F443201
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 434 | 244 | 434 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_79459_c1|nmdc:mga0k408_79459_c1_59_412 |
| Length | 117 |
| Sequence | MKRAKRQAGSSGSGSAIGGAMQIAKPEPQAKQLRKKAGSWLKELRARAGLSQIELAAILEFKYYTFISQVENGFGRVPTESMEAWAKALGVNPSEFARELLSYYEPELYRLLFEVKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 153 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 154 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 155 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 184 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 220 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 229 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 230 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 231 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 232 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 233 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 234 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 235 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 236 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 237 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 239 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 240 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.53 |
| Nodule | 0 |
| Rhizoplane | 11.06 |
| Rhizosphere | 80.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10085821 | 3300005328 | Bacteria | 1919 |
| 2 | Ga0070683_100100630 | 3300005329 | Bacteria | 2721 |
| 3 | Ga0070683_101431887 | 3300005329 | Bacteria | 664 |
| 4 | Ga0070690_100003935 | 3300005330 | Bacteria | 8199 |
| 5 | Ga0070690_101644547 | 3300005330 | Bacteria | 521 |
| 6 | Ga0070670_100003295 | 3300005331 | Bacteria | 13360 |
| 7 | Ga0070677_10155434 | 3300005333 | Bacteria | 1068 |
| 8 | Ga0070682_100269143 | 3300005337 | Bacteria | 1237 |
| 9 | Ga0070682_100586728 | 3300005337 | Bacteria | 878 |
| 10 | Ga0068868_100319293 | 3300005338 | Bacteria | 1323 |
| 11 | Ga0068868_101635846 | 3300005338 | Bacteria | 606 |
| 12 | Ga0070691_10082708 | 3300005341 | Bacteria | 1574 |
| 13 | Ga0070668_100609731 | 3300005347 | Bacteria | 956 |
| 14 | Ga0070668_102093562 | 3300005347 | Bacteria | 522 |
| 15 | Ga0070669_100049936 | 3300005353 | Bacteria | 3055 |
| 16 | Ga0070675_101581860 | 3300005354 | Bacteria | 605 |
| 17 | Ga0070671_100116770 | 3300005355 | Bacteria | 2244 |
| 18 | Ga0070671_100558137 | 3300005355 | Unclassified | 988 |
| 19 | Ga0070674_100851185 | 3300005356 | Bacteria | 791 |
| 20 | Ga0070674_101125808 | 3300005356 | Unclassified | 694 |
| 21 | Ga0070674_101145005 | 3300005356 | Bacteria | 689 |
| 22 | Ga0070688_100006635 | 3300005365 | Bacteria | 6199 |
| 23 | Ga0070659_100088000 | 3300005366 | Bacteria | 2487 |
| 24 | Ga0070659_100957305 | 3300005366 | Bacteria | 750 |
| 25 | Ga0070667_100464223 | 3300005367 | Bacteria | 1158 |
| 26 | Ga0070714_100988387 | 3300005435 | Bacteria | 819 |
| 27 | Ga0070713_101501061 | 3300005436 | Unclassified | 654 |
| 28 | Ga0070713_101532963 | 3300005436 | Bacteria | 647 |
| 29 | Ga0070701_10483269 | 3300005438 | Bacteria | 801 |
| 30 | Ga0070701_10704806 | 3300005438 | Bacteria | 679 |
| 31 | Ga0070711_100219863 | 3300005439 | Bacteria | 1476 |
| 32 | Ga0070711_100301753 | 3300005439 | Unclassified | 1274 |
| 33 | Ga0070663_100288623 | 3300005455 | Bacteria | 1310 |
| 34 | Ga0070678_100207795 | 3300005456 | Bacteria | 1620 |
| 35 | Ga0070662_100017831 | 3300005457 | Bacteria | 4790 |
| 36 | Ga0070681_10169665 | 3300005458 | Bacteria | 2104 |
| 37 | Ga0068867_101685772 | 3300005459 | Unclassified | 594 |
| 38 | Ga0070685_10535443 | 3300005466 | Bacteria | 834 |
| 39 | Ga0070679_100664631 | 3300005530 | Bacteria | 985 |
| 40 | Ga0070679_101828358 | 3300005530 | Bacteria | 556 |
| 41 | Ga0070684_100397034 | 3300005535 | Bacteria | 1271 |
| 42 | Ga0070684_102072595 | 3300005535 | Bacteria | 537 |
| 43 | Ga0068853_100184894 | 3300005539 | Bacteria | 1891 |
| 44 | Ga0070672_100551090 | 3300005543 | Bacteria | 1001 |
| 45 | Ga0070686_100388216 | 3300005544 | Bacteria | 1058 |
| 46 | Ga0070686_101446972 | 3300005544 | Bacteria | 578 |
| 47 | Ga0070686_101484724 | 3300005544 | Unclassified | 571 |
| 48 | Ga0070693_100018816 | 3300005547 | Bacteria | 3613 |
| 49 | Ga0070665_100145562 | 3300005548 | Bacteria | 2372 |
| 50 | Ga0070665_100847863 | 3300005548 | Bacteria | 927 |
| 51 | Ga0070665_101983930 | 3300005548 | Unclassified | 587 |
| 52 | Ga0070664_100128382 | 3300005564 | Bacteria | 2225 |
| 53 | Ga0070664_100261554 | 3300005564 | Bacteria | 1557 |
| 54 | Ga0068856_101277859 | 3300005614 | Unclassified | 749 |
| 55 | Ga0068852_100432321 | 3300005616 | Bacteria | 1300 |
| 56 | Ga0068859_100080459 | 3300005617 | Bacteria | 3299 |
| 57 | Ga0068859_101007473 | 3300005617 | Bacteria | 915 |
| 58 | Ga0068864_100033415 | 3300005618 | Bacteria | 4373 |
