108 Ga0075362_10417139 3300006177 Bacteria 678
109 Ga0075367_10008132 3300006178 Bacteria 5417
110 Ga0075367_10045170 3300006178 Bacteria 2584
111 Ga0075367_10135392 3300006178 Bacteria 1524
112 Ga0075367_10263406 3300006178 Bacteria 1082
113 Ga0075367_10646566 3300006178 Bacteria 672
114 Ga0075369_10005481 3300006186 Bacteria 4745
115 Ga0075369_10006398 3300006186 Bacteria 4451
116 Ga0075366_10008310 3300006195 Bacteria 5765
117 Ga0075366_10023591 3300006195 Bacteria 3585
118 Ga0075366_10425813 3300006195 Bacteria 818
119 Ga0097621_100011195 3300006237 Bacteria 6604
120 Ga0097621_100126907 3300006237 Bacteria 2168
121 Ga0097621_100134205 3300006237 Bacteria 2110
122 Ga0075370_10037002 3300006353 Bacteria 2743
123 Ga0075370_10170133 3300006353 Bacteria 1281
124 Ga0075370_10233660 3300006353 Bacteria 1088
125 Ga0068871_100030597 3300006358 Bacteria 4240
126 Ga0068871_100341746 3300006358 Bacteria 1322
127 Ga0068871_101278081 3300006358 Bacteria 690
128 Ga0075430_100552333 3300006846 Bacteria 950
129 Ga0075433_10039312 3300006852 Bacteria 4090
130 Ga0068865_100451273 3300006881 Bacteria 1063
131 Ga0068865_100733631 3300006881 Bacteria 847
132 Ga0075436_100973565 3300006914 Bacteria 636
133 Ga0097620_100040531 3300006931 Bacteria 4675
134 Ga0097620_101172567 3300006931 Bacteria 846
135 Ga0105240_10015967 3300009093 Bacteria 10179
136 Ga0105240_10254259 3300009093 Bacteria 2030
137 Ga0111539_10561052 3300009094 Bacteria 1330
138 Ga0105245_10169752 3300009098 Bacteria 2077
139 Ga0105245_10351052 3300009098 Bacteria 1461
140 Ga0105245_10836703 3300009098 Bacteria 960
141 Ga0105245_11024298 3300009098 Bacteria 870
142 Ga0114129_10010456 3300009147 Bacteria 13236
143 Ga0105243_10113516 3300009148 Bacteria 2272
144 Ga0105243_10232030 3300009148 Bacteria 1638
145 Ga0105241_10003207 3300009174 Bacteria 12173
146 Ga0105241_10382856 3300009174 Bacteria 1230
147 Ga0105241_10798949 3300009174 Bacteria 869
148 Ga0105241_11908583 3300009174 Bacteria 582
149 Ga0105248_10083526 3300009177 Bacteria 3593
150 Ga0105248_12495656 3300009177 Bacteria 589
151 Ga0105237_10436384 3300009545 Bacteria 1315
152 Ga0105237_10968536 3300009545 Bacteria 858
153 Ga0105238_10253865 3300009551 Bacteria 1737
154 Ga0105238_10268811 3300009551 Bacteria 1685
155 Ga0105249_10966096 3300009553 Bacteria 920
156 Ga0105249_10969098 3300009553 Bacteria 919
157 Ga0105249_11479386 3300009553 Bacteria 751
158 Ga0105239_10118929 3300010375 Bacteria 2932
159 Ga0105239_10918702 3300010375 Bacteria 1005
160 Ga0105239_12402788 3300010375 Bacteria 614
161 Ga0105246_10018227 3300011119 Bacteria 4473
162 Ga0105246_10174778 3300011119 Bacteria 1648
163 Ga0157373_10259001 3300013100 Bacteria 1231
164 Ga0157373_10276264 3300013100 Bacteria 1190
165 Ga0157370_10058428 3300013104 Bacteria 3666
166 Ga0157370_10562874 3300013104 Bacteria 1045
167 Ga0157369_10052430 3300013105 Bacteria 4414
168 Ga0157369_10182054 3300013105 Bacteria 2211
169 Ga0157374_10553893 3300013296 Bacteria 1158
170 Ga0157378_10062860 3300013297 Bacteria 3316
171 Ga0157378_11253113 3300013297 Bacteria 782
172 Ga0157372_10031685 3300013307 Bacteria 5789
173 Ga0157372_10145391 3300013307 Bacteria 2734
174 Ga0157372_11433084 3300013307 Bacteria 796
175 Ga0157375_10403366 3300013308 Bacteria 1534
176 Ga0157375_10542380 3300013308 Bacteria 1325
177 Ga0157375_12621343 3300013308 Bacteria 602
178 Ga0163163_11031626 3300014325 Bacteria 886
179 Ga0163163_11194260 3300014325 Bacteria 823
180 Ga0163163_11221167 3300014325 Bacteria 814
181 Ga0182008_10307924 3300014497 Bacteria 830
182 Ga0182008_10543252 3300014497 Bacteria 645
183 Ga0157377_10645008 3300014745 Bacteria 761
184 Ga0157379_10000985 3300014968 Bacteria 23098
185 Ga0157379_10013478 3300014968 Bacteria 7163
186 Ga0157379_10282632 3300014968 Bacteria 1510
187 Ga0157379_10733225 3300014968 Bacteria 929
188 Ga0157376_10426126 3300014969 Bacteria 1289
189 Ga0157376_10546724 3300014969 Bacteria 1145
190 Ga0157376_11828484 3300014969 Bacteria 644
191 Ga0157376_12588103 3300014969 Bacteria 547
192 Ga0206353_11722219 3300020082 Bacteria 1493
193 Ga0213872_10131367 3300021361 Bacteria 1103
194 Ga0207426_1028223 3300025302 Bacteria 1862
195 Ga0207688_10126331 3300025901 Bacteria 1496
196 Ga0207647_10028923 3300025904 Bacteria 3593
197 Ga0207645_10023563 3300025907 Bacteria 4000
198 Ga0207645_10128193 3300025907 Bacteria 1650
199 Ga0207645_10211809 3300025907 Bacteria 1276
200 Ga0207643_10021842 3300025908 Bacteria 3521
201 Ga0207643_10373072 3300025908 Bacteria 898
202 Ga0207705_10012453 3300025909 Bacteria 6144
203 Ga0207705_10773038 3300025909 Bacteria 746
204 Ga0207654_10023679 3300025911 Bacteria 3292
205 Ga0207654_10190651 3300025911 Bacteria 1343
206 Ga0207654_10397934 3300025911 Bacteria 957
207 Ga0207707_10019045 3300025912 Bacteria 5989
208 Ga0207707_10775688 3300025912 Bacteria 800
209 Ga0207695_10042659 3300025913 Bacteria 4841
210 Ga0207695_10133107 3300025913 Bacteria 2442
211 Ga0207695_11387715 3300025913 Bacteria 583
212 Ga0207671_10051071 3300025914 Bacteria 3063
213 Ga0207671_10286439 3300025914 Bacteria 1300
214 Ga0207660_10001681 3300025917 Bacteria 14824
215 Ga0207660_10420995 3300025917 Bacteria 1077
216 Ga0207660_10448658 3300025917 Bacteria 1043
217 Ga0207657_10080872 3300025919 Bacteria 2730
218 Ga0207649_10286146 3300025920 Bacteria 1200
219 Ga0207652_10007980 3300025921 Bacteria 8496
220 Ga0207652_10288649 3300025921 Bacteria 1480
