F443201

General Info

Members Datasets Scaffolds Average Seq Length
434 244 434 100

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_79459_c1|nmdc:mga0k408_79459_c1_59_412
Length 117
Sequence MKRAKRQAGSSGSGSAIGGAMQIAKPEPQAKQLRKKAGSWLKELRARAGLSQIELAAILEFKYYTFISQVENGFGRVPTESMEAWAKALGVNPSEFARELLSYYEPELYRLLFEVKK

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 11.06
Rhizosphere 80.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10085821 3300005328 Bacteria 1919
2 Ga0070683_100100630 3300005329 Bacteria 2721
3 Ga0070683_101431887 3300005329 Bacteria 664
4 Ga0070690_100003935 3300005330 Bacteria 8199
5 Ga0070690_101644547 3300005330 Bacteria 521
6 Ga0070670_100003295 3300005331 Bacteria 13360
7 Ga0070677_10155434 3300005333 Bacteria 1068
8 Ga0070682_100269143 3300005337 Bacteria 1237
9 Ga0070682_100586728 3300005337 Bacteria 878
10 Ga0068868_100319293 3300005338 Bacteria 1323
11 Ga0068868_101635846 3300005338 Bacteria 606
12 Ga0070691_10082708 3300005341 Bacteria 1574
13 Ga0070668_100609731 3300005347 Bacteria 956
14 Ga0070668_102093562 3300005347 Bacteria 522
15 Ga0070669_100049936 3300005353 Bacteria 3055
16 Ga0070675_101581860 3300005354 Bacteria 605
17 Ga0070671_100116770 3300005355 Bacteria 2244
18 Ga0070671_100558137 3300005355 Unclassified 988
19 Ga0070674_100851185 3300005356 Bacteria 791
20 Ga0070674_101125808 3300005356 Unclassified 694
21 Ga0070674_101145005 3300005356 Bacteria 689
22 Ga0070688_100006635 3300005365 Bacteria 6199
23 Ga0070659_100088000 3300005366 Bacteria 2487
24 Ga0070659_100957305 3300005366 Bacteria 750
25 Ga0070667_100464223 3300005367 Bacteria 1158
26 Ga0070714_100988387 3300005435 Bacteria 819
27 Ga0070713_101501061 3300005436 Unclassified 654
28 Ga0070713_101532963 3300005436 Bacteria 647
29 Ga0070701_10483269 3300005438 Bacteria 801
30 Ga0070701_10704806 3300005438 Bacteria 679
31 Ga0070711_100219863 3300005439 Bacteria 1476
32 Ga0070711_100301753 3300005439 Unclassified 1274
33 Ga0070663_100288623 3300005455 Bacteria 1310
34 Ga0070678_100207795 3300005456 Bacteria 1620
35 Ga0070662_100017831 3300005457 Bacteria 4790
36 Ga0070681_10169665 3300005458 Bacteria 2104
37 Ga0068867_101685772 3300005459 Unclassified 594
38 Ga0070685_10535443 3300005466 Bacteria 834
39 Ga0070679_100664631 3300005530 Bacteria 985
40 Ga0070679_101828358 3300005530 Bacteria 556
41 Ga0070684_100397034 3300005535 Bacteria 1271
42 Ga0070684_102072595 3300005535 Bacteria 537
43 Ga0068853_100184894 3300005539 Bacteria 1891
44 Ga0070672_100551090 3300005543 Bacteria 1001
45 Ga0070686_100388216 3300005544 Bacteria 1058
46 Ga0070686_101446972 3300005544 Bacteria 578
47 Ga0070686_101484724 3300005544 Unclassified 571
48 Ga0070693_100018816 3300005547 Bacteria 3613
49 Ga0070665_100145562 3300005548 Bacteria 2372
50 Ga0070665_100847863 3300005548 Bacteria 927
51 Ga0070665_101983930 3300005548 Unclassified 587
52 Ga0070664_100128382 3300005564 Bacteria 2225
53 Ga0070664_100261554 3300005564 Bacteria 1557
54 Ga0068856_101277859 3300005614 Unclassified 749
55 Ga0068852_100432321 3300005616 Bacteria 1300
56 Ga0068859_100080459 3300005617 Bacteria 3299
57 Ga0068859_101007473 3300005617 Bacteria 915
58 Ga0068864_100033415 3300005618 Bacteria 4373
59 Ga0068864_100586311 3300005618 Bacteria 1081
60 Ga0068861_100146808 3300005719 Unclassified 1931
61 Ga0068861_100833803 3300005719 Bacteria 868
62 Ga0068861_101829311 3300005719 Bacteria 603
63 Ga0068870_11111412 3300005840 Bacteria 569
64 Ga0068863_100698932 3300005841 Bacteria 1008
65 Ga0068858_100718291 3300005842 Bacteria 973
66 Ga0068860_102449985 3300005843 Unclassified 542
67 Ga0068862_100183626 3300005844 Bacteria 1878
68 Ga0068862_101704093 3300005844 Bacteria 638
69 Ga0081455_10017091 3300005937 Bacteria 6971
70 Ga0081455_10193131 3300005937 Bacteria 1531
71 Ga0081539_10305458 3300005985 Bacteria 682
72 Ga0070717_10686781 3300006028 Bacteria 930
73 Ga0075365_10024069 3300006038 Bacteria 3836
74 Ga0075365_10704423 3300006038 Bacteria 713
75 Ga0070712_100543692 3300006175 Unclassified 978
76 Ga0075362_10074238 3300006177 Bacteria 1558
77 Ga0075362_10104793 3300006177 Bacteria 1326
78 Ga0075362_10435233 3300006177 Bacteria 665
79 Ga0075362_10613431 3300006177 Bacteria 563
80 Ga0075367_10222421 3300006178 Bacteria 1181
81 Ga0075369_10167526 3300006186 Bacteria 1008
82 Ga0075366_10004388 3300006195 Bacteria 7570
83 Ga0075366_10042442 3300006195 Bacteria 2693
84 Ga0075428_100046994 3300006844 Bacteria 4742
85 Ga0075428_100392542 3300006844 Bacteria 1487
86 Ga0075428_101031170 3300006844 Unclassified 870
87 Ga0075428_101367989 3300006844 Bacteria 743
88 Ga0075428_102641314 3300006844 Unclassified 512
89 Ga0075430_100169947 3300006846 Bacteria 1814
90 Ga0075431_100019442 3300006847 Bacteria 6925
91 Ga0075431_101554903 3300006847 Bacteria 619
92 Ga0075434_100018214 3300006871 Bacteria 6781
93 Ga0068865_100134073 3300006881 Bacteria 1858
94 Ga0097620_100080459 3300006931 Bacteria 3299
95 Ga0097620_101007459 3300006931 Bacteria 915
96 Ga0075435_100295458 3300007076 Bacteria 1385
97 Ga0099795_10367487 3300007788 Bacteria 647
98 Ga0105240_11045701 3300009093 Bacteria 871
99 Ga0111539_10102048 3300009094 Bacteria 3367
100 Ga0111539_10417054 3300009094 Bacteria 1564
101 Ga0111539_10670681 3300009094 Bacteria 1207
102 Ga0111539_10774014 3300009094 Bacteria 1117
103 Ga0111539_11253236 3300009094 Bacteria 861