| 59 | Ga0068864_100586311 | 3300005618 | Bacteria | 1081 |
| 60 | Ga0068861_100146808 | 3300005719 | Unclassified | 1931 |
| 61 | Ga0068861_100833803 | 3300005719 | Bacteria | 868 |
| 62 | Ga0068861_101829311 | 3300005719 | Bacteria | 603 |
| 63 | Ga0068870_11111412 | 3300005840 | Bacteria | 569 |
| 64 | Ga0068863_100698932 | 3300005841 | Bacteria | 1008 |
| 65 | Ga0068858_100718291 | 3300005842 | Bacteria | 973 |
| 66 | Ga0068860_102449985 | 3300005843 | Unclassified | 542 |
| 67 | Ga0068862_100183626 | 3300005844 | Bacteria | 1878 |
| 68 | Ga0068862_101704093 | 3300005844 | Bacteria | 638 |
| 69 | Ga0081455_10017091 | 3300005937 | Bacteria | 6971 |
| 70 | Ga0081455_10193131 | 3300005937 | Bacteria | 1531 |
| 71 | Ga0081539_10305458 | 3300005985 | Bacteria | 682 |
| 72 | Ga0070717_10686781 | 3300006028 | Bacteria | 930 |
| 73 | Ga0075365_10024069 | 3300006038 | Bacteria | 3836 |
| 74 | Ga0075365_10704423 | 3300006038 | Bacteria | 713 |
| 75 | Ga0070712_100543692 | 3300006175 | Unclassified | 978 |
| 76 | Ga0075362_10074238 | 3300006177 | Bacteria | 1558 |
| 77 | Ga0075362_10104793 | 3300006177 | Bacteria | 1326 |
| 78 | Ga0075362_10435233 | 3300006177 | Bacteria | 665 |
| 79 | Ga0075362_10613431 | 3300006177 | Bacteria | 563 |
| 80 | Ga0075367_10222421 | 3300006178 | Bacteria | 1181 |
| 81 | Ga0075369_10167526 | 3300006186 | Bacteria | 1008 |
| 82 | Ga0075366_10004388 | 3300006195 | Bacteria | 7570 |
| 83 | Ga0075366_10042442 | 3300006195 | Bacteria | 2693 |
| 84 | Ga0075428_100046994 | 3300006844 | Bacteria | 4742 |
| 85 | Ga0075428_100392542 | 3300006844 | Bacteria | 1487 |
| 86 | Ga0075428_101031170 | 3300006844 | Unclassified | 870 |
| 87 | Ga0075428_101367989 | 3300006844 | Bacteria | 743 |
| 88 | Ga0075428_102641314 | 3300006844 | Unclassified | 512 |
| 89 | Ga0075430_100169947 | 3300006846 | Bacteria | 1814 |
| 90 | Ga0075431_100019442 | 3300006847 | Bacteria | 6925 |
| 91 | Ga0075431_101554903 | 3300006847 | Bacteria | 619 |
| 92 | Ga0075434_100018214 | 3300006871 | Bacteria | 6781 |
| 93 | Ga0068865_100134073 | 3300006881 | Bacteria | 1858 |
| 94 | Ga0097620_100080459 | 3300006931 | Bacteria | 3299 |
| 95 | Ga0097620_101007459 | 3300006931 | Bacteria | 915 |
| 96 | Ga0075435_100295458 | 3300007076 | Bacteria | 1385 |
| 97 | Ga0099795_10367487 | 3300007788 | Bacteria | 647 |
| 98 | Ga0105240_11045701 | 3300009093 | Bacteria | 871 |
| 99 | Ga0111539_10102048 | 3300009094 | Bacteria | 3367 |
| 100 | Ga0111539_10417054 | 3300009094 | Bacteria | 1564 |
| 101 | Ga0111539_10670681 | 3300009094 | Bacteria | 1207 |
| 102 | Ga0111539_10774014 | 3300009094 | Bacteria | 1117 |
| 103 | Ga0111539_11253236 | 3300009094 | Bacteria | 861 |
| 104 | Ga0111539_13496701 | 3300009094 | Unclassified | 504 |
| 105 | Ga0105245_10039626 | 3300009098 | Bacteria | 4194 |
| 106 | Ga0105245_11127440 | 3300009098 | Bacteria | 831 |
| 107 | Ga0105247_10106416 | 3300009101 | Bacteria | 1799 |
| 108 | Ga0105247_10138537 | 3300009101 | Bacteria | 1592 |
| 109 | Ga0114129_10005101 | 3300009147 | Bacteria | 18497 |
| 110 | Ga0114129_10864743 | 3300009147 | Bacteria | 1148 |
| 111 | Ga0114129_12905855 | 3300009147 | Unclassified | 566 |
| 112 | Ga0114129_13318815 | 3300009147 | Unclassified | 520 |
| 113 | Ga0105243_10652526 | 3300009148 | Bacteria | 1020 |
| 114 | Ga0105243_11438064 | 3300009148 | Unclassified | 711 |
| 115 | Ga0105242_10804669 | 3300009176 | Unclassified | 931 |
| 116 | Ga0105242_10826239 | 3300009176 | Bacteria | 920 |
| 117 | Ga0105242_11622380 | 3300009176 | Unclassified | 681 |
| 118 | Ga0105242_12215770 | 3300009176 | Bacteria | 595 |
| 119 | Ga0105248_10015876 | 3300009177 | Bacteria | 8297 |
| 120 | Ga0105248_10817424 | 3300009177 | Unclassified | 1052 |
| 121 | Ga0105248_10946085 | 3300009177 | Bacteria | 973 |
| 122 | Ga0105238_10664902 | 3300009551 | Bacteria | 1052 |
| 123 | Ga0105238_11282561 | 3300009551 | Unclassified | 758 |
| 124 | Ga0105249_10108236 | 3300009553 | Bacteria | 2624 |
| 125 | Ga0105249_10667680 | 3300009553 | Bacteria | 1098 |
| 126 | Ga0105249_11492037 | 3300009553 | Bacteria | 748 |
| 127 | Ga0105249_12239715 | 3300009553 | Bacteria | 619 |
| 128 | Ga0105239_10237933 | 3300010375 | Bacteria | 2044 |
| 129 | Ga0105239_12411293 | 3300010375 | Bacteria | 613 |
| 130 | Ga0105239_13119832 | 3300010375 | Unclassified | 540 |
| 131 | Ga0105246_10058522 | 3300011119 | Bacteria | 2670 |
| 132 | Ga0105246_10288340 | 3300011119 | Bacteria | 1320 |
| 133 | Ga0157378_10476722 | 3300013297 | Bacteria | 1243 |
| 134 | Ga0157378_10725003 | 3300013297 | Unclassified | 1015 |
| 135 | Ga0157378_11226122 | 3300013297 | Bacteria | 790 |
| 136 | Ga0163162_10031609 | 3300013306 | Bacteria | 5251 |
| 137 | Ga0163162_10214916 | 3300013306 | Bacteria | 2053 |
| 138 | Ga0163162_10336297 | 3300013306 | Bacteria | 1642 |
| 139 | Ga0163162_13488752 | 3300013306 | Unclassified | 500 |