221 Ga0207659_10070695 3300025926 Bacteria 2546
222 Ga0207659_10439251 3300025926 Bacteria 1097
223 Ga0207659_10716990 3300025926 Bacteria 857
224 Ga0207659_11347691 3300025926 Bacteria 612
225 Ga0207687_10081987 3300025927 Bacteria 2332
226 Ga0207687_10303620 3300025927 Bacteria 1286
227 Ga0207687_10871334 3300025927 Bacteria 770
228 Ga0207700_10053613 3300025928 Bacteria 3023
229 Ga0207700_10324546 3300025928 Bacteria 1335
230 Ga0207644_10094574 3300025931 Bacteria 2233
231 Ga0207644_10100922 3300025931 Bacteria 2168
232 Ga0207644_10954807 3300025931 Bacteria 719
233 Ga0207706_10136725 3300025933 Bacteria 2156
234 Ga0207706_10269480 3300025933 Bacteria 1486
235 Ga0207686_11089526 3300025934 Bacteria 651
236 Ga0207709_10251964 3300025935 Bacteria 1290
237 Ga0207670_10592867 3300025936 Bacteria 909
238 Ga0207669_10395848 3300025937 Bacteria 1081
239 Ga0207665_11431353 3300025939 Bacteria 550
240 Ga0207691_10055065 3300025940 Bacteria 3627
241 Ga0207691_10132930 3300025940 Bacteria 2197
242 Ga0207689_10097705 3300025942 Bacteria 2412
243 Ga0207661_10193671 3300025944 Bacteria 1783
244 Ga0207679_10551170 3300025945 Bacteria 1034
245 Ga0207667_10000890 3300025949 Bacteria 38063
246 Ga0207667_10007671 3300025949 Bacteria 12918
247 Ga0207667_10265398 3300025949 Bacteria 1755
248 Ga0207667_10468336 3300025949 Bacteria 1279
249 Ga0207667_10735610 3300025949 Bacteria 987
250 Ga0207651_10065067 3300025960 Bacteria 2555
251 Ga0207651_10292749 3300025960 Bacteria 1351
252 Ga0207712_10891452 3300025961 Bacteria 786
253 Ga0207658_10592212 3300025986 Bacteria 996
254 Ga0207658_10708450 3300025986 Bacteria 910
255 Ga0207677_10104834 3300026023 Bacteria 2091
256 Ga0207677_10190797 3300026023 Bacteria 1621
257 Ga0207703_10022086 3300026035 Bacteria 4987
258 Ga0207703_10070789 3300026035 Bacteria 2879
259 Ga0207639_10286048 3300026041 Bacteria 1452
260 Ga0207639_10616545 3300026041 Bacteria 1001
261 Ga0207639_11871040 3300026041 Bacteria 561
262 Ga0207678_10421193 3300026067 Bacteria 1158
263 Ga0207702_10119860 3300026078 Bacteria 2353
264 Ga0207702_10198356 3300026078 Bacteria 1859
265 Ga0207702_10199100 3300026078 Bacteria 1855
266 Ga0207648_10092317 3300026089 Bacteria 2647
267 Ga0207648_11022918 3300026089 Bacteria 774
268 Ga0207676_10361099 3300026095 Bacteria 1346
269 Ga0207676_11033257 3300026095 Bacteria 811
270 Ga0207674_10037898 3300026116 Bacteria 5009
271 Ga0207674_10321631 3300026116 Bacteria 1496
272 Ga0207675_100517815 3300026118 Bacteria 1189
273 Ga0207675_100817623 3300026118 Bacteria 946
274 Ga0207675_100967287 3300026118 Bacteria 869
275 Ga0207683_10013856 3300026121 Bacteria 6875
276 Ga0207683_10016020 3300026121 Bacteria 6380
277 Ga0207683_10301978 3300026121 Bacteria 1465
278 Ga0207683_10325725 3300026121 Bacteria 1408
279 Ga0207698_10251719 3300026142 Bacteria 1617
280 Ga0268266_10017428 3300028379 Bacteria 6125
281 Ga0268266_10068242 3300028379 Bacteria 3078
282 Ga0268266_10244848 3300028379 Bacteria 1656
283 Ga0268266_10328642 3300028379 Bacteria 1432
284 Ga0268266_10544865 3300028379 Bacteria 1111
285 Ga0268266_10670841 3300028379 Bacteria 998
286 Ga0268266_10917101 3300028379 Bacteria 847
287 Ga0268265_10385342 3300028380 Bacteria 1291
288 Ga0268264_10279980 3300028381 Bacteria 1562
289 Ga0268264_10922398 3300028381 Bacteria 877
290 Ga0265334_10007601 3300028573 Bacteria 4643
291 Ga0265330_10168689 3300031235 Bacteria 928
292 Ga0265332_10034666 3300031238 Bacteria 2193
293 Ga0265332_10038339 3300031238 Bacteria 2077
294 Ga0265340_10032622 3300031247 Bacteria 2599
295 Ga0307513_10255228 3300031456 Bacteria 1547
296 Ga0307408_100055720 3300031548 Bacteria 2864
297 Ga0307508_10000536 3300031616 Bacteria 45094
298 Ga0307516_10004601 3300031730 Bacteria 16925
299 Ga0307516_10028629 3300031730 Bacteria 5636
300 Ga0373934_0056151 3300035086 Bacteria 1566
301 Ga0373936_0063125 3300035113 Bacteria 1516
302 Ga0373941_0332239 3300035115 Bacteria 614
303 Ga0373960_0026179 3300035121 Bacteria 1592
304 Ga0373943_0071067 3300035170 Bacteria 1763
305 Ga0373943_0448916 3300035170 Bacteria 749
306 Ga0373946_0657914 3300035171 Bacteria 546
307 Ga0373931_0165777 3300035691 Bacteria 1298
308 Ga0373935_0127691 3300035692 Bacteria 1705
309 Ga0373935_0806642 3300035692 Bacteria 693
310 Ga0373935_1321284 3300035692 Bacteria 538
311 Ga0373927_0038214 3300035695 Bacteria 3117
312 Ga0373947_0209156 3300035725 Bacteria 1279
313 Ga0373937_0038886 3300036401 Bacteria 4335
314 Ga0373925_0106757 3300037068 Bacteria 2159
315 Ga0373925_0189500 3300037068 Bacteria 1631
316 Ga0373925_0509643 3300037068 Bacteria 988
317 Ga0395899_0006982 3300037312 Bacteria 8749
318 Ga0395899_0180451 3300037312 Bacteria 1482
319 Ga0395899_0330982 3300037312 Bacteria 1023
320 Ga0395900_0008065 3300037418 Bacteria 10840
321 Ga0395900_0034491 3300037418 Bacteria 5211
322 Ga0395900_0069169 3300037418 Bacteria 3628
323 Ga0395900_0142805 3300037418 Bacteria 2450
324 Ga0395898_0023439 3300037466 Bacteria 6238
325 Ga0395898_0029294 3300037466 Bacteria 5516
326 Ga0395905_0229259 3300037471 Bacteria 1737
327 Ga0395901_0002465 3300038443 Bacteria 18769
328 Ga0395901_0101474 3300038443 Bacteria 3019
329 Ga0395901_0146198 3300038443 Bacteria 2484
330 Ga0395901_0200863 3300038443 Bacteria 2089
331 Ga0436365_0792106 3300039437 Bacteria 910
332 Ga0436360_0669886 3300039438 Bacteria 23196
333 Ga0436361_0036338 3300039447 Bacteria 1840
334 Ga0436363_1010245 3300039450 Bacteria 1022
335 Ga0436362_0516513 3300039453 Bacteria 601