104 Ga0111539_13496701 3300009094 Unclassified 504
105 Ga0105245_10039626 3300009098 Bacteria 4194
106 Ga0105245_11127440 3300009098 Bacteria 831
107 Ga0105247_10106416 3300009101 Bacteria 1799
108 Ga0105247_10138537 3300009101 Bacteria 1592
109 Ga0114129_10005101 3300009147 Bacteria 18497
110 Ga0114129_10864743 3300009147 Bacteria 1148
111 Ga0114129_12905855 3300009147 Unclassified 566
112 Ga0114129_13318815 3300009147 Unclassified 520
113 Ga0105243_10652526 3300009148 Bacteria 1020
114 Ga0105243_11438064 3300009148 Unclassified 711
115 Ga0105242_10804669 3300009176 Unclassified 931
116 Ga0105242_10826239 3300009176 Bacteria 920
117 Ga0105242_11622380 3300009176 Unclassified 681
118 Ga0105242_12215770 3300009176 Bacteria 595
119 Ga0105248_10015876 3300009177 Bacteria 8297
120 Ga0105248_10817424 3300009177 Unclassified 1052
121 Ga0105248_10946085 3300009177 Bacteria 973
122 Ga0105238_10664902 3300009551 Bacteria 1052
123 Ga0105238_11282561 3300009551 Unclassified 758
124 Ga0105249_10108236 3300009553 Bacteria 2624
125 Ga0105249_10667680 3300009553 Bacteria 1098
126 Ga0105249_11492037 3300009553 Bacteria 748
127 Ga0105249_12239715 3300009553 Bacteria 619
128 Ga0105239_10237933 3300010375 Bacteria 2044
129 Ga0105239_12411293 3300010375 Bacteria 613
130 Ga0105239_13119832 3300010375 Unclassified 540
131 Ga0105246_10058522 3300011119 Bacteria 2670
132 Ga0105246_10288340 3300011119 Bacteria 1320
133 Ga0157378_10476722 3300013297 Bacteria 1243
134 Ga0157378_10725003 3300013297 Unclassified 1015
135 Ga0157378_11226122 3300013297 Bacteria 790
136 Ga0163162_10031609 3300013306 Bacteria 5251
137 Ga0163162_10214916 3300013306 Bacteria 2053
138 Ga0163162_10336297 3300013306 Bacteria 1642
139 Ga0163162_13488752 3300013306 Unclassified 500
140 Ga0157375_10035185 3300013308 Bacteria 4779
141 Ga0157375_11904439 3300013308 Unclassified 706
142 Ga0157375_12462013 3300013308 Bacteria 621
143 Ga0163163_10002186 3300014325 Bacteria 16467
144 Ga0163163_10068555 3300014325 Bacteria 3529
145 Ga0163163_10077199 3300014325 Bacteria 3326
146 Ga0157380_10370769 3300014326 Bacteria 1347
147 Ga0157380_11546579 3300014326 Unclassified 718
148 Ga0157380_12573056 3300014326 Bacteria 575
149 Ga0157377_10137392 3300014745 Bacteria 1499
150 Ga0157379_10017694 3300014968 Bacteria 6278
151 Ga0157379_10108231 3300014968 Bacteria 2495
152 Ga0157379_10503509 3300014968 Bacteria 1123
153 Ga0157379_10540219 3300014968 Bacteria 1084
154 Ga0157376_10162692 3300014969 Bacteria 2025
155 Ga0209758_1000382 3300025297 Bacteria 76653
156 Ga0209758_1085542 3300025297 Bacteria 939
157 Ga0207697_10016668 3300025315 Bacteria 3027
158 Ga0207710_10203262 3300025900 Unclassified 979
159 Ga0207688_10435040 3300025901 Bacteria 816
160 Ga0207685_10156257 3300025905 Bacteria 1037
161 Ga0207699_10198601 3300025906 Bacteria 1358
162 Ga0207699_10585261 3300025906 Unclassified 812
163 Ga0207645_10038182 3300025907 Bacteria 3080
164 Ga0207707_11245078 3300025912 Bacteria 600
165 Ga0207695_10770129 3300025913 Bacteria 843
166 Ga0207693_10096155 3300025915 Bacteria 2322
167 Ga0207693_10493117 3300025915 Unclassified 956
168 Ga0207663_10141889 3300025916 Bacteria 1674
169 Ga0207660_10894409 3300025917 Unclassified 725
170 Ga0207652_11165449 3300025921 Bacteria 672
171 Ga0207681_10100813 3300025923 Bacteria 2082
172 Ga0207694_10324354 3300025924 Bacteria 1271
173 Ga0207650_10043607 3300025925 Bacteria 3293
174 Ga0207659_10321386 3300025926 Unclassified 1277
175 Ga0207700_10415987 3300025928 Bacteria 1180
176 Ga0207664_10276028 3300025929 Bacteria 1474
177 Ga0207690_10149735 3300025932 Bacteria 1729
178 Ga0207706_10045969 3300025933 Bacteria 3866
179 Ga0207686_10188493 3300025934 Bacteria 1468
180 Ga0207686_10672519 3300025934 Bacteria 821
181 Ga0207670_10002860 3300025936 Bacteria 9110
182 Ga0207669_10634953 3300025937 Bacteria 872
183 Ga0207704_10088038 3300025938 Bacteria 2030
184 Ga0207665_10129934 3300025939 Bacteria 1787
185 Ga0207665_10893079 3300025939 Unclassified 705
186 Ga0207711_10009020 3300025941 Bacteria 8337
187 Ga0207711_10686113 3300025941 Bacteria 955
188 Ga0207661_10173788 3300025944 Bacteria 1877
189 Ga0207679_10022390 3300025945 Bacteria 4302
190 Ga0207679_10203844 3300025945 Bacteria 1654
191 Ga0207679_10218119 3300025945 Bacteria 1604
192 Ga0207712_10414302 3300025961 Bacteria 1135
193 Ga0207712_10761707 3300025961 Bacteria 849
194 Ga0207658_10651126 3300025986 Bacteria 950
195 Ga0207677_11076753 3300026023 Bacteria 732
196 Ga0207703_10362637 3300026035 Bacteria 1337
197 Ga0207639_10402883 3300026041 Bacteria 1233
198 Ga0207678_10230815 3300026067 Bacteria 1585
199 Ga0207708_11275934 3300026075 Bacteria 643
200 Ga0207641_10413121 3300026088 Bacteria 1298
201 Ga0207648_10273227 3300026089 Bacteria 1510
202 Ga0207676_10016782 3300026095 Bacteria 5301
203 Ga0207676_10702018 3300026095 Bacteria 980
204 Ga0207675_100335249 3300026118 Bacteria 1479
205 Ga0207698_10529503 3300026142 Bacteria 1151
206 Ga0207698_10658454 3300026142 Bacteria 1038
207 Ga0207428_10500372 3300027907 Bacteria 883
208 Ga0268266_10235478 3300028379 Bacteria 1688
209 Ga0268266_10604851 3300028379 Bacteria 1053
210 Ga0268266_10753863 3300028379 Bacteria 940
211 Ga0268266_11457978 3300028379 Unclassified 660
212 Ga0268265_10395839 3300028380 Bacteria 1275
213 Ga0268264_10055088 3300028381 Bacteria 3323