| 140 | Ga0157375_10035185 | 3300013308 | Bacteria | 4779 |
| 141 | Ga0157375_11904439 | 3300013308 | Unclassified | 706 |
| 142 | Ga0157375_12462013 | 3300013308 | Bacteria | 621 |
| 143 | Ga0163163_10002186 | 3300014325 | Bacteria | 16467 |
| 144 | Ga0163163_10068555 | 3300014325 | Bacteria | 3529 |
| 145 | Ga0163163_10077199 | 3300014325 | Bacteria | 3326 |
| 146 | Ga0157380_10370769 | 3300014326 | Bacteria | 1347 |
| 147 | Ga0157380_11546579 | 3300014326 | Unclassified | 718 |
| 148 | Ga0157380_12573056 | 3300014326 | Bacteria | 575 |
| 149 | Ga0157377_10137392 | 3300014745 | Bacteria | 1499 |
| 150 | Ga0157379_10017694 | 3300014968 | Bacteria | 6278 |
| 151 | Ga0157379_10108231 | 3300014968 | Bacteria | 2495 |
| 152 | Ga0157379_10503509 | 3300014968 | Bacteria | 1123 |
| 153 | Ga0157379_10540219 | 3300014968 | Bacteria | 1084 |
| 154 | Ga0157376_10162692 | 3300014969 | Bacteria | 2025 |
| 155 | Ga0209758_1000382 | 3300025297 | Bacteria | 76653 |
| 156 | Ga0209758_1085542 | 3300025297 | Bacteria | 939 |
| 157 | Ga0207697_10016668 | 3300025315 | Bacteria | 3027 |
| 158 | Ga0207710_10203262 | 3300025900 | Unclassified | 979 |
| 159 | Ga0207688_10435040 | 3300025901 | Bacteria | 816 |
| 160 | Ga0207685_10156257 | 3300025905 | Bacteria | 1037 |
| 161 | Ga0207699_10198601 | 3300025906 | Bacteria | 1358 |
| 162 | Ga0207699_10585261 | 3300025906 | Unclassified | 812 |
| 163 | Ga0207645_10038182 | 3300025907 | Bacteria | 3080 |
| 164 | Ga0207707_11245078 | 3300025912 | Bacteria | 600 |
| 165 | Ga0207695_10770129 | 3300025913 | Bacteria | 843 |
| 166 | Ga0207693_10096155 | 3300025915 | Bacteria | 2322 |
| 167 | Ga0207693_10493117 | 3300025915 | Unclassified | 956 |
| 168 | Ga0207663_10141889 | 3300025916 | Bacteria | 1674 |
| 169 | Ga0207660_10894409 | 3300025917 | Unclassified | 725 |
| 170 | Ga0207652_11165449 | 3300025921 | Bacteria | 672 |
| 171 | Ga0207681_10100813 | 3300025923 | Bacteria | 2082 |
| 172 | Ga0207694_10324354 | 3300025924 | Bacteria | 1271 |
| 173 | Ga0207650_10043607 | 3300025925 | Bacteria | 3293 |
| 174 | Ga0207659_10321386 | 3300025926 | Unclassified | 1277 |
| 175 | Ga0207700_10415987 | 3300025928 | Bacteria | 1180 |
| 176 | Ga0207664_10276028 | 3300025929 | Bacteria | 1474 |
| 177 | Ga0207690_10149735 | 3300025932 | Bacteria | 1729 |
| 178 | Ga0207706_10045969 | 3300025933 | Bacteria | 3866 |
| 179 | Ga0207686_10188493 | 3300025934 | Bacteria | 1468 |
| 180 | Ga0207686_10672519 | 3300025934 | Bacteria | 821 |
| 181 | Ga0207670_10002860 | 3300025936 | Bacteria | 9110 |
| 182 | Ga0207669_10634953 | 3300025937 | Bacteria | 872 |
| 183 | Ga0207704_10088038 | 3300025938 | Bacteria | 2030 |
| 184 | Ga0207665_10129934 | 3300025939 | Bacteria | 1787 |
| 185 | Ga0207665_10893079 | 3300025939 | Unclassified | 705 |
| 186 | Ga0207711_10009020 | 3300025941 | Bacteria | 8337 |
| 187 | Ga0207711_10686113 | 3300025941 | Bacteria | 955 |
| 188 | Ga0207661_10173788 | 3300025944 | Bacteria | 1877 |
| 189 | Ga0207679_10022390 | 3300025945 | Bacteria | 4302 |
| 190 | Ga0207679_10203844 | 3300025945 | Bacteria | 1654 |
| 191 | Ga0207679_10218119 | 3300025945 | Bacteria | 1604 |
| 192 | Ga0207712_10414302 | 3300025961 | Bacteria | 1135 |
| 193 | Ga0207712_10761707 | 3300025961 | Bacteria | 849 |
| 194 | Ga0207658_10651126 | 3300025986 | Bacteria | 950 |
| 195 | Ga0207677_11076753 | 3300026023 | Bacteria | 732 |
| 196 | Ga0207703_10362637 | 3300026035 | Bacteria | 1337 |
| 197 | Ga0207639_10402883 | 3300026041 | Bacteria | 1233 |
| 198 | Ga0207678_10230815 | 3300026067 | Bacteria | 1585 |
| 199 | Ga0207708_11275934 | 3300026075 | Bacteria | 643 |
| 200 | Ga0207641_10413121 | 3300026088 | Bacteria | 1298 |
| 201 | Ga0207648_10273227 | 3300026089 | Bacteria | 1510 |
| 202 | Ga0207676_10016782 | 3300026095 | Bacteria | 5301 |
| 203 | Ga0207676_10702018 | 3300026095 | Bacteria | 980 |
| 204 | Ga0207675_100335249 | 3300026118 | Bacteria | 1479 |
| 205 | Ga0207698_10529503 | 3300026142 | Bacteria | 1151 |
| 206 | Ga0207698_10658454 | 3300026142 | Bacteria | 1038 |
| 207 | Ga0207428_10500372 | 3300027907 | Bacteria | 883 |
| 208 | Ga0268266_10235478 | 3300028379 | Bacteria | 1688 |
| 209 | Ga0268266_10604851 | 3300028379 | Bacteria | 1053 |
| 210 | Ga0268266_10753863 | 3300028379 | Bacteria | 940 |
| 211 | Ga0268266_11457978 | 3300028379 | Unclassified | 660 |
| 212 | Ga0268265_10395839 | 3300028380 | Bacteria | 1275 |
| 213 | Ga0268264_10055088 | 3300028381 | Bacteria | 3323 |
| 214 | Ga0268264_12291804 | 3300028381 | Bacteria | 547 |
| 215 | Ga0307408_100162703 | 3300031548 | Bacteria | 1774 |
| 216 | Ga0307413_10206401 | 3300031824 | Bacteria | 1423 |
| 217 | Ga0307410_11385922 | 3300031852 | Bacteria | 617 |
| 218 | Ga0307410_11711769 | 3300031852 | Unclassified | 557 |
| 219 | Ga0307406_11464420 | 3300031901 | Unclassified | 600 |