336 Ga0436362_0847056 3300039453 Bacteria 672
337 Ga0439466_0079189 3300041411 Bacteria 1038
338 Ga0451789_1032472 3300041443 Bacteria 893
339 Ga0451791_0490183 3300041451 Bacteria 1169
340 Ga0451791_1903639 3300041451 Bacteria 643
341 Ga0451795_0063147 3300041456 Bacteria 590
342 Ga0451800_0197503 3300041459 Bacteria 834
343 Ga0451802_0435044 3300041460 Bacteria 942
344 Ga0451802_1457977 3300041460 Bacteria 618
345 Ga0451807_0752192 3300041486 Bacteria 1185
346 Ga0451841_0771169 3300041498 Unclassified 544
347 Ga0439441_018618 3300042001 Bacteria 1258
348 Ga0439442_046377 3300042002 Bacteria 916
349 Ga0439448_0023426 3300042005 Bacteria 1926
350 Ga0439458_0010190 3300042157 Bacteria 2093
351 Ga0466963_0520906 3300044694 Bacteria 839
352 Ga0466957_0064705 3300044842 Bacteria 2250
353 Ga0466960_0658212 3300044901 Bacteria 626
354 Ga0495621_0123639 3300046539 Bacteria 1002
355 Ga0495634_0262410 3300046642 Bacteria 1053
356 Ga0495661_0137936 3300046665 Bacteria 1330
357 Ga0495647_0078887 3300046681 Bacteria 1332
358 Ga0495658_1099978 3300046683 Bacteria 507
359 Ga0495624_0425923 3300046690 Bacteria 796
360 Ga0495589_0082870 3300046794 Bacteria 1559
361 Ga0495672_0083083 3300047320 Bacteria 1780
362 Ga0495683_0118392 3300047323 Bacteria 1259
363 Ga0495675_0776102 3300047444 Bacteria 532
364 Ga0495684_0316519 3300047471 Bacteria 1117
365 Ga0495626_0253510 3300048091 Bacteria 705
366 Ga0496112_0662281 3300048915 Bacteria 973
367 Ga0496121_0001676 3300048924 Bacteria 36412
368 Ga0501033_0226408 3300049570 Bacteria 1330
369 Ga0501034_0014582 3300049571 Bacteria 8091
370 Ga0501034_0034986 3300049571 Bacteria 5094
371 Ga0501034_0044589 3300049571 Bacteria 4484
372 Ga0501034_0124864 3300049571 Bacteria 2559
373 Ga0501034_0131833 3300049571 Bacteria 2482
374 Ga0501034_0649829 3300049571 Bacteria 956
375 Ga0501036_0841008 3300049572 Bacteria 755
376 Ga0501037_0073568 3300049573 Bacteria 2485
377 Ga0501046_0027903 3300049580 Bacteria 4602
378 Ga0501048_0556889 3300049582 Bacteria 823
379 Ga0501067_0127919 3300049583 Unclassified 1413
380 Ga0501068_0104058 3300049584 Bacteria 1761
381 Ga0501069_0586497 3300049585 Bacteria 668
382 Ga0501070_0357892 3300049586 Bacteria 1184
383 Ga0501070_0791118 3300049586 Bacteria 745
384 Ga0501073_0378961 3300049589 Bacteria 977
385 Ga0501073_0681027 3300049589 Bacteria 709
386 Ga0501074_0590242 3300049590 Bacteria 786
387 Ga0501210_029356 3300049657 Bacteria 563
388 Ga0501080_0268383 3300049742 Bacteria 1554
389 Ga0501080_0412722 3300049742 Bacteria 1214
390 Ga0501080_0464404 3300049742 Bacteria 1134
391 Ga0501083_0288842 3300049744 Bacteria 1067
392 Ga0501083_0411805 3300049744 Bacteria 880
393 Ga0501035_0606349 3300049822 Bacteria 892
394 Ga0501044_0186735 3300049823 Bacteria 2037
395 Ga0501044_0707437 3300049823 Bacteria 892
396 Ga0501044_1027604 3300049823 Bacteria 695
397 nmdc:mga03683_107074_c1 3300050489 Bacteria 1233
398 nmdc:mga03683_29912_c1 3300050489 Bacteria 2176
399 nmdc:mga03683_401791_c1 3300050489 Bacteria 654
400 nmdc:mga03683_76237_c1 3300050489 Bacteria 1441
401 nmdc:mga03683_77591_c1 3300050489 Bacteria 1429
402 nmdc:mga00v17_735819_c1 3300050491 Bacteria 631
403 nmdc:mga0yw44_79683_c1 3300050492 Bacteria 2050
404 nmdc:mga0k408_18685_c1 3300050493 Bacteria 3872
405 nmdc:mga0k408_28341_c1 3300050493 Bacteria 3183
406 nmdc:mga06z11_174170_c1 3300050494 Bacteria 1237
407 nmdc:mga06z11_222024_c1 3300050494 Bacteria 1105
408 nmdc:mga06z11_439705_c1 3300050494 Bacteria 787
409 nmdc:mga06z11_88161_c1 3300050494 Bacteria 1679
410 nmdc:mga07m45_127053_c1 3300050496 Bacteria 1474
411 nmdc:mga07m45_20276_c1 3300050496 Bacteria 3610
412 nmdc:mga07m45_250764_c1 3300050496 Bacteria 1030
413 nmdc:mga07m45_252095_c1 3300050496 Bacteria 1027
414 nmdc:mga08y16_141238_c1 3300050511 Bacteria 2503
415 nmdc:mga08y16_83239_c1 3300050511 Bacteria 3334
416 nmdc:mga0a205_94361_c1 3300050515 Bacteria 2890
417 nmdc:mga0sz30_69914_c1 3300050516 Bacteria 1510
418 nmdc:mga0sz30_8944_c1 3300050516 Bacteria 3796
419 Ga0495612_0165736 3300053078 Bacteria 966
420 Ga0500644_0174312 3300053088 Bacteria 876
421 Ga0500644_0228849 3300053088 Bacteria 778
422 Ga0500646_0181180 3300053090 Bacteria 714
423 Ga0500647_0014038 3300053091 Bacteria 3634
424 Ga0500566_0147418 3300053094 Bacteria 1242
425 Ga0500566_0447575 3300053094 Bacteria 566
426 Ga0500641_0000821 3300053096 Bacteria 11212
427 Ga0500597_281955 3300053120 Bacteria 669
428 Ga0500642_0200075 3300053130 Bacteria 930
429 Ga0500573_0000050 3300053140 Bacteria 95598
430 Ga0500616_0005690 3300053153 Bacteria 8400
431 Ga0500609_003533 3300053731 Bacteria 2190
432 Ga0500552_000130 3300053733 Bacteria 6380
433 Ga0590077_015107 3300059426 Bacteria 1611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0658212 Ga0466960_0658212_224_589 120
2 3300025913 Ga0207695_11387715 Ga0207695_113877151 121
3 3300046683 Ga0495658_1099978 Ga0495658_1099978_109_483 123
4 3300047444 Ga0495675_0776102 Ga0495675_0776102_117_491 123
5 3300026035 Ga0207703_10022086 Ga0207703_100220865 136
6 3300048924 Ga0496121_0001676 Ga0496121_0001676_2241_2693 136
7 3300014497 Ga0182008_10307924 Ga0182008_103079242 137
8 3300005618 Ga0068864_100469684 Ga0068864_1004696842 138
9 3300026095 Ga0207676_10361099 Ga0207676_103610992 138
10 3300028573 Ga0265334_10007601 Ga0265334_100076012 138
11 3300031247 Ga0265340_10032622 Ga0265340_100326222 138
12 3300039453 Ga0436362_0516513 Ga0436362_0516513_57_554 138