214 Ga0268264_12291804 3300028381 Bacteria 547
215 Ga0307408_100162703 3300031548 Bacteria 1774
216 Ga0307413_10206401 3300031824 Bacteria 1423
217 Ga0307410_11385922 3300031852 Bacteria 617
218 Ga0307410_11711769 3300031852 Unclassified 557
219 Ga0307406_11464420 3300031901 Unclassified 600
220 Ga0307407_10201929 3300031903 Bacteria 1333
221 Ga0307412_10144284 3300031911 Bacteria 1748
222 Ga0307409_100171723 3300031995 Bacteria 1909
223 Ga0307416_102906001 3300032002 Unclassified 573
224 Ga0307416_103398235 3300032002 Unclassified 533
225 Ga0307416_103692198 3300032002 Unclassified 512
226 Ga0307411_10174206 3300032005 Bacteria 1626
227 Ga0307411_10393369 3300032005 Bacteria 1144
228 Ga0307415_101681261 3300032126 Unclassified 612
229 Ga0373930_0001772 3300034816 Bacteria 3278
230 Ga0373930_0060129 3300034816 Bacteria 846
231 Ga0373938_0068493 3300034957 Unclassified 844
232 Ga0373938_0082649 3300034957 Unclassified 784
233 Ga0373928_0009951 3300035084 Bacteria 1863
234 Ga0373940_0078785 3300035088 Unclassified 971
235 Ga0373940_0364701 3300035088 Unclassified 509
236 Ga0373951_0074261 3300035091 Unclassified 871
237 Ga0373952_0004860 3300035092 Bacteria 2444
238 Ga0373932_0058705 3300035112 Unclassified 1163
239 Ga0373932_0336758 3300035112 Unclassified 571
240 Ga0373932_0395447 3300035112 Unclassified 534
241 Ga0373939_0004798 3300035114 Bacteria 3205
242 Ga0373939_0039468 3300035114 Unclassified 1413
243 Ga0373941_0094543 3300035115 Unclassified 1031
244 Ga0373941_0425242 3300035115 Bacteria 553
245 Ga0373960_0003526 3300035121 Bacteria 3546
246 Ga0373942_0003945 3300035207 Bacteria 3464
247 Ga0373961_0007220 3300035241 Bacteria 2685
248 Ga0373961_0014770 3300035241 Bacteria 1987
249 Ga0373931_0000416 3300035691 Bacteria 17409
250 Ga0373931_0001658 3300035691 Bacteria 9635
251 Ga0373931_0434591 3300035691 Bacteria 837
252 Ga0373937_1323306 3300036401 Bacteria 668
253 Ga0373925_0624939 3300037068 Bacteria 887
254 Ga0439453_0049969 3300041408 Bacteria 843
255 Ga0451798_0387576 3300041458 Unclassified 699
256 Ga0450908_035710 3300042184 Bacteria 862
257 Ga0439435_0026640 3300042436 Bacteria 1541
258 Ga0466963_0186969 3300044694 Unclassified 1447
259 Ga0495629_0020340 3300046459 Bacteria 4741
260 Ga0495638_0047138 3300046460 Bacteria 2703
261 Ga0495582_0245616 3300046473 Bacteria 1026
262 Ga0495594_0140888 3300046499 Bacteria 1368
263 Ga0495665_0544835 3300046531 Bacteria 583
264 Ga0495598_0104095 3300046537 Unclassified 943
265 Ga0495674_0272691 3300047319 Bacteria 1388
266 Ga0495672_0450892 3300047320 Unclassified 580
267 Ga0495685_008495 3300047447 Bacteria 3412
268 Ga0495593_0174860 3300047673 Bacteria 1082
269 Ga0495615_0042932 3300048090 Bacteria 1136
270 Ga0496100_0000936 3300048903 Bacteria 13936
271 Ga0496100_0528127 3300048903 Bacteria 911
272 Ga0496101_0001406 3300048904 Bacteria 14407
273 Ga0496101_0050852 3300048904 Bacteria 2985
274 Ga0496101_0063969 3300048904 Bacteria 2679
275 Ga0496101_1161860 3300048904 Bacteria 605
276 Ga0496102_0024611 3300048905 Bacteria 5353
277 Ga0496102_0459249 3300048905 Bacteria 1194
278 Ga0496102_1795191 3300048905 Bacteria 530
279 Ga0496103_0053335 3300048906 Bacteria 2506
280 Ga0496103_0166366 3300048906 Bacteria 1415
281 Ga0496103_0388732 3300048906 Bacteria 896
282 Ga0496104_0004098 3300048907 Bacteria 12645
283 Ga0496104_0022209 3300048907 Bacteria 5827
284 Ga0496104_0025211 3300048907 Bacteria 5480
285 Ga0496105_0002256 3300048908 Bacteria 13967
286 Ga0496105_0022327 3300048908 Bacteria 5125
287 Ga0496105_0022512 3300048908 Bacteria 5104
288 Ga0496106_0006550 3300048909 Bacteria 8624
289 Ga0496106_0024691 3300048909 Bacteria 4470
290 Ga0496106_0129950 3300048909 Bacteria 1975
291 Ga0496107_0010746 3300048910 Bacteria 6367
292 Ga0496107_0568825 3300048910 Bacteria 839
293 Ga0496107_1037499 3300048910 Unclassified 594
294 Ga0496108_0000400 3300048911 Bacteria 35840
295 Ga0496108_0096169 3300048911 Bacteria 2522
296 Ga0496109_0011907 3300048912 Bacteria 7488
297 Ga0496109_0044007 3300048912 Bacteria 4049
298 Ga0496109_0112696 3300048912 Bacteria 2529
299 Ga0496109_0150811 3300048912 Bacteria 2176
300 Ga0496110_0025649 3300048913 Bacteria 5040
301 Ga0496110_0121068 3300048913 Bacteria 2357
302 Ga0496110_0368659 3300048913 Bacteria 1308
303 Ga0496110_0968206 3300048913 Bacteria 758
304 Ga0496111_0009679 3300048914 Bacteria 6442
305 Ga0496111_0460275 3300048914 Bacteria 938
306 Ga0496112_0019174 3300048915 Bacteria 6450
307 Ga0496112_0038742 3300048915 Bacteria 4656
308 Ga0496112_0232200 3300048915 Bacteria 1799
309 Ga0496113_0008141 3300048916 Bacteria 6806
310 Ga0496113_0047155 3300048916 Bacteria 3202
311 Ga0496113_0072319 3300048916 Bacteria 2624
312 Ga0496113_0119420 3300048916 Bacteria 2060
313 Ga0496114_0194429 3300048917 Bacteria 1775
314 Ga0496115_0003984 3300048918 Bacteria 10651
315 Ga0496115_0276554 3300048918 Bacteria 1379
316 Ga0496115_0337768 3300048918 Bacteria 1230
317 Ga0501031_0034456 3300049568 Bacteria 3304
318 Ga0501032_0019142 3300049569 Bacteria 4790
319 Ga0501032_0541316 3300049569 Bacteria 743
320 Ga0501032_0653528 3300049569 Unclassified 668
321 Ga0501033_0062034 3300049570 Bacteria 2753
322 Ga0501034_0000438 3300049571 Bacteria 68973
323 Ga0501034_0012727 3300049571 Bacteria 8677
324 Ga0501034_0139101 3300049571 Bacteria 2408
325 Ga0501034_0551739 3300049571 Bacteria 1062