| 220 | Ga0307407_10201929 | 3300031903 | Bacteria | 1333 |
| 221 | Ga0307412_10144284 | 3300031911 | Bacteria | 1748 |
| 222 | Ga0307409_100171723 | 3300031995 | Bacteria | 1909 |
| 223 | Ga0307416_102906001 | 3300032002 | Unclassified | 573 |
| 224 | Ga0307416_103398235 | 3300032002 | Unclassified | 533 |
| 225 | Ga0307416_103692198 | 3300032002 | Unclassified | 512 |
| 226 | Ga0307411_10174206 | 3300032005 | Bacteria | 1626 |
| 227 | Ga0307411_10393369 | 3300032005 | Bacteria | 1144 |
| 228 | Ga0307415_101681261 | 3300032126 | Unclassified | 612 |
| 229 | Ga0373930_0001772 | 3300034816 | Bacteria | 3278 |
| 230 | Ga0373930_0060129 | 3300034816 | Bacteria | 846 |
| 231 | Ga0373938_0068493 | 3300034957 | Unclassified | 844 |
| 232 | Ga0373938_0082649 | 3300034957 | Unclassified | 784 |
| 233 | Ga0373928_0009951 | 3300035084 | Bacteria | 1863 |
| 234 | Ga0373940_0078785 | 3300035088 | Unclassified | 971 |
| 235 | Ga0373940_0364701 | 3300035088 | Unclassified | 509 |
| 236 | Ga0373951_0074261 | 3300035091 | Unclassified | 871 |
| 237 | Ga0373952_0004860 | 3300035092 | Bacteria | 2444 |
| 238 | Ga0373932_0058705 | 3300035112 | Unclassified | 1163 |
| 239 | Ga0373932_0336758 | 3300035112 | Unclassified | 571 |
| 240 | Ga0373932_0395447 | 3300035112 | Unclassified | 534 |
| 241 | Ga0373939_0004798 | 3300035114 | Bacteria | 3205 |
| 242 | Ga0373939_0039468 | 3300035114 | Unclassified | 1413 |
| 243 | Ga0373941_0094543 | 3300035115 | Unclassified | 1031 |
| 244 | Ga0373941_0425242 | 3300035115 | Bacteria | 553 |
| 245 | Ga0373960_0003526 | 3300035121 | Bacteria | 3546 |
| 246 | Ga0373942_0003945 | 3300035207 | Bacteria | 3464 |
| 247 | Ga0373961_0007220 | 3300035241 | Bacteria | 2685 |
| 248 | Ga0373961_0014770 | 3300035241 | Bacteria | 1987 |
| 249 | Ga0373931_0000416 | 3300035691 | Bacteria | 17409 |
| 250 | Ga0373931_0001658 | 3300035691 | Bacteria | 9635 |
| 251 | Ga0373931_0434591 | 3300035691 | Bacteria | 837 |
| 252 | Ga0373937_1323306 | 3300036401 | Bacteria | 668 |
| 253 | Ga0373925_0624939 | 3300037068 | Bacteria | 887 |
| 254 | Ga0439453_0049969 | 3300041408 | Bacteria | 843 |
| 255 | Ga0451798_0387576 | 3300041458 | Unclassified | 699 |
| 256 | Ga0450908_035710 | 3300042184 | Bacteria | 862 |
| 257 | Ga0439435_0026640 | 3300042436 | Bacteria | 1541 |
| 258 | Ga0466963_0186969 | 3300044694 | Unclassified | 1447 |
| 259 | Ga0495629_0020340 | 3300046459 | Bacteria | 4741 |
| 260 | Ga0495638_0047138 | 3300046460 | Bacteria | 2703 |
| 261 | Ga0495582_0245616 | 3300046473 | Bacteria | 1026 |
| 262 | Ga0495594_0140888 | 3300046499 | Bacteria | 1368 |
| 263 | Ga0495665_0544835 | 3300046531 | Bacteria | 583 |
| 264 | Ga0495598_0104095 | 3300046537 | Unclassified | 943 |
| 265 | Ga0495674_0272691 | 3300047319 | Bacteria | 1388 |
| 266 | Ga0495672_0450892 | 3300047320 | Unclassified | 580 |
| 267 | Ga0495685_008495 | 3300047447 | Bacteria | 3412 |
| 268 | Ga0495593_0174860 | 3300047673 | Bacteria | 1082 |
| 269 | Ga0495615_0042932 | 3300048090 | Bacteria | 1136 |
| 270 | Ga0496100_0000936 | 3300048903 | Bacteria | 13936 |
| 271 | Ga0496100_0528127 | 3300048903 | Bacteria | 911 |
| 272 | Ga0496101_0001406 | 3300048904 | Bacteria | 14407 |
| 273 | Ga0496101_0050852 | 3300048904 | Bacteria | 2985 |
| 274 | Ga0496101_0063969 | 3300048904 | Bacteria | 2679 |
| 275 | Ga0496101_1161860 | 3300048904 | Bacteria | 605 |
| 276 | Ga0496102_0024611 | 3300048905 | Bacteria | 5353 |
| 277 | Ga0496102_0459249 | 3300048905 | Bacteria | 1194 |
| 278 | Ga0496102_1795191 | 3300048905 | Bacteria | 530 |
| 279 | Ga0496103_0053335 | 3300048906 | Bacteria | 2506 |
| 280 | Ga0496103_0166366 | 3300048906 | Bacteria | 1415 |
| 281 | Ga0496103_0388732 | 3300048906 | Bacteria | 896 |
| 282 | Ga0496104_0004098 | 3300048907 | Bacteria | 12645 |
| 283 | Ga0496104_0022209 | 3300048907 | Bacteria | 5827 |
| 284 | Ga0496104_0025211 | 3300048907 | Bacteria | 5480 |
| 285 | Ga0496105_0002256 | 3300048908 | Bacteria | 13967 |
| 286 | Ga0496105_0022327 | 3300048908 | Bacteria | 5125 |
| 287 | Ga0496105_0022512 | 3300048908 | Bacteria | 5104 |
| 288 | Ga0496106_0006550 | 3300048909 | Bacteria | 8624 |
| 289 | Ga0496106_0024691 | 3300048909 | Bacteria | 4470 |
| 290 | Ga0496106_0129950 | 3300048909 | Bacteria | 1975 |
| 291 | Ga0496107_0010746 | 3300048910 | Bacteria | 6367 |
| 292 | Ga0496107_0568825 | 3300048910 | Bacteria | 839 |
| 293 | Ga0496107_1037499 | 3300048910 | Unclassified | 594 |
| 294 | Ga0496108_0000400 | 3300048911 | Bacteria | 35840 |
| 295 | Ga0496108_0096169 | 3300048911 | Bacteria | 2522 |
| 296 | Ga0496109_0011907 | 3300048912 | Bacteria | 7488 |
| 297 | Ga0496109_0044007 | 3300048912 | Bacteria | 4049 |
| 298 | Ga0496109_0112696 | 3300048912 | Bacteria | 2529 |
| 299 | Ga0496109_0150811 | 3300048912 | Bacteria | 2176 |
| 300 | Ga0496110_0025649 | 3300048913 | Bacteria | 5040 |