13 3300005539 Ga0068853_101106480 Ga0068853_1011064802 139
14 3300005617 Ga0068859_101172488 Ga0068859_1011724882 139
15 3300005937 Ga0081455_10087762 Ga0081455_100877622 139
16 3300006038 Ga0075365_10410867 Ga0075365_104108672 139
17 3300006048 Ga0075363_100062891 Ga0075363_1000628913 139
18 3300006177 Ga0075362_10022167 Ga0075362_100221674 139
19 3300006177 Ga0075362_10417139 Ga0075362_104171391 139
20 3300006178 Ga0075367_10008132 Ga0075367_100081325 139
21 3300006178 Ga0075367_10263406 Ga0075367_102634062 139
22 3300006186 Ga0075369_10005481 Ga0075369_100054812 139
23 3300006195 Ga0075366_10023591 Ga0075366_100235912 139
24 3300006353 Ga0075370_10037002 Ga0075370_100370024 139
25 3300006353 Ga0075370_10170133 Ga0075370_101701332 139
26 3300006846 Ga0075430_100552333 Ga0075430_1005523332 139
27 3300006914 Ga0075436_100973565 Ga0075436_1009735651 139
28 3300006931 Ga0097620_101172567 Ga0097620_1011725672 139
29 3300009094 Ga0111539_10561052 Ga0111539_105610522 139
30 3300009148 Ga0105243_10232030 Ga0105243_102320303 139
31 3300009553 Ga0105249_10966096 Ga0105249_109660962 139
32 3300050493 nmdc:mga0k408_28341_c1 nmdc:mga0k408_28341_c1_1714_2193 139
33 3300005434 Ga0070709_10066126 Ga0070709_100661263 140
34 3300005435 Ga0070714_101413921 Ga0070714_1014139212 140
35 3300005436 Ga0070713_100054621 Ga0070713_1000546215 140
36 3300005937 Ga0081455_10029189 Ga0081455_100291894 140
37 3300006028 Ga0070717_10166454 Ga0070717_101664542 140
38 3300025901 Ga0207688_10126331 Ga0207688_101263312 140
39 3300025935 Ga0207709_10251964 Ga0207709_102519642 140
40 3300025937 Ga0207669_10395848 Ga0207669_103958482 140
41 3300026118 Ga0207675_100517815 Ga0207675_1005178152 140
42 3300028379 Ga0268266_10544865 Ga0268266_105448651 140
43 3300031548 Ga0307408_100055720 Ga0307408_1000557203 140
44 3300041411 Ga0439466_0079189 Ga0439466_0079189_46_528 140
45 3300042002 Ga0439442_046377 Ga0439442_046377_179_661 140
46 3300049571 Ga0501034_0044589 Ga0501034_0044589_3300_3782 140
47 3300049572 Ga0501036_0841008 Ga0501036_0841008_256_738 140
48 3300050489 nmdc:mga03683_29912_c1 nmdc:mga03683_29912_c1_817_1299 140
49 3300050489 nmdc:mga03683_77591_c1 nmdc:mga03683_77591_c1_214_696 140
50 3300050492 nmdc:mga0yw44_79683_c1 nmdc:mga0yw44_79683_c1_1410_1892 140
51 3300050494 nmdc:mga06z11_174170_c1 nmdc:mga06z11_174170_c1_460_942 140
52 3300050494 nmdc:mga06z11_222024_c1 nmdc:mga06z11_222024_c1_195_677 140
53 3300050496 nmdc:mga07m45_20276_c1 nmdc:mga07m45_20276_c1_625_1107 140
54 3300050496 nmdc:mga07m45_250764_c1 nmdc:mga07m45_250764_c1_335_817 140
55 3300050496 nmdc:mga07m45_252095_c1 nmdc:mga07m45_252095_c1_433_915 140
56 3300050511 nmdc:mga08y16_83239_c1 nmdc:mga08y16_83239_c1_1983_2465 140
57 3300050516 nmdc:mga0sz30_8944_c1 nmdc:mga0sz30_8944_c1_1630_2112 140
58 3300053096 Ga0500641_0000821 Ga0500641_0000821_4873_5355 140
59 3300025928 Ga0207700_10053613 Ga0207700_100536133 141
60 3300035086 Ga0373934_0056151 Ga0373934_0056151_72_569 141
61 3300035692 Ga0373935_0127691 Ga0373935_0127691_1049_1546 141
62 3300035725 Ga0373947_0209156 Ga0373947_0209156_69_566 141
63 3300036401 Ga0373937_0038886 Ga0373937_0038886_3055_3552 141
64 3300037068 Ga0373925_0189500 Ga0373925_0189500_190_687 141
65 3300059426 Ga0590077_015107 Ga0590077_015107_512_940 142
66 3300009098 Ga0105245_10836703 Ga0105245_108367032 143
67 3300009553 Ga0105249_10969098 Ga0105249_109690981 143
68 3300005548 Ga0070665_101098270 Ga0070665_1010982702 144
69 3300021361 Ga0213872_10131367 Ga0213872_101313672 144
70 3300039438 Ga0436360_0669886 Ga0436360_0669886_22103_22600 144
71 3300039447 Ga0436361_0036338 Ga0436361_0036338_1186_1683 144
72 3300042001 Ga0439441_018618 Ga0439441_018618_405_887 144
73 3300005539 Ga0068853_100467795 Ga0068853_1004677951 145
74 3300005617 Ga0068859_100040531 Ga0068859_1000405313 145
75 3300006931 Ga0097620_100040531 Ga0097620_1000405313 145
76 3300025949 Ga0207667_10000890 Ga0207667_100008906 145
77 3300026041 Ga0207639_11871040 Ga0207639_118710401 145
78 3300041443 Ga0451789_1032472 Ga0451789_1032472_310_753 145
79 3300041451 Ga0451791_0490183 Ga0451791_0490183_508_951 145
80 3300041460 Ga0451802_0435044 Ga0451802_0435044_282_725 145
81 3300041486 Ga0451807_0752192 Ga0451807_0752192_577_1020 145
82 3300049583 Ga0501067_0127919 Ga0501067_0127919_538_981 145
83 3300049586 Ga0501070_0357892 Ga0501070_0357892_421_864 145
84 3300049589 Ga0501073_0378961 Ga0501073_0378961_234_677 145
85 3300049742 Ga0501080_0464404 Ga0501080_0464404_337_780 145
86 3300005329 Ga0070683_100630515 Ga0070683_1006305152 146
87 3300005355 Ga0070671_100652686 Ga0070671_1006526862 146
88 3300006237 Ga0097621_100126907 Ga0097621_1001269072 146
89 3300006358 Ga0068871_100341746 Ga0068871_1003417461 146
90 3300006852 Ga0075433_10039312 Ga0075433_100393122 146
91 3300009147 Ga0114129_10010456 Ga0114129_100104567 146
92 3300013307 Ga0157372_10031685 Ga0157372_100316856 146
93 3300014969 Ga0157376_10426126 Ga0157376_104261262 146
94 3300014969 Ga0157376_10546724 Ga0157376_105467242 146
95 3300031456 Ga0307513_10255228 Ga0307513_102552282 146
96 3300031616 Ga0307508_10000536 Ga0307508_100005368 146
97 3300031730 Ga0307516_10004601 Ga0307516_100046016 146
98 3300037068 Ga0373925_0509643 Ga0373925_0509643_84_527 146
99 3300041451 Ga0451791_1903639 Ga0451791_1903639_65_511 146
100 3300041460 Ga0451802_1457977 Ga0451802_1457977_39_488 146
101 3300041498 Ga0451841_0771169 Ga0451841_0771169_51_497 146