326 Ga0501036_0059398 3300049572 Bacteria 3240
327 Ga0501036_0093151 3300049572 Bacteria 2545
328 Ga0501036_0259865 3300049572 Bacteria 1455
329 Ga0501036_0298105 3300049572 Bacteria 1349
330 Ga0501037_0332507 3300049573 Bacteria 1050
331 Ga0501038_0019505 3300049574 Bacteria 6111
332 Ga0501038_0060337 3300049574 Bacteria 3246
333 Ga0501039_0073166 3300049575 Bacteria 2663
334 Ga0501039_0128901 3300049575 Bacteria 1985
335 Ga0501040_0163574 3300049576 Bacteria 1574
336 Ga0501040_0771937 3300049576 Unclassified 695
337 Ga0501041_0733254 3300049577 Unclassified 633
338 Ga0501042_0427343 3300049578 Bacteria 960
339 Ga0501043_0060077 3300049579 Bacteria 2983
340 Ga0501043_0712314 3300049579 Bacteria 732
341 Ga0501046_0064018 3300049580 Bacteria 2871
342 Ga0501046_0649410 3300049580 Bacteria 746
343 Ga0501046_1030074 3300049580 Unclassified 571
344 Ga0501047_0061534 3300049581 Bacteria 3622
345 Ga0501047_0126186 3300049581 Bacteria 2439
346 Ga0501047_0477354 3300049581 Unclassified 1075
347 Ga0501048_0128859 3300049582 Bacteria 1789
348 Ga0501068_0106149 3300049584 Unclassified 1744
349 Ga0501068_0481632 3300049584 Unclassified 804
350 Ga0501070_0034993 3300049586 Bacteria 4198
351 Ga0501070_0190786 3300049586 Bacteria 1684
352 Ga0501070_0208451 3300049586 Bacteria 1605
353 Ga0501071_0094631 3300049587 Bacteria 2198
354 Ga0501071_0446367 3300049587 Unclassified 990
355 Ga0501071_0833882 3300049587 Bacteria 711
356 Ga0501072_1042102 3300049588 Unclassified 637
357 Ga0501073_0574595 3300049589 Unclassified 779
358 Ga0501073_0734990 3300049589 Bacteria 681
359 Ga0501073_0923900 3300049589 Bacteria 601
360 Ga0501074_0675638 3300049590 Unclassified 729
361 Ga0501074_1198278 3300049590 Unclassified 533
362 Ga0501075_0245664 3300049591 Bacteria 1364
363 Ga0501076_0144193 3300049592 Bacteria 1936
364 Ga0501076_0194643 3300049592 Bacteria 1655
365 Ga0501076_0827240 3300049592 Unclassified 764
366 Ga0501077_0326473 3300049593 Bacteria 978
367 Ga0501077_0367783 3300049593 Unclassified 918
368 Ga0501077_0814164 3300049593 Unclassified 601
369 Ga0501077_0937628 3300049593 Bacteria 557
370 Ga0501079_1079954 3300049741 Unclassified 632
371 Ga0501079_1113660 3300049741 Bacteria 622
372 Ga0501080_0579954 3300049742 Bacteria 997
373 Ga0501081_0407604 3300049743 Bacteria 1007
374 Ga0501081_0729937 3300049743 Bacteria 744
375 Ga0501083_0852746 3300049744 Bacteria 593
376 Ga0501083_1101642 3300049744 Bacteria 517
377 Ga0501035_0272415 3300049822 Bacteria 1432
378 Ga0501035_0842909 3300049822 Bacteria 730
379 Ga0501044_0001788 3300049823 Bacteria 25106
380 Ga0501044_0072138 3300049823 Bacteria 3511
381 Ga0501044_0264173 3300049823 Bacteria 1659
382 Ga0501044_0589512 3300049823 Bacteria 1005
383 Ga0501044_1011973 3300049823 Bacteria 702
384 Ga0501045_0176950 3300049824 Bacteria 1589
385 nmdc:mga03683_189045_c1 3300050489 Bacteria 942
386 nmdc:mga03683_573327_c1 3300050489 Unclassified 551
387 nmdc:mga00v17_159912_c1 3300050491 Bacteria 984
388 nmdc:mga0yw44_1464_c1 3300050492 Bacteria 9398
389 nmdc:mga0k408_17338_c1 3300050493 Bacteria 4012
390 nmdc:mga0k408_402919_c1 3300050493 Unclassified 814
391 nmdc:mga0k408_79459_c1 3300050493 Bacteria 1919
392 nmdc:mga06z11_132390_c1 3300050494 Bacteria 1401
393 nmdc:mga06z11_167067_c1 3300050494 Bacteria 1261
394 nmdc:mga06z11_44196_c1 3300050494 Bacteria 2245
395 nmdc:mga07m45_41227_c1 3300050496 Bacteria 2584
396 nmdc:mga05p37_1314121_c1 3300050507 Unclassified 736
397 nmdc:mga05p37_56610_c1 3300050507 Bacteria 4828
398 nmdc:mga05p37_766057_c1 3300050507 Bacteria 1061
399 nmdc:mga09592_113584_c1 3300050508 Bacteria 2324
400 nmdc:mga09592_290244_c1 3300050508 Bacteria 1418
401 nmdc:mga0qj67_315378_c1 3300050509 Bacteria 1266
402 nmdc:mga0qj67_910884_c1 3300050509 Bacteria 692
403 nmdc:mga06r32_1502710_c1 3300050510 Unclassified 614
404 nmdc:mga08y16_111918_c1 3300050511 Bacteria 2842
405 nmdc:mga08y16_456580_c1 3300050511 Bacteria 1302
406 nmdc:mga08y16_832825_c1 3300050511 Bacteria 913
407 nmdc:mga0sz30_209632_c1 3300050516 Bacteria 866
408 nmdc:mga0sz30_275031_c1 3300050516 Bacteria 750
409 Ga0495619_0092429 3300053085 Bacteria 2049
410 Ga0500646_0296409 3300053090 Bacteria 579
411 Ga0500583_0218254 3300053092 Bacteria 946
412 Ga0500651_0200485 3300053093 Bacteria 1178
413 Ga0500593_016715 3300053117 Bacteria 3181
414 Ga0500595_137993 3300053119 Unclassified 684
415 Ga0500628_091315 3300053129 Bacteria 794
416 Ga0500642_0143398 3300053130 Bacteria 1121
417 Ga0500604_0012339 3300053151 Bacteria 2307
418 Ga0500616_0302576 3300053153 Unclassified 664
419 Ga0500627_0072895 3300053158 Bacteria 1523
420 Ga0500636_0263157 3300053177 Bacteria 872
421 Ga0500611_015228 3300053727 Bacteria 1359
422 Ga0501084_0115123 3300054114 Bacteria 2260
423 Ga0501084_0266029 3300054114 Bacteria 1448
424 Ga0501084_0468506 3300054114 Bacteria 1065
425 Ga0587115_053055 3300059626 Unclassified 663
426 Ga0587079_002805 3300059647 Bacteria 2192
427 Ga0501082_0002950 3300060353 Bacteria 14841
428 Ga0501082_0176758 3300060353 Bacteria 1856
429 Ga0501082_0346979 3300060353 Bacteria 1294
430 Ga0501082_0377295 3300060353 Bacteria 1237
431 Ga0501082_1333953 3300060353 Unclassified 627
432 Ga0501082_1514314 3300060353 Unclassified 586
433 Ga0530510_0031201 3300061734 Bacteria 3832
434 Ga0530510_0042817 3300061734 Bacteria 3271