| 301 | Ga0496110_0121068 | 3300048913 | Bacteria | 2357 |
| 302 | Ga0496110_0368659 | 3300048913 | Bacteria | 1308 |
| 303 | Ga0496110_0968206 | 3300048913 | Bacteria | 758 |
| 304 | Ga0496111_0009679 | 3300048914 | Bacteria | 6442 |
| 305 | Ga0496111_0460275 | 3300048914 | Bacteria | 938 |
| 306 | Ga0496112_0019174 | 3300048915 | Bacteria | 6450 |
| 307 | Ga0496112_0038742 | 3300048915 | Bacteria | 4656 |
| 308 | Ga0496112_0232200 | 3300048915 | Bacteria | 1799 |
| 309 | Ga0496113_0008141 | 3300048916 | Bacteria | 6806 |
| 310 | Ga0496113_0047155 | 3300048916 | Bacteria | 3202 |
| 311 | Ga0496113_0072319 | 3300048916 | Bacteria | 2624 |
| 312 | Ga0496113_0119420 | 3300048916 | Bacteria | 2060 |
| 313 | Ga0496114_0194429 | 3300048917 | Bacteria | 1775 |
| 314 | Ga0496115_0003984 | 3300048918 | Bacteria | 10651 |
| 315 | Ga0496115_0276554 | 3300048918 | Bacteria | 1379 |
| 316 | Ga0496115_0337768 | 3300048918 | Bacteria | 1230 |
| 317 | Ga0501031_0034456 | 3300049568 | Bacteria | 3304 |
| 318 | Ga0501032_0019142 | 3300049569 | Bacteria | 4790 |
| 319 | Ga0501032_0541316 | 3300049569 | Bacteria | 743 |
| 320 | Ga0501032_0653528 | 3300049569 | Unclassified | 668 |
| 321 | Ga0501033_0062034 | 3300049570 | Bacteria | 2753 |
| 322 | Ga0501034_0000438 | 3300049571 | Bacteria | 68973 |
| 323 | Ga0501034_0012727 | 3300049571 | Bacteria | 8677 |
| 324 | Ga0501034_0139101 | 3300049571 | Bacteria | 2408 |
| 325 | Ga0501034_0551739 | 3300049571 | Bacteria | 1062 |
| 326 | Ga0501036_0059398 | 3300049572 | Bacteria | 3240 |
| 327 | Ga0501036_0093151 | 3300049572 | Bacteria | 2545 |
| 328 | Ga0501036_0259865 | 3300049572 | Bacteria | 1455 |
| 329 | Ga0501036_0298105 | 3300049572 | Bacteria | 1349 |
| 330 | Ga0501037_0332507 | 3300049573 | Bacteria | 1050 |
| 331 | Ga0501038_0019505 | 3300049574 | Bacteria | 6111 |
| 332 | Ga0501038_0060337 | 3300049574 | Bacteria | 3246 |
| 333 | Ga0501039_0073166 | 3300049575 | Bacteria | 2663 |
| 334 | Ga0501039_0128901 | 3300049575 | Bacteria | 1985 |
| 335 | Ga0501040_0163574 | 3300049576 | Bacteria | 1574 |
| 336 | Ga0501040_0771937 | 3300049576 | Unclassified | 695 |
| 337 | Ga0501041_0733254 | 3300049577 | Unclassified | 633 |
| 338 | Ga0501042_0427343 | 3300049578 | Bacteria | 960 |
| 339 | Ga0501043_0060077 | 3300049579 | Bacteria | 2983 |
| 340 | Ga0501043_0712314 | 3300049579 | Bacteria | 732 |
| 341 | Ga0501046_0064018 | 3300049580 | Bacteria | 2871 |
| 342 | Ga0501046_0649410 | 3300049580 | Bacteria | 746 |
| 343 | Ga0501046_1030074 | 3300049580 | Unclassified | 571 |
| 344 | Ga0501047_0061534 | 3300049581 | Bacteria | 3622 |
| 345 | Ga0501047_0126186 | 3300049581 | Bacteria | 2439 |
| 346 | Ga0501047_0477354 | 3300049581 | Unclassified | 1075 |
| 347 | Ga0501048_0128859 | 3300049582 | Bacteria | 1789 |
| 348 | Ga0501068_0106149 | 3300049584 | Unclassified | 1744 |
| 349 | Ga0501068_0481632 | 3300049584 | Unclassified | 804 |
| 350 | Ga0501070_0034993 | 3300049586 | Bacteria | 4198 |
| 351 | Ga0501070_0190786 | 3300049586 | Bacteria | 1684 |
| 352 | Ga0501070_0208451 | 3300049586 | Bacteria | 1605 |
| 353 | Ga0501071_0094631 | 3300049587 | Bacteria | 2198 |
| 354 | Ga0501071_0446367 | 3300049587 | Unclassified | 990 |
| 355 | Ga0501071_0833882 | 3300049587 | Bacteria | 711 |
| 356 | Ga0501072_1042102 | 3300049588 | Unclassified | 637 |
| 357 | Ga0501073_0574595 | 3300049589 | Unclassified | 779 |
| 358 | Ga0501073_0734990 | 3300049589 | Bacteria | 681 |
| 359 | Ga0501073_0923900 | 3300049589 | Bacteria | 601 |
| 360 | Ga0501074_0675638 | 3300049590 | Unclassified | 729 |
| 361 | Ga0501074_1198278 | 3300049590 | Unclassified | 533 |
| 362 | Ga0501075_0245664 | 3300049591 | Bacteria | 1364 |
| 363 | Ga0501076_0144193 | 3300049592 | Bacteria | 1936 |
| 364 | Ga0501076_0194643 | 3300049592 | Bacteria | 1655 |
| 365 | Ga0501076_0827240 | 3300049592 | Unclassified | 764 |
| 366 | Ga0501077_0326473 | 3300049593 | Bacteria | 978 |
| 367 | Ga0501077_0367783 | 3300049593 | Unclassified | 918 |
| 368 | Ga0501077_0814164 | 3300049593 | Unclassified | 601 |
| 369 | Ga0501077_0937628 | 3300049593 | Bacteria | 557 |
| 370 | Ga0501079_1079954 | 3300049741 | Unclassified | 632 |
| 371 | Ga0501079_1113660 | 3300049741 | Bacteria | 622 |
| 372 | Ga0501080_0579954 | 3300049742 | Bacteria | 997 |
| 373 | Ga0501081_0407604 | 3300049743 | Bacteria | 1007 |
| 374 | Ga0501081_0729937 | 3300049743 | Bacteria | 744 |
| 375 | Ga0501083_0852746 | 3300049744 | Bacteria | 593 |
| 376 | Ga0501083_1101642 | 3300049744 | Bacteria | 517 |
| 377 | Ga0501035_0272415 | 3300049822 | Bacteria | 1432 |
| 378 | Ga0501035_0842909 | 3300049822 | Bacteria | 730 |
| 379 | Ga0501044_0001788 | 3300049823 | Bacteria | 25106 |
| 380 | Ga0501044_0072138 | 3300049823 | Bacteria | 3511 |
| 381 | Ga0501044_0264173 | 3300049823 | Bacteria | 1659 |
| 382 | Ga0501044_0589512 | 3300049823 | Bacteria | 1005 |