102 3300049657 Ga0501210_029356 Ga0501210_029356_34_480 146
103 3300050515 nmdc:mga0a205_94361_c1 nmdc:mga0a205_94361_c1_1186_1629 146
104 3300005983 Ga0081540_1061149 Ga0081540_10611494 147
105 3300006881 Ga0068865_100733631 Ga0068865_1007336312 147
106 3300031235 Ga0265330_10168689 Ga0265330_101686892 148
107 3300035115 Ga0373941_0332239 Ga0373941_0332239_108_554 148
108 3300005328 Ga0070676_10037515 Ga0070676_100375151 149
109 3300005328 Ga0070676_10225598 Ga0070676_102255982 149
110 3300005334 Ga0068869_100049554 Ga0068869_1000495542 149
111 3300005338 Ga0068868_100410224 Ga0068868_1004102242 149
112 3300005340 Ga0070689_100582977 Ga0070689_1005829772 149
113 3300005347 Ga0070668_101117686 Ga0070668_1011176862 149
114 3300005354 Ga0070675_100039780 Ga0070675_1000397802 149
115 3300005355 Ga0070671_101699729 Ga0070671_1016997291 149
116 3300005364 Ga0070673_100101443 Ga0070673_1001014433 149
117 3300005364 Ga0070673_100196652 Ga0070673_1001966522 149
118 3300005436 Ga0070713_100327196 Ga0070713_1003271962 149
119 3300005456 Ga0070678_100082573 Ga0070678_1000825732 149
120 3300005456 Ga0070678_100207838 Ga0070678_1002078381 149
121 3300005539 Ga0068853_100572814 Ga0068853_1005728142 149
122 3300005546 Ga0070696_100363817 Ga0070696_1003638172 149
123 3300005547 Ga0070693_100905641 Ga0070693_1009056412 149
124 3300005548 Ga0070665_100023165 Ga0070665_1000231656 149
125 3300005548 Ga0070665_100794386 Ga0070665_1007943862 149
126 3300005563 Ga0068855_100785719 Ga0068855_1007857192 149
127 3300005577 Ga0068857_100209157 Ga0068857_1002091573 149
128 3300005614 Ga0068856_100253213 Ga0068856_1002532132 149
129 3300005616 Ga0068852_102114260 Ga0068852_1021142602 149
130 3300005618 Ga0068864_100691246 Ga0068864_1006912462 149
131 3300005719 Ga0068861_100233225 Ga0068861_1002332251 149
132 3300005840 Ga0068870_10040147 Ga0068870_100401472 149
133 3300005840 Ga0068870_10412074 Ga0068870_104120742 149
134 3300005843 Ga0068860_100639955 Ga0068860_1006399552 149
135 3300006163 Ga0070715_10421371 Ga0070715_104213712 149
136 3300006237 Ga0097621_100011195 Ga0097621_1000111958 149
137 3300006237 Ga0097621_100134205 Ga0097621_1001342052 149
138 3300006358 Ga0068871_100030597 Ga0068871_1000305972 149
139 3300009098 Ga0105245_10169752 Ga0105245_101697523 149
140 3300009098 Ga0105245_10351052 Ga0105245_103510522 149
141 3300009098 Ga0105245_11024298 Ga0105245_110242982 149
142 3300009148 Ga0105243_10113516 Ga0105243_101135162 149
143 3300009174 Ga0105241_10798949 Ga0105241_107989492 149
144 3300009174 Ga0105241_11908583 Ga0105241_119085832 149
145 3300009177 Ga0105248_10083526 Ga0105248_100835262 149
146 3300009545 Ga0105237_10968536 Ga0105237_109685362 149
147 3300009551 Ga0105238_10253865 Ga0105238_102538653 149
148 3300011119 Ga0105246_10018227 Ga0105246_100182273 149
149 3300011119 Ga0105246_10174778 Ga0105246_101747782 149
150 3300013100 Ga0157373_10276264 Ga0157373_102762642 149
151 3300013297 Ga0157378_10062860 Ga0157378_100628602 149
152 3300013308 Ga0157375_10403366 Ga0157375_104033662 149
153 3300013308 Ga0157375_10542380 Ga0157375_105423802 149
154 3300013308 Ga0157375_12621343 Ga0157375_126213431 149
155 3300014497 Ga0182008_10543252 Ga0182008_105432522 149
156 3300014745 Ga0157377_10645008 Ga0157377_106450082 149
157 3300014968 Ga0157379_10013478 Ga0157379_100134784 149
158 3300014969 Ga0157376_11828484 Ga0157376_118284841 149
159 3300025907 Ga0207645_10023563 Ga0207645_100235635 149
160 3300025907 Ga0207645_10128193 Ga0207645_101281933 149
161 3300025908 Ga0207643_10021842 Ga0207643_100218422 149
162 3300025908 Ga0207643_10373072 Ga0207643_103730722 149
163 3300025911 Ga0207654_10190651 Ga0207654_101906512 149
164 3300025911 Ga0207654_10397934 Ga0207654_103979342 149
165 3300025914 Ga0207671_10051071 Ga0207671_100510712 149
166 3300025926 Ga0207659_10439251 Ga0207659_104392513 149
167 3300025927 Ga0207687_10081987 Ga0207687_100819873 149
168 3300025927 Ga0207687_10303620 Ga0207687_103036202 149
169 3300025927 Ga0207687_10871334 Ga0207687_108713342 149
170 3300025928 Ga0207700_10324546 Ga0207700_103245462 149
171 3300025931 Ga0207644_10094574 Ga0207644_100945742 149
172 3300025931 Ga0207644_10100922 Ga0207644_101009222 149
173 3300025933 Ga0207706_10136725 Ga0207706_101367253 149
174 3300025934 Ga0207686_11089526 Ga0207686_110895262 149
175 3300025939 Ga0207665_11431353 Ga0207665_114313531 149
176 3300025940 Ga0207691_10055065 Ga0207691_100550652 149
177 3300025942 Ga0207689_10097705 Ga0207689_100977053 149
178 3300025960 Ga0207651_10065067 Ga0207651_100650672 149
179 3300025961 Ga0207712_10891452 Ga0207712_108914522 149
180 3300025986 Ga0207658_10592212 Ga0207658_105922122 149
181 3300026078 Ga0207702_10198356 Ga0207702_101983563 149
182 3300026089 Ga0207648_10092317 Ga0207648_100923172 149
183 3300026095 Ga0207676_11033257 Ga0207676_110332572 149
184 3300026118 Ga0207675_100817623 Ga0207675_1008176232 149
185 3300026118 Ga0207675_100967287 Ga0207675_1009672871 149
186 3300026121 Ga0207683_10013856 Ga0207683_100138566 149
187 3300026121 Ga0207683_10301978 Ga0207683_103019782 149
188 3300026142 Ga0207698_10251719 Ga0207698_102517192 149
189 3300028379 Ga0268266_10068242 Ga0268266_100682422 149
190 3300031730 Ga0307516_10028629 Ga0307516_100286292 149
191 3300039437 Ga0436365_0792106 Ga0436365_0792106_329_781 149
192 3300046539 Ga0495621_0123639 Ga0495621_0123639_209_661 149
193 3300046642 Ga0495634_0262410 Ga0495634_0262410_520_972 149