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100558137 Ga0070671_1005581372 74
2 3300009101 Ga0105247_10138537 Ga0105247_101385373 74
3 3300009176 Ga0105242_11622380 Ga0105242_116223802 74
4 3300009177 Ga0105248_10817424 Ga0105248_108174241 74
5 3300009553 Ga0105249_10108236 Ga0105249_101082362 74
6 3300011119 Ga0105246_10288340 Ga0105246_102883402 74
7 3300013297 Ga0157378_11226122 Ga0157378_112261222 74
8 3300013306 Ga0163162_10336297 Ga0163162_103362973 74
9 3300013308 Ga0157375_10035185 Ga0157375_100351853 74
10 3300014968 Ga0157379_10017694 Ga0157379_100176943 74
11 3300005439 Ga0070711_100301753 Ga0070711_1003017532 75
12 3300006175 Ga0070712_100543692 Ga0070712_1005436922 75
13 3300007076 Ga0075435_100295458 Ga0075435_1002954582 75
14 3300009094 Ga0111539_10417054 Ga0111539_104170542 75
15 3300009098 Ga0105245_10039626 Ga0105245_100396262 75
16 3300010375 Ga0105239_13119832 Ga0105239_131198321 75
17 3300013306 Ga0163162_13488752 Ga0163162_134887522 75
18 3300014325 Ga0163163_10077199 Ga0163163_100771993 75
19 3300014968 Ga0157379_10503509 Ga0157379_105035093 75
20 3300014969 Ga0157376_10162692 Ga0157376_101626923 75
21 3300025906 Ga0207699_10585261 Ga0207699_105852611 75
22 3300025915 Ga0207693_10493117 Ga0207693_104931172 75
23 3300025945 Ga0207679_10203844 Ga0207679_102038442 75
24 3300048903 Ga0496100_0528127 Ga0496100_0528127_524_865 75
25 3300048904 Ga0496101_0050852 Ga0496101_0050852_1315_1656 75
26 3300048906 Ga0496103_0166366 Ga0496103_0166366_92_433 75
27 3300048907 Ga0496104_0004098 Ga0496104_0004098_10429_10770 75
28 3300048908 Ga0496105_0022327 Ga0496105_0022327_3664_4005 75
29 3300048909 Ga0496106_0129950 Ga0496106_0129950_1457_1798 75
30 3300048910 Ga0496107_1037499 Ga0496107_1037499_239_580 75
31 3300048912 Ga0496109_0112696 Ga0496109_0112696_513_854 75
32 3300048913 Ga0496110_0968206 Ga0496110_0968206_11_352 75
33 3300048915 Ga0496112_0232200 Ga0496112_0232200_1392_1733 75
34 3300048916 Ga0496113_0047155 Ga0496113_0047155_1858_2199 75
35 3300048918 Ga0496115_0337768 Ga0496115_0337768_351_692 75
36 3300006038 Ga0075365_10024069 Ga0075365_100240693 77
37 3300006178 Ga0075367_10222421 Ga0075367_102224213 77
38 3300006186 Ga0075369_10167526 Ga0075369_101675262 77
39 3300006844 Ga0075428_100392542 Ga0075428_1003925423 77
40 3300006846 Ga0075430_100169947 Ga0075430_1001699473 77
41 3300006847 Ga0075431_100019442 Ga0075431_1000194423 77
42 3300009094 Ga0111539_13496701 Ga0111539_134967012 77
43 3300049742 Ga0501080_0579954 Ga0501080_0579954_381_686 77
44 3300049743 Ga0501081_0729937 Ga0501081_0729937_50_355 77
45 3300050492 nmdc:mga0yw44_1464_c1 nmdc:mga0yw44_1464_c1_6734_7072 77
46 3300050494 nmdc:mga06z11_167067_c1 nmdc:mga06z11_167067_c1_172_477 77
47 3300050509 nmdc:mga0qj67_315378_c1 nmdc:mga0qj67_315378_c1_827_1165 77
48 3300050511 nmdc:mga08y16_832825_c1 nmdc:mga08y16_832825_c1_283_621 77
49 3300050516 nmdc:mga0sz30_275031_c1 nmdc:mga0sz30_275031_c1_298_636 77
50 3300061734 Ga0530510_0042817 Ga0530510_0042817_351_656 77
51 3300025297 Ga0209758_1000382 Ga0209758_100038271 78
52 3300025297 Ga0209758_1085542 Ga0209758_10855422 78
53 3300005937 Ga0081455_10017091 Ga0081455_100170912 79
54 3300006177 Ga0075362_10104793 Ga0075362_101047931 79
55 3300006844 Ga0075428_102641314 Ga0075428_1026413141 79
56 3300006847 Ga0075431_101554903 Ga0075431_1015549031 79
57 3300009147 Ga0114129_13318815 Ga0114129_133188151 79
58 3300050489 nmdc:mga03683_573327_c1 nmdc:mga03683_573327_c1_160_498 79
59 3300050507 nmdc:mga05p37_766057_c1 nmdc:mga05p37_766057_c1_383_721 79
60 3300050508 nmdc:mga09592_113584_c1 nmdc:mga09592_113584_c1_732_1070 79
61 3300050510 nmdc:mga06r32_1502710_c1 nmdc:mga06r32_1502710_c1_212_550 79
62 3300005338 Ga0068868_100319293 Ga0068868_1003192932 81
63 3300005458 Ga0070681_10169665 Ga0070681_101696653 81
64 3300005530 Ga0070679_101828358 Ga0070679_1018283581 81
65 3300005547 Ga0070693_100018816 Ga0070693_1000188164 81
66 3300025912 Ga0207707_11245078 Ga0207707_112450782 81
67 3300050496 nmdc:mga07m45_41227_c1 nmdc:mga07m45_41227_c1_1041_1382 83
68 3300006177 Ga0075362_10613431 Ga0075362_106134311 86
69 3300053090 Ga0500646_0296409 Ga0500646_0296409_69_407 88
70 3300005347 Ga0070668_102093562 Ga0070668_1020935622 92
71 3300005548 Ga0070665_100847863 Ga0070665_1008478632 92
72 3300028379 Ga0268266_10753863 Ga0268266_107538632 92
73 3300005614 Ga0068856_101277859 Ga0068856_1012778592 93
74 3300005337 Ga0070682_100269143 Ga0070682_1002691433 96
75 3300005548 Ga0070665_101983930 Ga0070665_1019839301 96
76 3300006844 Ga0075428_101367989 Ga0075428_1013679892 96
77 3300009094 Ga0111539_10102048 Ga0111539_101020483 96
78 3300028379 Ga0268266_11457978 Ga0268266_114579782 96
79 3300031852 Ga0307410_11385922 Ga0307410_113859222 96
80 3300049590 Ga0501074_1198278 Ga0501074_1198278_194_484 96
81 3300050511 nmdc:mga08y16_111918_c1 nmdc:mga08y16_111918_c1_970_1260 96
82 3300005328 Ga0070676_10085821 Ga0070676_100858213 97
83 3300005329 Ga0070683_100100630 Ga0070683_1001006303 97
84 3300005329 Ga0070683_101431887 Ga0070683_1014318872 97
85 3300005330 Ga0070690_100003935 Ga0070690_1000039354 97
86 3300005330 Ga0070690_101644547 Ga0070690_1016445471 97
87 3300005331 Ga0070670_100003295 Ga0070670_1000032952 97
88 3300005333 Ga0070677_10155434 Ga0070677_101554341 97
89 3300005337 Ga0070682_100586728 Ga0070682_1005867282 97
90 3300005338 Ga0068868_101635846 Ga0068868_1016358461 97
91 3300005341 Ga0070691_10082708 Ga0070691_100827081 97
92 3300005347 Ga0070668_100609731 Ga0070668_1006097312 97
93 3300005353 Ga0070669_100049936 Ga0070669_1000499363 97
94 3300005354 Ga0070675_101581860 Ga0070675_1015818602 97
95 3300005355 Ga0070671_100116770 Ga0070671_1001167703 97
96 3300005356 Ga0070674_100851185 Ga0070674_1008511852 97
97 3300005356 Ga0070674_101125808 Ga0070674_1011258082 97
98 3300005356 Ga0070674_101145005 Ga0070674_1011450052 97
99 3300005365 Ga0070688_100006635 Ga0070688_1000066354 97
100 3300005366 Ga0070659_100088000 Ga0070659_1000880004 97
101 3300005366 Ga0070659_100957305 Ga0070659_1009573051 97
102 3300005367 Ga0070667_100464223 Ga0070667_1004642231 97
103 3300005435 Ga0070714_100988387 Ga0070714_1009883872 97
104 3300005436 Ga0070713_101501061 Ga0070713_1015010611 97
105 3300005436 Ga0070713_101532963 Ga0070713_1015329631 97
106 3300005438 Ga0070701_10483269 Ga0070701_104832692 97
107 3300005438 Ga0070701_10704806 Ga0070701_107048061 97
108 3300005439 Ga0070711_100219863 Ga0070711_1002198633 97
109 3300005455 Ga0070663_100288623 Ga0070663_1002886232 97
110 3300005456 Ga0070678_100207795 Ga0070678_1002077951 97
111 3300005457 Ga0070662_100017831 Ga0070662_1000178311 97
112 3300005459 Ga0068867_101685772 Ga0068867_1016857722 97
113 3300005466 Ga0070685_10535443 Ga0070685_105354432 97
114 3300005530 Ga0070679_100664631 Ga0070679_1006646312 97
115 3300005535 Ga0070684_100397034 Ga0070684_1003970341 97
116 3300005535 Ga0070684_102072595 Ga0070684_1020725951 97