| 383 | Ga0501044_1011973 | 3300049823 | Bacteria | 702 |
| 384 | Ga0501045_0176950 | 3300049824 | Bacteria | 1589 |
| 385 | nmdc:mga03683_189045_c1 | 3300050489 | Bacteria | 942 |
| 386 | nmdc:mga03683_573327_c1 | 3300050489 | Unclassified | 551 |
| 387 | nmdc:mga00v17_159912_c1 | 3300050491 | Bacteria | 984 |
| 388 | nmdc:mga0yw44_1464_c1 | 3300050492 | Bacteria | 9398 |
| 389 | nmdc:mga0k408_17338_c1 | 3300050493 | Bacteria | 4012 |
| 390 | nmdc:mga0k408_402919_c1 | 3300050493 | Unclassified | 814 |
| 391 | nmdc:mga0k408_79459_c1 | 3300050493 | Bacteria | 1919 |
| 392 | nmdc:mga06z11_132390_c1 | 3300050494 | Bacteria | 1401 |
| 393 | nmdc:mga06z11_167067_c1 | 3300050494 | Bacteria | 1261 |
| 394 | nmdc:mga06z11_44196_c1 | 3300050494 | Bacteria | 2245 |
| 395 | nmdc:mga07m45_41227_c1 | 3300050496 | Bacteria | 2584 |
| 396 | nmdc:mga05p37_1314121_c1 | 3300050507 | Unclassified | 736 |
| 397 | nmdc:mga05p37_56610_c1 | 3300050507 | Bacteria | 4828 |
| 398 | nmdc:mga05p37_766057_c1 | 3300050507 | Bacteria | 1061 |
| 399 | nmdc:mga09592_113584_c1 | 3300050508 | Bacteria | 2324 |
| 400 | nmdc:mga09592_290244_c1 | 3300050508 | Bacteria | 1418 |
| 401 | nmdc:mga0qj67_315378_c1 | 3300050509 | Bacteria | 1266 |
| 402 | nmdc:mga0qj67_910884_c1 | 3300050509 | Bacteria | 692 |
| 403 | nmdc:mga06r32_1502710_c1 | 3300050510 | Unclassified | 614 |
| 404 | nmdc:mga08y16_111918_c1 | 3300050511 | Bacteria | 2842 |
| 405 | nmdc:mga08y16_456580_c1 | 3300050511 | Bacteria | 1302 |
| 406 | nmdc:mga08y16_832825_c1 | 3300050511 | Bacteria | 913 |
| 407 | nmdc:mga0sz30_209632_c1 | 3300050516 | Bacteria | 866 |
| 408 | nmdc:mga0sz30_275031_c1 | 3300050516 | Bacteria | 750 |
| 409 | Ga0495619_0092429 | 3300053085 | Bacteria | 2049 |
| 410 | Ga0500646_0296409 | 3300053090 | Bacteria | 579 |
| 411 | Ga0500583_0218254 | 3300053092 | Bacteria | 946 |
| 412 | Ga0500651_0200485 | 3300053093 | Bacteria | 1178 |
| 413 | Ga0500593_016715 | 3300053117 | Bacteria | 3181 |
| 414 | Ga0500595_137993 | 3300053119 | Unclassified | 684 |
| 415 | Ga0500628_091315 | 3300053129 | Bacteria | 794 |
| 416 | Ga0500642_0143398 | 3300053130 | Bacteria | 1121 |
| 417 | Ga0500604_0012339 | 3300053151 | Bacteria | 2307 |
| 418 | Ga0500616_0302576 | 3300053153 | Unclassified | 664 |
| 419 | Ga0500627_0072895 | 3300053158 | Bacteria | 1523 |
| 420 | Ga0500636_0263157 | 3300053177 | Bacteria | 872 |
| 421 | Ga0500611_015228 | 3300053727 | Bacteria | 1359 |
| 422 | Ga0501084_0115123 | 3300054114 | Bacteria | 2260 |
| 423 | Ga0501084_0266029 | 3300054114 | Bacteria | 1448 |
| 424 | Ga0501084_0468506 | 3300054114 | Bacteria | 1065 |
| 425 | Ga0587115_053055 | 3300059626 | Unclassified | 663 |
| 426 | Ga0587079_002805 | 3300059647 | Bacteria | 2192 |
| 427 | Ga0501082_0002950 | 3300060353 | Bacteria | 14841 |
| 428 | Ga0501082_0176758 | 3300060353 | Bacteria | 1856 |
| 429 | Ga0501082_0346979 | 3300060353 | Bacteria | 1294 |
| 430 | Ga0501082_0377295 | 3300060353 | Bacteria | 1237 |
| 431 | Ga0501082_1333953 | 3300060353 | Unclassified | 627 |
| 432 | Ga0501082_1514314 | 3300060353 | Unclassified | 586 |
| 433 | Ga0530510_0031201 | 3300061734 | Bacteria | 3832 |
| 434 | Ga0530510_0042817 | 3300061734 | Bacteria | 3271 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100558137 | Ga0070671_1005581372 | 74 |
| 2 | 3300009101 | Ga0105247_10138537 | Ga0105247_101385373 | 74 |
| 3 | 3300009176 | Ga0105242_11622380 | Ga0105242_116223802 | 74 |
| 4 | 3300009177 | Ga0105248_10817424 | Ga0105248_108174241 | 74 |
| 5 | 3300009553 | Ga0105249_10108236 | Ga0105249_101082362 | 74 |
| 6 | 3300011119 | Ga0105246_10288340 | Ga0105246_102883402 | 74 |
| 7 | 3300013297 | Ga0157378_11226122 | Ga0157378_112261222 | 74 |
| 8 | 3300013306 | Ga0163162_10336297 | Ga0163162_103362973 | 74 |
| 9 | 3300013308 | Ga0157375_10035185 | Ga0157375_100351853 | 74 |
| 10 | 3300014968 | Ga0157379_10017694 | Ga0157379_100176943 | 74 |
| 11 | 3300005439 | Ga0070711_100301753 | Ga0070711_1003017532 | 75 |
| 12 | 3300006175 | Ga0070712_100543692 | Ga0070712_1005436922 | 75 |
| 13 | 3300007076 | Ga0075435_100295458 | Ga0075435_1002954582 | 75 |
| 14 | 3300009094 | Ga0111539_10417054 | Ga0111539_104170542 | 75 |
| 15 | 3300009098 | Ga0105245_10039626 | Ga0105245_100396262 | 75 |
| 16 | 3300010375 | Ga0105239_13119832 | Ga0105239_131198321 | 75 |
| 17 | 3300013306 | Ga0163162_13488752 | Ga0163162_134887522 | 75 |
| 18 | 3300014325 | Ga0163163_10077199 | Ga0163163_100771993 | 75 |
| 19 | 3300014968 | Ga0157379_10503509 | Ga0157379_105035093 | 75 |
| 20 | 3300014969 | Ga0157376_10162692 | Ga0157376_101626923 | 75 |
| 21 | 3300025906 | Ga0207699_10585261 | Ga0207699_105852611 | 75 |
| 22 | 3300025915 | Ga0207693_10493117 | Ga0207693_104931172 | 75 |
| 23 | 3300025945 | Ga0207679_10203844 | Ga0207679_102038442 | 75 |
| 24 | 3300048903 | Ga0496100_0528127 | Ga0496100_0528127_524_865 | 75 |