194 3300046665 Ga0495661_0137936 Ga0495661_0137936_615_1067 149
195 3300046690 Ga0495624_0425923 Ga0495624_0425923_163_615 149
196 3300046794 Ga0495589_0082870 Ga0495589_0082870_82_534 149
197 3300047320 Ga0495672_0083083 Ga0495672_0083083_59_517 149
198 3300047323 Ga0495683_0118392 Ga0495683_0118392_544_996 149
199 3300047471 Ga0495684_0316519 Ga0495684_0316519_451_903 149
200 3300048091 Ga0495626_0253510 Ga0495626_0253510_208_660 149
201 3300053094 Ga0500566_0147418 Ga0500566_0147418_268_720 149
202 3300053140 Ga0500573_0000050 Ga0500573_0000050_43023_43475 149
203 3300005536 Ga0070697_100802042 Ga0070697_1008020422 150
204 3300013307 Ga0157372_10145391 Ga0157372_101453912 150
205 3300026089 Ga0207648_11022918 Ga0207648_110229181 150
206 3300028379 Ga0268266_10244848 Ga0268266_102448482 150
207 3300005336 Ga0070680_101232443 Ga0070680_1012324431 151
208 3300005618 Ga0068864_101352722 Ga0068864_1013527222 151
209 3300005843 Ga0068860_100346549 Ga0068860_1003465492 151
210 3300009174 Ga0105241_10003207 Ga0105241_100032078 151
211 3300014968 Ga0157379_10000985 Ga0157379_100009852 151
212 3300025911 Ga0207654_10023679 Ga0207654_100236792 151
213 3300026035 Ga0207703_10070789 Ga0207703_100707893 151
214 3300028381 Ga0268264_10279980 Ga0268264_102799802 151
215 iso_pu_bacteria 2643221734 2644737576 151
216 3300005548 Ga0070665_100028269 Ga0070665_1000282691 153
217 3300014969 Ga0157376_12588103 Ga0157376_125881031 153
218 3300031238 Ga0265332_10038339 Ga0265332_100383392 153
219 3300049571 Ga0501034_0131833 Ga0501034_0131833_1328_1873 153
220 3300049823 Ga0501044_1027604 Ga0501044_1027604_24_569 153
221 3300005543 Ga0070672_101208240 Ga0070672_1012082402 154
222 3300025917 Ga0207660_10448658 Ga0207660_104486581 154
223 3300005985 Ga0081539_10002511 Ga0081539_100025116 158
224 3300025302 Ga0207426_1028223 Ga0207426_10282232 158
225 3300049571 Ga0501034_0014582 Ga0501034_0014582_3199_3675 158
226 3300049584 Ga0501068_0104058 Ga0501068_0104058_1096_1572 158
227 3300049589 Ga0501073_0681027 Ga0501073_0681027_70_546 158
228 3300049744 Ga0501083_0411805 Ga0501083_0411805_393_869 158
229 3300049823 Ga0501044_0707437 Ga0501044_0707437_104_580 158
230 3300005327 Ga0070658_10635491 Ga0070658_106354912 159
231 3300005328 Ga0070676_10248362 Ga0070676_102483622 159
232 3300005329 Ga0070683_100399641 Ga0070683_1003996412 159
233 3300005338 Ga0068868_100200360 Ga0068868_1002003603 159
234 3300005344 Ga0070661_100387712 Ga0070661_1003877122 159
235 3300005355 Ga0070671_100940085 Ga0070671_1009400851 159
236 3300005366 Ga0070659_100420312 Ga0070659_1004203122 159
237 3300005456 Ga0070678_100016748 Ga0070678_1000167485 159
238 3300005457 Ga0070662_100870604 Ga0070662_1008706042 159
239 3300005535 Ga0070684_100402896 Ga0070684_1004028962 159
240 3300005548 Ga0070665_100866976 Ga0070665_1008669762 159
241 3300005563 Ga0068855_100066359 Ga0068855_1000663593 159
242 3300005564 Ga0070664_100462730 Ga0070664_1004627302 159
243 3300005577 Ga0068857_100688441 Ga0068857_1006884411 159
244 3300005614 Ga0068856_100005899 Ga0068856_10000589911 159
245 3300005616 Ga0068852_100633632 Ga0068852_1006336322 159
246 3300005834 Ga0068851_10605926 Ga0068851_106059262 159
247 3300006358 Ga0068871_101278081 Ga0068871_1012780811 159
248 3300009093 Ga0105240_10254259 Ga0105240_102542592 159
249 3300009174 Ga0105241_10382856 Ga0105241_103828561 159
250 3300009545 Ga0105237_10436384 Ga0105237_104363842 159
251 3300009551 Ga0105238_10268811 Ga0105238_102688112 159
252 3300010375 Ga0105239_10118929 Ga0105239_101189293 159
253 3300013100 Ga0157373_10259001 Ga0157373_102590012 159
254 3300013105 Ga0157369_10182054 Ga0157369_101820542 159
255 3300013296 Ga0157374_10553893 Ga0157374_105538932 159
256 3300013297 Ga0157378_11253113 Ga0157378_112531132 159
257 3300014968 Ga0157379_10282632 Ga0157379_102826322 159
258 3300025904 Ga0207647_10028923 Ga0207647_100289232 159
259 3300025907 Ga0207645_10211809 Ga0207645_102118092 159
260 3300025909 Ga0207705_10773038 Ga0207705_107730382 159
261 3300025912 Ga0207707_10775688 Ga0207707_107756882 159
262 3300025913 Ga0207695_10133107 Ga0207695_101331072 159
263 3300025914 Ga0207671_10286439 Ga0207671_102864392 159
264 3300025917 Ga0207660_10420995 Ga0207660_104209952 159
265 3300025919 Ga0207657_10080872 Ga0207657_100808726 159
266 3300025920 Ga0207649_10286146 Ga0207649_102861462 159
267 3300025921 Ga0207652_10288649 Ga0207652_102886492 159
268 3300025931 Ga0207644_10954807 Ga0207644_109548072 159
269 3300025933 Ga0207706_10269480 Ga0207706_102694802 159
270 3300025944 Ga0207661_10193671 Ga0207661_101936712 159
271 3300025945 Ga0207679_10551170 Ga0207679_105511702 159
272 3300025949 Ga0207667_10265398 Ga0207667_102653982 159
273 3300025949 Ga0207667_10468336 Ga0207667_104683362 159
274 3300025986 Ga0207658_10708450 Ga0207658_107084502 159
275 3300026023 Ga0207677_10190797 Ga0207677_101907972 159
276 3300026041 Ga0207639_10286048 Ga0207639_102860482 159
277 3300026078 Ga0207702_10119860 Ga0207702_101198602 159
278 3300026116 Ga0207674_10321631 Ga0207674_103216313 159
279 3300026121 Ga0207683_10016020 Ga0207683_100160205 159
280 3300028379 Ga0268266_10670841 Ga0268266_106708412 159
281 3300028379 Ga0268266_10917101 Ga0268266_109171011 159
282 3300035171 Ga0373946_0657914 Ga0373946_0657914_16_495 159
283 3300035692 Ga0373935_1321284 Ga0373935_1321284_12_491 159
284 3300037312 Ga0395899_0180451 Ga0395899_0180451_210_689 159