117 3300005539 Ga0068853_100184894 Ga0068853_1001848943 97
118 3300005543 Ga0070672_100551090 Ga0070672_1005510903 97
119 3300005544 Ga0070686_100388216 Ga0070686_1003882163 97
120 3300005544 Ga0070686_101446972 Ga0070686_1014469721 97
121 3300005544 Ga0070686_101484724 Ga0070686_1014847241 97
122 3300005548 Ga0070665_100145562 Ga0070665_1001455623 97
123 3300005564 Ga0070664_100128382 Ga0070664_1001283822 97
124 3300005564 Ga0070664_100261554 Ga0070664_1002615541 97
125 3300005616 Ga0068852_100432321 Ga0068852_1004323213 97
126 3300005617 Ga0068859_100080459 Ga0068859_1000804593 97
127 3300005617 Ga0068859_101007473 Ga0068859_1010074732 97
128 3300005618 Ga0068864_100033415 Ga0068864_1000334153 97
129 3300005618 Ga0068864_100586311 Ga0068864_1005863113 97
130 3300005719 Ga0068861_100146808 Ga0068861_1001468083 97
131 3300005719 Ga0068861_100833803 Ga0068861_1008338031 97
132 3300005719 Ga0068861_101829311 Ga0068861_1018293111 97
133 3300005840 Ga0068870_11111412 Ga0068870_111114121 97
134 3300005841 Ga0068863_100698932 Ga0068863_1006989322 97
135 3300005842 Ga0068858_100718291 Ga0068858_1007182912 97
136 3300005843 Ga0068860_102449985 Ga0068860_1024499852 97
137 3300005844 Ga0068862_100183626 Ga0068862_1001836263 97
138 3300005844 Ga0068862_101704093 Ga0068862_1017040932 97
139 3300005937 Ga0081455_10193131 Ga0081455_101931312 97
140 3300005985 Ga0081539_10305458 Ga0081539_103054582 97
141 3300006028 Ga0070717_10686781 Ga0070717_106867812 97
142 3300006038 Ga0075365_10704423 Ga0075365_107044231 97
143 3300006177 Ga0075362_10074238 Ga0075362_100742382 97
144 3300006177 Ga0075362_10435233 Ga0075362_104352331 97
145 3300006195 Ga0075366_10004388 Ga0075366_100043887 97
146 3300006195 Ga0075366_10042442 Ga0075366_100424423 97
147 3300006844 Ga0075428_100046994 Ga0075428_1000469945 97
148 3300006844 Ga0075428_101031170 Ga0075428_1010311701 97
149 3300006871 Ga0075434_100018214 Ga0075434_1000182144 97
150 3300006881 Ga0068865_100134073 Ga0068865_1001340733 97
151 3300006931 Ga0097620_100080459 Ga0097620_1000804593 97
152 3300006931 Ga0097620_101007459 Ga0097620_1010074592 97
153 3300007788 Ga0099795_10367487 Ga0099795_103674871 97
154 3300009093 Ga0105240_11045701 Ga0105240_110457013 97
155 3300009094 Ga0111539_10670681 Ga0111539_106706812 97
156 3300009094 Ga0111539_10774014 Ga0111539_107740142 97
157 3300009094 Ga0111539_11253236 Ga0111539_112532362 97
158 3300009098 Ga0105245_11127440 Ga0105245_111274402 97
159 3300009101 Ga0105247_10106416 Ga0105247_101064163 97
160 3300009147 Ga0114129_10005101 Ga0114129_1000510115 97
161 3300009147 Ga0114129_10864743 Ga0114129_108647432 97
162 3300009147 Ga0114129_12905855 Ga0114129_129058551 97
163 3300009148 Ga0105243_10652526 Ga0105243_106525262 97
164 3300009148 Ga0105243_11438064 Ga0105243_114380642 97
165 3300009176 Ga0105242_10804669 Ga0105242_108046692 97
166 3300009176 Ga0105242_10826239 Ga0105242_108262391 97
167 3300009176 Ga0105242_12215770 Ga0105242_122157702 97
168 3300009177 Ga0105248_10015876 Ga0105248_100158766 97
169 3300009177 Ga0105248_10946085 Ga0105248_109460852 97
170 3300009551 Ga0105238_10664902 Ga0105238_106649022 97
171 3300009551 Ga0105238_11282561 Ga0105238_112825611 97
172 3300009553 Ga0105249_10667680 Ga0105249_106676802 97
173 3300009553 Ga0105249_11492037 Ga0105249_114920372 97
174 3300009553 Ga0105249_12239715 Ga0105249_122397151 97
175 3300010375 Ga0105239_10237933 Ga0105239_102379331 97
176 3300010375 Ga0105239_12411293 Ga0105239_124112932 97
177 3300011119 Ga0105246_10058522 Ga0105246_100585222 97
178 3300013297 Ga0157378_10476722 Ga0157378_104767222 97
179 3300013297 Ga0157378_10725003 Ga0157378_107250032 97
180 3300013306 Ga0163162_10031609 Ga0163162_100316095 97
181 3300013306 Ga0163162_10214916 Ga0163162_102149161 97
182 3300013308 Ga0157375_11904439 Ga0157375_119044392 97
183 3300013308 Ga0157375_12462013 Ga0157375_124620132 97
184 3300014325 Ga0163163_10002186 Ga0163163_100021867 97
185 3300014325 Ga0163163_10068555 Ga0163163_100685554 97
186 3300014326 Ga0157380_10370769 Ga0157380_103707692 97
187 3300014326 Ga0157380_11546579 Ga0157380_115465792 97
188 3300014326 Ga0157380_12573056 Ga0157380_125730561 97
189 3300014745 Ga0157377_10137392 Ga0157377_101373922 97
190 3300014968 Ga0157379_10108231 Ga0157379_101082314 97
191 3300014968 Ga0157379_10540219 Ga0157379_105402192 97
192 3300025315 Ga0207697_10016668 Ga0207697_100166683 97
193 3300025900 Ga0207710_10203262 Ga0207710_102032623 97
194 3300025901 Ga0207688_10435040 Ga0207688_104350402 97
195 3300025905 Ga0207685_10156257 Ga0207685_101562572 97
196 3300025906 Ga0207699_10198601 Ga0207699_101986012 97
197 3300025907 Ga0207645_10038182 Ga0207645_100381823 97
198 3300025913 Ga0207695_10770129 Ga0207695_107701293 97
199 3300025915 Ga0207693_10096155 Ga0207693_100961552 97
200 3300025916 Ga0207663_10141889 Ga0207663_101418893 97
201 3300025917 Ga0207660_10894409 Ga0207660_108944092 97
202 3300025921 Ga0207652_11165449 Ga0207652_111654491 97
203 3300025923 Ga0207681_10100813 Ga0207681_101008133 97
204 3300025924 Ga0207694_10324354 Ga0207694_103243542 97
205 3300025925 Ga0207650_10043607 Ga0207650_100436073 97
206 3300025926 Ga0207659_10321386 Ga0207659_103213862 97
207 3300025928 Ga0207700_10415987 Ga0207700_104159872 97
208 3300025929 Ga0207664_10276028 Ga0207664_102760283 97
209 3300025932 Ga0207690_10149735 Ga0207690_101497353 97
210 3300025933 Ga0207706_10045969 Ga0207706_100459693 97
211 3300025934 Ga0207686_10188493 Ga0207686_101884933 97
212 3300025934 Ga0207686_10672519 Ga0207686_106725192 97
213 3300025936 Ga0207670_10002860 Ga0207670_100028606 97
214 3300025937 Ga0207669_10634953 Ga0207669_106349532 97
215 3300025938 Ga0207704_10088038 Ga0207704_100880383 97
216 3300025939 Ga0207665_10129934 Ga0207665_101299342 97
217 3300025939 Ga0207665_10893079 Ga0207665_108930792 97
218 3300025941 Ga0207711_10009020 Ga0207711_100090206 97
219 3300025941 Ga0207711_10686113 Ga0207711_106861132 97
220 3300025944 Ga0207661_10173788 Ga0207661_101737883 97
221 3300025945 Ga0207679_10022390 Ga0207679_100223904 97
222 3300025945 Ga0207679_10218119 Ga0207679_102181191 97
223 3300025961 Ga0207712_10414302 Ga0207712_104143022 97
224 3300025961 Ga0207712_10761707 Ga0207712_107617072 97
225 3300025986 Ga0207658_10651126 Ga0207658_106511262 97
226 3300026023 Ga0207677_11076753 Ga0207677_110767532 97
227 3300026035 Ga0207703_10362637 Ga0207703_103626372 97
228 3300026041 Ga0207639_10402883 Ga0207639_104028832 97
229 3300026067 Ga0207678_10230815 Ga0207678_102308152 97
230 3300026075 Ga0207708_11275934 Ga0207708_112759341 97
231 3300026088 Ga0207641_10413121 Ga0207641_104131212 97
232 3300026089 Ga0207648_10273227 Ga0207648_102732272 97
233 3300026095 Ga0207676_10016782 Ga0207676_100167823 97
234 3300026095 Ga0207676_10702018 Ga0207676_107020181 97
235 3300026118 Ga0207675_100335249 Ga0207675_1003352493 97
236 3300026142 Ga0207698_10529503 Ga0207698_105295031 97
237 3300026142 Ga0207698_10658454 Ga0207698_106584543 97