| 25 | 3300048904 | Ga0496101_0050852 | Ga0496101_0050852_1315_1656 | 75 |
| 26 | 3300048906 | Ga0496103_0166366 | Ga0496103_0166366_92_433 | 75 |
| 27 | 3300048907 | Ga0496104_0004098 | Ga0496104_0004098_10429_10770 | 75 |
| 28 | 3300048908 | Ga0496105_0022327 | Ga0496105_0022327_3664_4005 | 75 |
| 29 | 3300048909 | Ga0496106_0129950 | Ga0496106_0129950_1457_1798 | 75 |
| 30 | 3300048910 | Ga0496107_1037499 | Ga0496107_1037499_239_580 | 75 |
| 31 | 3300048912 | Ga0496109_0112696 | Ga0496109_0112696_513_854 | 75 |
| 32 | 3300048913 | Ga0496110_0968206 | Ga0496110_0968206_11_352 | 75 |
| 33 | 3300048915 | Ga0496112_0232200 | Ga0496112_0232200_1392_1733 | 75 |
| 34 | 3300048916 | Ga0496113_0047155 | Ga0496113_0047155_1858_2199 | 75 |
| 35 | 3300048918 | Ga0496115_0337768 | Ga0496115_0337768_351_692 | 75 |
| 36 | 3300006038 | Ga0075365_10024069 | Ga0075365_100240693 | 77 |
| 37 | 3300006178 | Ga0075367_10222421 | Ga0075367_102224213 | 77 |
| 38 | 3300006186 | Ga0075369_10167526 | Ga0075369_101675262 | 77 |
| 39 | 3300006844 | Ga0075428_100392542 | Ga0075428_1003925423 | 77 |
| 40 | 3300006846 | Ga0075430_100169947 | Ga0075430_1001699473 | 77 |
| 41 | 3300006847 | Ga0075431_100019442 | Ga0075431_1000194423 | 77 |
| 42 | 3300009094 | Ga0111539_13496701 | Ga0111539_134967012 | 77 |
| 43 | 3300049742 | Ga0501080_0579954 | Ga0501080_0579954_381_686 | 77 |
| 44 | 3300049743 | Ga0501081_0729937 | Ga0501081_0729937_50_355 | 77 |
| 45 | 3300050492 | nmdc:mga0yw44_1464_c1 | nmdc:mga0yw44_1464_c1_6734_7072 | 77 |
| 46 | 3300050494 | nmdc:mga06z11_167067_c1 | nmdc:mga06z11_167067_c1_172_477 | 77 |
| 47 | 3300050509 | nmdc:mga0qj67_315378_c1 | nmdc:mga0qj67_315378_c1_827_1165 | 77 |
| 48 | 3300050511 | nmdc:mga08y16_832825_c1 | nmdc:mga08y16_832825_c1_283_621 | 77 |
| 49 | 3300050516 | nmdc:mga0sz30_275031_c1 | nmdc:mga0sz30_275031_c1_298_636 | 77 |
| 50 | 3300061734 | Ga0530510_0042817 | Ga0530510_0042817_351_656 | 77 |
| 51 | 3300025297 | Ga0209758_1000382 | Ga0209758_100038271 | 78 |
| 52 | 3300025297 | Ga0209758_1085542 | Ga0209758_10855422 | 78 |
| 53 | 3300005937 | Ga0081455_10017091 | Ga0081455_100170912 | 79 |
| 54 | 3300006177 | Ga0075362_10104793 | Ga0075362_101047931 | 79 |
| 55 | 3300006844 | Ga0075428_102641314 | Ga0075428_1026413141 | 79 |
| 56 | 3300006847 | Ga0075431_101554903 | Ga0075431_1015549031 | 79 |
| 57 | 3300009147 | Ga0114129_13318815 | Ga0114129_133188151 | 79 |
| 58 | 3300050489 | nmdc:mga03683_573327_c1 | nmdc:mga03683_573327_c1_160_498 | 79 |
| 59 | 3300050507 | nmdc:mga05p37_766057_c1 | nmdc:mga05p37_766057_c1_383_721 | 79 |
| 60 | 3300050508 | nmdc:mga09592_113584_c1 | nmdc:mga09592_113584_c1_732_1070 | 79 |
| 61 | 3300050510 | nmdc:mga06r32_1502710_c1 | nmdc:mga06r32_1502710_c1_212_550 | 79 |
| 62 | 3300005338 | Ga0068868_100319293 | Ga0068868_1003192932 | 81 |
| 63 | 3300005458 | Ga0070681_10169665 | Ga0070681_101696653 | 81 |
| 64 | 3300005530 | Ga0070679_101828358 | Ga0070679_1018283581 | 81 |
| 65 | 3300005547 | Ga0070693_100018816 | Ga0070693_1000188164 | 81 |
| 66 | 3300025912 | Ga0207707_11245078 | Ga0207707_112450782 | 81 |
| 67 | 3300050496 | nmdc:mga07m45_41227_c1 | nmdc:mga07m45_41227_c1_1041_1382 | 83 |
| 68 | 3300006177 | Ga0075362_10613431 | Ga0075362_106134311 | 86 |
| 69 | 3300053090 | Ga0500646_0296409 | Ga0500646_0296409_69_407 | 88 |
| 70 | 3300005347 | Ga0070668_102093562 | Ga0070668_1020935622 | 92 |
| 71 | 3300005548 | Ga0070665_100847863 | Ga0070665_1008478632 | 92 |
| 72 | 3300028379 | Ga0268266_10753863 | Ga0268266_107538632 | 92 |
| 73 | 3300005614 | Ga0068856_101277859 | Ga0068856_1012778592 | 93 |
| 74 | 3300005337 | Ga0070682_100269143 | Ga0070682_1002691433 | 96 |
| 75 | 3300005548 | Ga0070665_101983930 | Ga0070665_1019839301 | 96 |
| 76 | 3300006844 | Ga0075428_101367989 | Ga0075428_1013679892 | 96 |
| 77 | 3300009094 | Ga0111539_10102048 | Ga0111539_101020483 | 96 |
| 78 | 3300028379 | Ga0268266_11457978 | Ga0268266_114579782 | 96 |
| 79 | 3300031852 | Ga0307410_11385922 | Ga0307410_113859222 | 96 |
| 80 | 3300049590 | Ga0501074_1198278 | Ga0501074_1198278_194_484 | 96 |
| 81 | 3300050511 | nmdc:mga08y16_111918_c1 | nmdc:mga08y16_111918_c1_970_1260 | 96 |
| 82 | 3300005328 | Ga0070676_10085821 | Ga0070676_100858213 | 97 |
| 83 | 3300005329 | Ga0070683_100100630 | Ga0070683_1001006303 | 97 |
| 84 | 3300005329 | Ga0070683_101431887 | Ga0070683_1014318872 | 97 |
| 85 | 3300005330 | Ga0070690_100003935 | Ga0070690_1000039354 | 97 |
| 86 | 3300005330 | Ga0070690_101644547 | Ga0070690_1016445471 | 97 |
| 87 | 3300005331 | Ga0070670_100003295 | Ga0070670_1000032952 | 97 |
| 88 | 3300005333 | Ga0070677_10155434 | Ga0070677_101554341 | 97 |
| 89 | 3300005337 | Ga0070682_100586728 | Ga0070682_1005867282 | 97 |
| 90 | 3300005338 | Ga0068868_101635846 | Ga0068868_1016358461 | 97 |