285 3300037312 Ga0395899_0330982 Ga0395899_0330982_327_806 159
286 3300037418 Ga0395900_0069169 Ga0395900_0069169_1268_1747 159
287 3300037418 Ga0395900_0142805 Ga0395900_0142805_618_1097 159
288 3300037466 Ga0395898_0029294 Ga0395898_0029294_3691_4170 159
289 3300037471 Ga0395905_0229259 Ga0395905_0229259_966_1445 159
290 3300038443 Ga0395901_0146198 Ga0395901_0146198_1388_1867 159
291 3300038443 Ga0395901_0200863 Ga0395901_0200863_618_1097 159
292 3300042005 Ga0439448_0023426 Ga0439448_0023426_1388_1867 159
293 3300044694 Ga0466963_0520906 Ga0466963_0520906_228_707 159
294 3300044842 Ga0466957_0064705 Ga0466957_0064705_447_926 159
295 3300046681 Ga0495647_0078887 Ga0495647_0078887_762_1241 159
296 3300048915 Ga0496112_0662281 Ga0496112_0662281_132_611 159
297 3300049571 Ga0501034_0034986 Ga0501034_0034986_3143_3622 159
298 3300049571 Ga0501034_0124864 Ga0501034_0124864_1338_1817 159
299 3300049571 Ga0501034_0649829 Ga0501034_0649829_359_838 159
300 3300049585 Ga0501069_0586497 Ga0501069_0586497_144_623 159
301 3300049742 Ga0501080_0412722 Ga0501080_0412722_321_800 159
302 3300049744 Ga0501083_0288842 Ga0501083_0288842_459_938 159
303 3300053078 Ga0495612_0165736 Ga0495612_0165736_178_657 159
304 3300053733 Ga0500552_000130 Ga0500552_000130_1432_1932 159
305 3300005327 Ga0070658_10004117 Ga0070658_100041179 160
306 3300005330 Ga0070690_100897954 Ga0070690_1008979541 160
307 3300005333 Ga0070677_10105477 Ga0070677_101054772 160
308 3300005336 Ga0070680_100002580 Ga0070680_1000025808 160
309 3300005338 Ga0068868_100222700 Ga0068868_1002227002 160
310 3300005340 Ga0070689_100118306 Ga0070689_1001183064 160
311 3300005341 Ga0070691_10002498 Ga0070691_100024987 160
312 3300005354 Ga0070675_100364669 Ga0070675_1003646692 160
313 3300005364 Ga0070673_100555158 Ga0070673_1005551582 160
314 3300005436 Ga0070713_100774613 Ga0070713_1007746132 160
315 3300005445 Ga0070708_100041603 Ga0070708_1000416033 160
316 3300005456 Ga0070678_100253477 Ga0070678_1002534772 160
317 3300005456 Ga0070678_100358901 Ga0070678_1003589012 160
318 3300005458 Ga0070681_10029792 Ga0070681_100297922 160
319 3300005458 Ga0070681_10806054 Ga0070681_108060542 160
320 3300005466 Ga0070685_10568429 Ga0070685_105684292 160
321 3300005467 Ga0070706_100190341 Ga0070706_1001903413 160
322 3300005471 Ga0070698_100002456 Ga0070698_10000245612 160
323 3300005518 Ga0070699_100077722 Ga0070699_1000777223 160
324 3300005530 Ga0070679_100005182 Ga0070679_10000518210 160
325 3300005536 Ga0070697_100032373 Ga0070697_1000323732 160
326 3300005539 Ga0068853_100992578 Ga0068853_1009925782 160
327 3300005546 Ga0070696_100212741 Ga0070696_1002127413 160
328 3300005548 Ga0070665_100132302 Ga0070665_1001323023 160
329 3300005563 Ga0068855_100313733 Ga0068855_1003137332 160
330 3300005577 Ga0068857_100026622 Ga0068857_1000266227 160
331 3300005578 Ga0068854_101124032 Ga0068854_1011240321 160
332 3300005614 Ga0068856_100229932 Ga0068856_1002299322 160
333 3300005719 Ga0068861_100566426 Ga0068861_1005664262 160
334 3300005844 Ga0068862_100406208 Ga0068862_1004062082 160
335 3300005844 Ga0068862_100465741 Ga0068862_1004657412 160
336 3300005937 Ga0081455_10001094 Ga0081455_1000109423 160
337 3300005937 Ga0081455_10004620 Ga0081455_100046205 160
338 3300006048 Ga0075363_100348951 Ga0075363_1003489512 160
339 3300006051 Ga0075364_10197835 Ga0075364_101978352 160
340 3300006177 Ga0075362_10050920 Ga0075362_100509202 160
341 3300006177 Ga0075362_10067027 Ga0075362_100670273 160
342 3300006178 Ga0075367_10045170 Ga0075367_100451705 160
343 3300006178 Ga0075367_10135392 Ga0075367_101353923 160
344 3300006178 Ga0075367_10646566 Ga0075367_106465662 160
345 3300006186 Ga0075369_10006398 Ga0075369_100063984 160
346 3300006195 Ga0075366_10008310 Ga0075366_100083103 160
347 3300006195 Ga0075366_10425813 Ga0075366_104258131 160
348 3300006353 Ga0075370_10233660 Ga0075370_102336602 160
349 3300006881 Ga0068865_100451273 Ga0068865_1004512732 160
350 3300009093 Ga0105240_10015967 Ga0105240_100159677 160
351 3300009177 Ga0105248_12495656 Ga0105248_124956561 160
352 3300009553 Ga0105249_11479386 Ga0105249_114793862 160
353 3300010375 Ga0105239_10918702 Ga0105239_109187022 160
354 3300010375 Ga0105239_12402788 Ga0105239_124027881 160
355 3300013104 Ga0157370_10058428 Ga0157370_100584283 160
356 3300013104 Ga0157370_10562874 Ga0157370_105628742 160
357 3300013105 Ga0157369_10052430 Ga0157369_100524303 160
358 3300013307 Ga0157372_11433084 Ga0157372_114330842 160
359 3300014325 Ga0163163_11031626 Ga0163163_110316262 160
360 3300014325 Ga0163163_11194260 Ga0163163_111942601 160
361 3300014325 Ga0163163_11221167 Ga0163163_112211672 160
362 3300014968 Ga0157379_10733225 Ga0157379_107332252 160
363 3300020082 Ga0206353_11722219 Ga0206353_117222191 160
364 3300025909 Ga0207705_10012453 Ga0207705_100124539 160
365 3300025912 Ga0207707_10019045 Ga0207707_100190456 160
366 3300025913 Ga0207695_10042659 Ga0207695_100426597 160
367 3300025917 Ga0207660_10001681 Ga0207660_100016817 160
368 3300025921 Ga0207652_10007980 Ga0207652_1000798011 160
369 3300025926 Ga0207659_10070695 Ga0207659_100706952 160
370 3300025926 Ga0207659_10716990 Ga0207659_107169901 160
371 3300025926 Ga0207659_11347691 Ga0207659_113476912 160
372 3300025936 Ga0207670_10592867 Ga0207670_105928672 160
373 3300025940 Ga0207691_10132930 Ga0207691_101329302 160
374 3300025949 Ga0207667_10007671 Ga0207667_100076718 160
375 3300025949 Ga0207667_10735610 Ga0207667_107356102 160