238 3300027907 Ga0207428_10500372 Ga0207428_105003721 97
239 3300028379 Ga0268266_10235478 Ga0268266_102354782 97
240 3300028379 Ga0268266_10604851 Ga0268266_106048512 97
241 3300028380 Ga0268265_10395839 Ga0268265_103958391 97
242 3300028381 Ga0268264_10055088 Ga0268264_100550884 97
243 3300028381 Ga0268264_12291804 Ga0268264_122918041 97
244 3300031548 Ga0307408_100162703 Ga0307408_1001627032 97
245 3300031824 Ga0307413_10206401 Ga0307413_102064011 97
246 3300031852 Ga0307410_11711769 Ga0307410_117117692 97
247 3300031901 Ga0307406_11464420 Ga0307406_114644201 97
248 3300031903 Ga0307407_10201929 Ga0307407_102019293 97
249 3300031911 Ga0307412_10144284 Ga0307412_101442843 97
250 3300031995 Ga0307409_100171723 Ga0307409_1001717233 97
251 3300032002 Ga0307416_102906001 Ga0307416_1029060012 97
252 3300032002 Ga0307416_103398235 Ga0307416_1033982352 97
253 3300032002 Ga0307416_103692198 Ga0307416_1036921982 97
254 3300032005 Ga0307411_10174206 Ga0307411_101742062 97
255 3300032005 Ga0307411_10393369 Ga0307411_103933691 97
256 3300032126 Ga0307415_101681261 Ga0307415_1016812611 97
257 3300034816 Ga0373930_0001772 Ga0373930_0001772_2443_2784 97
258 3300034816 Ga0373930_0060129 Ga0373930_0060129_186_479 97
259 3300034957 Ga0373938_0068493 Ga0373938_0068493_82_423 97
260 3300034957 Ga0373938_0082649 Ga0373938_0082649_52_345 97
261 3300035084 Ga0373928_0009951 Ga0373928_0009951_323_664 97
262 3300035088 Ga0373940_0078785 Ga0373940_0078785_244_585 97
263 3300035088 Ga0373940_0364701 Ga0373940_0364701_177_470 97
264 3300035091 Ga0373951_0074261 Ga0373951_0074261_276_617 97
265 3300035092 Ga0373952_0004860 Ga0373952_0004860_1635_1976 97
266 3300035112 Ga0373932_0058705 Ga0373932_0058705_528_869 97
267 3300035112 Ga0373932_0336758 Ga0373932_0336758_75_368 97
268 3300035112 Ga0373932_0395447 Ga0373932_0395447_65_358 97
269 3300035114 Ga0373939_0004798 Ga0373939_0004798_1893_2234 97
270 3300035114 Ga0373939_0039468 Ga0373939_0039468_926_1219 97
271 3300035115 Ga0373941_0094543 Ga0373941_0094543_531_872 97
272 3300035115 Ga0373941_0425242 Ga0373941_0425242_78_383 97
273 3300035121 Ga0373960_0003526 Ga0373960_0003526_1079_1420 97
274 3300035207 Ga0373942_0003945 Ga0373942_0003945_3086_3427 97
275 3300035241 Ga0373961_0007220 Ga0373961_0007220_224_517 97
276 3300035241 Ga0373961_0014770 Ga0373961_0014770_482_823 97
277 3300035691 Ga0373931_0000416 Ga0373931_0000416_5671_6012 97
278 3300035691 Ga0373931_0001658 Ga0373931_0001658_3311_3604 97
279 3300035691 Ga0373931_0434591 Ga0373931_0434591_487_792 97
280 3300036401 Ga0373937_1323306 Ga0373937_1323306_78_410 97
281 3300037068 Ga0373925_0624939 Ga0373925_0624939_161_502 97
282 3300041408 Ga0439453_0049969 Ga0439453_0049969_174_479 97
283 3300041458 Ga0451798_0387576 Ga0451798_0387576_375_668 97
284 3300042184 Ga0450908_035710 Ga0450908_035710_293_598 97
285 3300042436 Ga0439435_0026640 Ga0439435_0026640_633_926 97
286 3300044694 Ga0466963_0186969 Ga0466963_0186969_705_1013 97
287 3300046459 Ga0495629_0020340 Ga0495629_0020340_3275_3607 97
288 3300046460 Ga0495638_0047138 Ga0495638_0047138_1310_1633 97
289 3300046473 Ga0495582_0245616 Ga0495582_0245616_26_358 97
290 3300046499 Ga0495594_0140888 Ga0495594_0140888_12_317 97
291 3300046531 Ga0495665_0544835 Ga0495665_0544835_129_434 97
292 3300046537 Ga0495598_0104095 Ga0495598_0104095_439_744 97
293 3300047319 Ga0495674_0272691 Ga0495674_0272691_984_1316 97
294 3300047320 Ga0495672_0450892 Ga0495672_0450892_260_553 97
295 3300047447 Ga0495685_008495 Ga0495685_008495_1549_1854 97
296 3300047673 Ga0495593_0174860 Ga0495593_0174860_141_473 97
297 3300048090 Ga0495615_0042932 Ga0495615_0042932_304_609 97
298 3300048903 Ga0496100_0000936 Ga0496100_0000936_4357_4698 97
299 3300048904 Ga0496101_0001406 Ga0496101_0001406_9732_10073 97
300 3300048904 Ga0496101_0063969 Ga0496101_0063969_1732_2037 97
301 3300048904 Ga0496101_1161860 Ga0496101_1161860_202_507 97
302 3300048905 Ga0496102_0024611 Ga0496102_0024611_114_455 97
303 3300048905 Ga0496102_0459249 Ga0496102_0459249_246_551 97
304 3300048905 Ga0496102_1795191 Ga0496102_1795191_84_389 97
305 3300048906 Ga0496103_0053335 Ga0496103_0053335_34_330 97
306 3300048906 Ga0496103_0388732 Ga0496103_0388732_163_468 97
307 3300048907 Ga0496104_0022209 Ga0496104_0022209_146_487 97
308 3300048907 Ga0496104_0025211 Ga0496104_0025211_3335_3640 97
309 3300048908 Ga0496105_0002256 Ga0496105_0002256_10492_10833 97
310 3300048908 Ga0496105_0022512 Ga0496105_0022512_326_631 97
311 3300048909 Ga0496106_0006550 Ga0496106_0006550_1512_1853 97
312 3300048909 Ga0496106_0024691 Ga0496106_0024691_2786_3091 97
313 3300048910 Ga0496107_0010746 Ga0496107_0010746_5639_5980 97
314 3300048910 Ga0496107_0568825 Ga0496107_0568825_303_608 97
315 3300048911 Ga0496108_0000400 Ga0496108_0000400_4758_5063 97
316 3300048911 Ga0496108_0096169 Ga0496108_0096169_1197_1538 97
317 3300048912 Ga0496109_0011907 Ga0496109_0011907_5542_5847 97
318 3300048912 Ga0496109_0044007 Ga0496109_0044007_2970_3263 97
319 3300048912 Ga0496109_0150811 Ga0496109_0150811_1798_2139 97
320 3300048913 Ga0496110_0025649 Ga0496110_0025649_4513_4806 97
321 3300048913 Ga0496110_0121068 Ga0496110_0121068_109_414 97
322 3300048913 Ga0496110_0368659 Ga0496110_0368659_57_362 97
323 3300048914 Ga0496111_0009679 Ga0496111_0009679_4951_5292 97
324 3300048914 Ga0496111_0460275 Ga0496111_0460275_66_359 97
325 3300048915 Ga0496112_0019174 Ga0496112_0019174_2410_2715 97
326 3300048915 Ga0496112_0038742 Ga0496112_0038742_1303_1644 97
327 3300048916 Ga0496113_0008141 Ga0496113_0008141_2022_2327 97
328 3300048916 Ga0496113_0072319 Ga0496113_0072319_1531_1872 97
329 3300048916 Ga0496113_0119420 Ga0496113_0119420_1100_1393 97
330 3300048917 Ga0496114_0194429 Ga0496114_0194429_1421_1762 97
331 3300048918 Ga0496115_0003984 Ga0496115_0003984_2873_3214 97
332 3300048918 Ga0496115_0276554 Ga0496115_0276554_318_623 97
333 3300049568 Ga0501031_0034456 Ga0501031_0034456_1925_2236 97
334 3300049569 Ga0501032_0019142 Ga0501032_0019142_3111_3404 97
335 3300049569 Ga0501032_0541316 Ga0501032_0541316_89_382 97
336 3300049569 Ga0501032_0653528 Ga0501032_0653528_213_506 97
337 3300049570 Ga0501033_0062034 Ga0501033_0062034_1505_1816 97
338 3300049571 Ga0501034_0000438 Ga0501034_0000438_5423_5716 97
339 3300049571 Ga0501034_0012727 Ga0501034_0012727_541_852 97
340 3300049571 Ga0501034_0139101 Ga0501034_0139101_1093_1428 97
341 3300049571 Ga0501034_0551739 Ga0501034_0551739_710_1015 97
342 3300049572 Ga0501036_0059398 Ga0501036_0059398_368_703 97
343 3300049572 Ga0501036_0093151 Ga0501036_0093151_1446_1757 97
344 3300049572 Ga0501036_0259865 Ga0501036_0259865_273_566 97
345 3300049572 Ga0501036_0298105 Ga0501036_0298105_565_858 97
346 3300049573 Ga0501037_0332507 Ga0501037_0332507_62_397 97
347 3300049574 Ga0501038_0019505 Ga0501038_0019505_4353_4664 97
348 3300049574 Ga0501038_0060337 Ga0501038_0060337_490_825 97
349 3300049575 Ga0501039_0073166 Ga0501039_0073166_1031_1324 97
350 3300049575 Ga0501039_0128901 Ga0501039_0128901_1135_1446 97
351 3300049576 Ga0501040_0163574 Ga0501040_0163574_889_1194 97
352 3300049576 Ga0501040_0771937 Ga0501040_0771937_374_667 97
353 3300049577 Ga0501041_0733254 Ga0501041_0733254_53_346 97
354 3300049578 Ga0501042_0427343 Ga0501042_0427343_426_731 97
355 3300049579 Ga0501043_0060077 Ga0501043_0060077_2481_2816 97
356 3300049579 Ga0501043_0712314 Ga0501043_0712314_372_683 97
357 3300049580 Ga0501046_0064018 Ga0501046_0064018_371_676 97
358 3300049580 Ga0501046_0649410 Ga0501046_0649410_324_659 97
359 3300049580 Ga0501046_1030074 Ga0501046_1030074_246_539 97
360 3300049581 Ga0501047_0061534 Ga0501047_0061534_363_674 97
361 3300049581 Ga0501047_0126186 Ga0501047_0126186_330_665 97
362 3300049581 Ga0501047_0477354 Ga0501047_0477354_314_619 97
363 3300049582 Ga0501048_0128859 Ga0501048_0128859_61_396 97
364 3300049584 Ga0501068_0106149 Ga0501068_0106149_872_1165 97
365 3300049584 Ga0501068_0481632 Ga0501068_0481632_298_591 97
366 3300049586 Ga0501070_0034993 Ga0501070_0034993_1442_1777 97
367 3300049586 Ga0501070_0190786 Ga0501070_0190786_102_413 97
368 3300049586 Ga0501070_0208451 Ga0501070_0208451_643_936 97
369 3300049587 Ga0501071_0094631 Ga0501071_0094631_630_965 97
370 3300049587 Ga0501071_0446367 Ga0501071_0446367_26_319 97
371 3300049587 Ga0501071_0833882 Ga0501071_0833882_321_614 97
372 3300049588 Ga0501072_1042102 Ga0501072_1042102_12_317 97
373 3300049589 Ga0501073_0574595 Ga0501073_0574595_400_705 97
374 3300049589 Ga0501073_0734990 Ga0501073_0734990_224_517 97
375 3300049589 Ga0501073_0923900 Ga0501073_0923900_51_344 97
376 3300049590 Ga0501074_0675638 Ga0501074_0675638_139_432 97
377 3300049591 Ga0501075_0245664 Ga0501075_0245664_404_697 97
378 3300049592 Ga0501076_0144193 Ga0501076_0144193_1298_1603 97
379 3300049592 Ga0501076_0194643 Ga0501076_0194643_774_1067 97
380 3300049592 Ga0501076_0827240 Ga0501076_0827240_256_549 97
381 3300049593 Ga0501077_0326473 Ga0501077_0326473_237_542 97
382 3300049593 Ga0501077_0367783 Ga0501077_0367783_388_681 97
383 3300049593 Ga0501077_0814164 Ga0501077_0814164_24_323 97
384 3300049593 Ga0501077_0937628 Ga0501077_0937628_169_462 97
385 3300049741 Ga0501079_1079954 Ga0501079_1079954_73_366 97
386 3300049741 Ga0501079_1113660 Ga0501079_1113660_82_375 97
387 3300049743 Ga0501081_0407604 Ga0501081_0407604_107_400 97
388 3300049744 Ga0501083_0852746 Ga0501083_0852746_15_308 97
389 3300049744 Ga0501083_1101642 Ga0501083_1101642_109_414 97
390 3300049822 Ga0501035_0272415 Ga0501035_0272415_1025_1336 97
391 3300049822 Ga0501035_0842909 Ga0501035_0842909_213_506 97
392 3300049823 Ga0501044_0001788 Ga0501044_0001788_18608_18901 97
393 3300049823 Ga0501044_0072138 Ga0501044_0072138_2484_2819 97
394 3300049823 Ga0501044_0264173 Ga0501044_0264173_476_781 97
395 3300049823 Ga0501044_0589512 Ga0501044_0589512_272_583 97
396 3300049823 Ga0501044_1011973 Ga0501044_1011973_134_445 97
397 3300049824 Ga0501045_0176950 Ga0501045_0176950_616_921 97
398 3300050489 nmdc:mga03683_189045_c1 nmdc:mga03683_189045_c1_498_836 97
399 3300050491 nmdc:mga00v17_159912_c1 nmdc:mga00v17_159912_c1_287_592 97
400 3300050493 nmdc:mga0k408_17338_c1 nmdc:mga0k408_17338_c1_627_965 97
401 3300050493 nmdc:mga0k408_402919_c1 nmdc:mga0k408_402919_c1_271_573 97
402 3300050493 nmdc:mga0k408_79459_c1 nmdc:mga0k408_79459_c1_59_412 97
403 3300050494 nmdc:mga06z11_132390_c1 nmdc:mga06z11_132390_c1_283_576 97
404 3300050494 nmdc:mga06z11_44196_c1 nmdc:mga06z11_44196_c1_14_352 97
405 3300050507 nmdc:mga05p37_1314121_c1 nmdc:mga05p37_1314121_c1_352_651 97
406 3300050507 nmdc:mga05p37_56610_c1 nmdc:mga05p37_56610_c1_2065_2370 97
407 3300050508 nmdc:mga09592_290244_c1 nmdc:mga09592_290244_c1_65_370 97
408 3300050509 nmdc:mga0qj67_910884_c1 nmdc:mga0qj67_910884_c1_89_394 97
409 3300050511 nmdc:mga08y16_456580_c1 nmdc:mga08y16_456580_c1_835_1143 97
410 3300050516 nmdc:mga0sz30_209632_c1 nmdc:mga0sz30_209632_c1_177_482 97
411 3300053085 Ga0495619_0092429 Ga0495619_0092429_1019_1351 97
412 3300053092 Ga0500583_0218254 Ga0500583_0218254_602_928 97
413 3300053093 Ga0500651_0200485 Ga0500651_0200485_676_999 97
414 3300053117 Ga0500593_016715 Ga0500593_016715_689_988 97
415 3300053119 Ga0500595_137993 Ga0500595_137993_250_555 97
416 3300053129 Ga0500628_091315 Ga0500628_091315_110_403 97
417 3300053130 Ga0500642_0143398 Ga0500642_0143398_541_864 97
418 3300053151 Ga0500604_0012339 Ga0500604_0012339_1087_1386 97
419 3300053153 Ga0500616_0302576 Ga0500616_0302576_122_415 97
420 3300053158 Ga0500627_0072895 Ga0500627_0072895_700_993 97
421 3300053177 Ga0500636_0263157 Ga0500636_0263157_242_547 97
422 3300053727 Ga0500611_015228 Ga0500611_015228_858_1181 97
423 3300054114 Ga0501084_0115123 Ga0501084_0115123_224_517 97
424 3300054114 Ga0501084_0266029 Ga0501084_0266029_1048_1341 97
425 3300054114 Ga0501084_0468506 Ga0501084_0468506_205_498 97
426 3300059626 Ga0587115_053055 Ga0587115_053055_335_643 97
427 3300059647 Ga0587079_002805 Ga0587079_002805_333_641 97
428 3300060353 Ga0501082_0002950 Ga0501082_0002950_14490_14795 97
429 3300060353 Ga0501082_0176758 Ga0501082_0176758_615_920 97
430 3300060353 Ga0501082_0346979 Ga0501082_0346979_818_1111 97
431 3300060353 Ga0501082_0377295 Ga0501082_0377295_403_696 97
432 3300060353 Ga0501082_1333953 Ga0501082_1333953_41_346 97
433 3300060353 Ga0501082_1514314 Ga0501082_1514314_166_459 97
434 3300061734 Ga0530510_0031201 Ga0530510_0031201_106_399 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

41

96

0.97

PF13560

HTH_31

Helix-turn-helix domain

36

98

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1adr-assembly1.cif.gz_A determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor 0.8937 18 77
7xi5-assembly1.cif.gz_A anti-crispr-associated aca10 0.8914 18 67
1utx-assembly1.cif.gz_B regulation of cytolysin expression by enterococcus faecalis: role of cylr2 0.8896 21 75
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.8884 21 74
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.8879 21 74
ID Description Score Start End Superfamily
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8937 18 77 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8863 18 76 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8858 18 76 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8762 18 70 1.10.260.40
af_Q58006_80_170_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.876 18 72 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A5E8GU32-F1-model_v4 Helix-turn-helix protein 0.9991 9 92 GO:0003677
AF-B6IXD2-F1-model_v4 DNA-binding protein, putative 0.9984 9 94 GO:0003677
AF-A0A832DUV6-F1-model_v4 XRE family transcriptional regulator 0.9977 9 94 GO:0003677
AF-A0A2S6QIJ8-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9971 9 94 GO:0003677
AF-A0A1W2EV98-F1-model_v4 Helix-turn-helix domain-containing protein 0.997 9 95 GO:0003677

Feature Viewer

pLDDT pTM Quality
92.98 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map