376 3300025960 Ga0207651_10292749 Ga0207651_102927492 160
377 3300026023 Ga0207677_10104834 Ga0207677_101048342 160
378 3300026041 Ga0207639_10616545 Ga0207639_106165452 160
379 3300026067 Ga0207678_10421193 Ga0207678_104211932 160
380 3300026078 Ga0207702_10199100 Ga0207702_101991002 160
381 3300026116 Ga0207674_10037898 Ga0207674_100378983 160
382 3300026121 Ga0207683_10325725 Ga0207683_103257252 160
383 3300028379 Ga0268266_10017428 Ga0268266_100174285 160
384 3300028379 Ga0268266_10328642 Ga0268266_103286422 160
385 3300028380 Ga0268265_10385342 Ga0268265_103853422 160
386 3300028381 Ga0268264_10922398 Ga0268264_109223982 160
387 3300031238 Ga0265332_10034666 Ga0265332_100346663 160
388 3300035113 Ga0373936_0063125 Ga0373936_0063125_273_755 160
389 3300035121 Ga0373960_0026179 Ga0373960_0026179_664_1146 160
390 3300035170 Ga0373943_0071067 Ga0373943_0071067_359_841 160
391 3300035170 Ga0373943_0448916 Ga0373943_0448916_36_530 160
392 3300035691 Ga0373931_0165777 Ga0373931_0165777_406_903 160
393 3300035692 Ga0373935_0806642 Ga0373935_0806642_139_621 160
394 3300035695 Ga0373927_0038214 Ga0373927_0038214_1836_2318 160
395 3300037068 Ga0373925_0106757 Ga0373925_0106757_591_1073 160
396 3300037312 Ga0395899_0006982 Ga0395899_0006982_919_1401 160
397 3300037418 Ga0395900_0008065 Ga0395900_0008065_6859_7341 160
398 3300037418 Ga0395900_0034491 Ga0395900_0034491_3016_3498 160
399 3300037466 Ga0395898_0023439 Ga0395898_0023439_1781_2263 160
400 3300038443 Ga0395901_0002465 Ga0395901_0002465_15788_16270 160
401 3300038443 Ga0395901_0101474 Ga0395901_0101474_648_1130 160
402 3300039450 Ga0436363_1010245 Ga0436363_1010245_99_581 160
403 3300039453 Ga0436362_0847056 Ga0436362_0847056_144_629 160
404 3300041456 Ga0451795_0063147 Ga0451795_0063147_86_568 160
405 3300041459 Ga0451800_0197503 Ga0451800_0197503_209_691 160
406 3300042157 Ga0439458_0010190 Ga0439458_0010190_111_593 160
407 3300049570 Ga0501033_0226408 Ga0501033_0226408_239_724 160
408 3300049573 Ga0501037_0073568 Ga0501037_0073568_1797_2282 160
409 3300049580 Ga0501046_0027903 Ga0501046_0027903_1431_1916 160
410 3300049582 Ga0501048_0556889 Ga0501048_0556889_142_627 160
411 3300049586 Ga0501070_0791118 Ga0501070_0791118_39_524 160
412 3300049590 Ga0501074_0590242 Ga0501074_0590242_263_745 160
413 3300049742 Ga0501080_0268383 Ga0501080_0268383_399_881 160
414 3300049822 Ga0501035_0606349 Ga0501035_0606349_139_624 160
415 3300049823 Ga0501044_0186735 Ga0501044_0186735_1009_1494 160
416 3300050489 nmdc:mga03683_107074_c1 nmdc:mga03683_107074_c1_554_1066 160
417 3300050489 nmdc:mga03683_401791_c1 nmdc:mga03683_401791_c1_89_574 160
418 3300050489 nmdc:mga03683_76237_c1 nmdc:mga03683_76237_c1_141_623 160
419 3300050491 nmdc:mga00v17_735819_c1 nmdc:mga00v17_735819_c1_27_509 160
420 3300050493 nmdc:mga0k408_18685_c1 nmdc:mga0k408_18685_c1_2213_2695 160
421 3300050494 nmdc:mga06z11_439705_c1 nmdc:mga06z11_439705_c1_231_713 160
422 3300050494 nmdc:mga06z11_88161_c1 nmdc:mga06z11_88161_c1_1063_1551 160
423 3300050496 nmdc:mga07m45_127053_c1 nmdc:mga07m45_127053_c1_651_1136 160
424 3300050511 nmdc:mga08y16_141238_c1 nmdc:mga08y16_141238_c1_816_1298 160
425 3300050516 nmdc:mga0sz30_69914_c1 nmdc:mga0sz30_69914_c1_577_1062 160
426 3300053088 Ga0500644_0174312 Ga0500644_0174312_36_518 160
427 3300053088 Ga0500644_0228849 Ga0500644_0228849_129_614 160
428 3300053090 Ga0500646_0181180 Ga0500646_0181180_188_670 160
429 3300053091 Ga0500647_0014038 Ga0500647_0014038_1130_1612 160
430 3300053094 Ga0500566_0447575 Ga0500566_0447575_26_514 160
431 3300053120 Ga0500597_281955 Ga0500597_281955_12_500 160
432 3300053130 Ga0500642_0200075 Ga0500642_0200075_393_878 160
433 3300053153 Ga0500616_0005690 Ga0500616_0005690_4372_4857 160
434 3300053731 Ga0500609_003533 Ga0500609_003533_871_1353 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22769

DCD

dCTP deaminase-like

55

154

0.95

PF00692

dUTPase

dUTPase

44

179

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9691 8 134
1rnj-assembly1.cif.gz_A crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp 0.9455 5 137
6hde-assembly1.cif.gz_C structure of escherichia coli dutpase q93h mutant 0.9434 5 138
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9427 6 136
1dup-assembly1.cif.gz_A deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) 0.9426 5 137
ID Description Score Start End Superfamily
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9525 8 138 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9251 6 137 2.70.40.10
3tqzA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9202 6 139 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9186 8 138 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9183 6 137 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A355S0S3-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9918 7 119 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A355S0S3-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9831 7 119 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A1F9ZMA5-F1-model_v4 deleted 0.9815 5 129
AF-X0VWZ5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9805 4 114 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A2S6THV7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9751 4 134 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Feature Viewer

pLDDT pTM Quality
88.82 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map