| 91 | 3300005341 | Ga0070691_10082708 | Ga0070691_100827081 | 97 |
| 92 | 3300005347 | Ga0070668_100609731 | Ga0070668_1006097312 | 97 |
| 93 | 3300005353 | Ga0070669_100049936 | Ga0070669_1000499363 | 97 |
| 94 | 3300005354 | Ga0070675_101581860 | Ga0070675_1015818602 | 97 |
| 95 | 3300005355 | Ga0070671_100116770 | Ga0070671_1001167703 | 97 |
| 96 | 3300005356 | Ga0070674_100851185 | Ga0070674_1008511852 | 97 |
| 97 | 3300005356 | Ga0070674_101125808 | Ga0070674_1011258082 | 97 |
| 98 | 3300005356 | Ga0070674_101145005 | Ga0070674_1011450052 | 97 |
| 99 | 3300005365 | Ga0070688_100006635 | Ga0070688_1000066354 | 97 |
| 100 | 3300005366 | Ga0070659_100088000 | Ga0070659_1000880004 | 97 |
| 101 | 3300005366 | Ga0070659_100957305 | Ga0070659_1009573051 | 97 |
| 102 | 3300005367 | Ga0070667_100464223 | Ga0070667_1004642231 | 97 |
| 103 | 3300005435 | Ga0070714_100988387 | Ga0070714_1009883872 | 97 |
| 104 | 3300005436 | Ga0070713_101501061 | Ga0070713_1015010611 | 97 |
| 105 | 3300005436 | Ga0070713_101532963 | Ga0070713_1015329631 | 97 |
| 106 | 3300005438 | Ga0070701_10483269 | Ga0070701_104832692 | 97 |
| 107 | 3300005438 | Ga0070701_10704806 | Ga0070701_107048061 | 97 |
| 108 | 3300005439 | Ga0070711_100219863 | Ga0070711_1002198633 | 97 |
| 109 | 3300005455 | Ga0070663_100288623 | Ga0070663_1002886232 | 97 |
| 110 | 3300005456 | Ga0070678_100207795 | Ga0070678_1002077951 | 97 |
| 111 | 3300005457 | Ga0070662_100017831 | Ga0070662_1000178311 | 97 |
| 112 | 3300005459 | Ga0068867_101685772 | Ga0068867_1016857722 | 97 |
| 113 | 3300005466 | Ga0070685_10535443 | Ga0070685_105354432 | 97 |
| 114 | 3300005530 | Ga0070679_100664631 | Ga0070679_1006646312 | 97 |
| 115 | 3300005535 | Ga0070684_100397034 | Ga0070684_1003970341 | 97 |
| 116 | 3300005535 | Ga0070684_102072595 | Ga0070684_1020725951 | 97 |
| 117 | 3300005539 | Ga0068853_100184894 | Ga0068853_1001848943 | 97 |
| 118 | 3300005543 | Ga0070672_100551090 | Ga0070672_1005510903 | 97 |
| 119 | 3300005544 | Ga0070686_100388216 | Ga0070686_1003882163 | 97 |
| 120 | 3300005544 | Ga0070686_101446972 | Ga0070686_1014469721 | 97 |
| 121 | 3300005544 | Ga0070686_101484724 | Ga0070686_1014847241 | 97 |
| 122 | 3300005548 | Ga0070665_100145562 | Ga0070665_1001455623 | 97 |
| 123 | 3300005564 | Ga0070664_100128382 | Ga0070664_1001283822 | 97 |
| 124 | 3300005564 | Ga0070664_100261554 | Ga0070664_1002615541 | 97 |
| 125 | 3300005616 | Ga0068852_100432321 | Ga0068852_1004323213 | 97 |
| 126 | 3300005617 | Ga0068859_100080459 | Ga0068859_1000804593 | 97 |
| 127 | 3300005617 | Ga0068859_101007473 | Ga0068859_1010074732 | 97 |
| 128 | 3300005618 | Ga0068864_100033415 | Ga0068864_1000334153 | 97 |
| 129 | 3300005618 | Ga0068864_100586311 | Ga0068864_1005863113 | 97 |
| 130 | 3300005719 | Ga0068861_100146808 | Ga0068861_1001468083 | 97 |
| 131 | 3300005719 | Ga0068861_100833803 | Ga0068861_1008338031 | 97 |
| 132 | 3300005719 | Ga0068861_101829311 | Ga0068861_1018293111 | 97 |
| 133 | 3300005840 | Ga0068870_11111412 | Ga0068870_111114121 | 97 |
| 134 | 3300005841 | Ga0068863_100698932 | Ga0068863_1006989322 | 97 |
| 135 | 3300005842 | Ga0068858_100718291 | Ga0068858_1007182912 | 97 |
| 136 | 3300005843 | Ga0068860_102449985 | Ga0068860_1024499852 | 97 |
| 137 | 3300005844 | Ga0068862_100183626 | Ga0068862_1001836263 | 97 |
| 138 | 3300005844 | Ga0068862_101704093 | Ga0068862_1017040932 | 97 |
| 139 | 3300005937 | Ga0081455_10193131 | Ga0081455_101931312 | 97 |
| 140 | 3300005985 | Ga0081539_10305458 | Ga0081539_103054582 | 97 |
| 141 | 3300006028 | Ga0070717_10686781 | Ga0070717_106867812 | 97 |
| 142 | 3300006038 | Ga0075365_10704423 | Ga0075365_107044231 | 97 |
| 143 | 3300006177 | Ga0075362_10074238 | Ga0075362_100742382 | 97 |
| 144 | 3300006177 | Ga0075362_10435233 | Ga0075362_104352331 | 97 |
| 145 | 3300006195 | Ga0075366_10004388 | Ga0075366_100043887 | 97 |
| 146 | 3300006195 | Ga0075366_10042442 | Ga0075366_100424423 | 97 |
| 147 | 3300006844 | Ga0075428_100046994 | Ga0075428_1000469945 | 97 |
| 148 | 3300006844 | Ga0075428_101031170 | Ga0075428_1010311701 | 97 |
| 149 | 3300006871 | Ga0075434_100018214 | Ga0075434_1000182144 | 97 |
| 150 | 3300006881 | Ga0068865_100134073 | Ga0068865_1001340733 | 97 |
| 151 | 3300006931 | Ga0097620_100080459 | Ga0097620_1000804593 | 97 |
| 152 | 3300006931 | Ga0097620_101007459 | Ga0097620_1010074592 | 97 |
| 153 | 3300007788 | Ga0099795_10367487 | Ga0099795_103674871 | 97 |
| 154 | 3300009093 | Ga0105240_11045701 | Ga0105240_110457013 | 97 |
| 155 | 3300009094 | Ga0111539_10670681 | Ga0111539_106706812 | 97 |
| 156 | 3300009094 | Ga0111539_10774014 | Ga0111539_107740142 | 97 |
| 157 | 3300009094 | Ga0111539_11253236 | Ga0111539_112532362 | 97 |
| 158 | 3300009098 | Ga0105245_11127440 | Ga0105245_111274402 | 97 |
| 159 | 3300009101 | Ga0105247_10106416 | Ga0105247_101064163 | 97 |
| 160 | 3300009147 | Ga0114129_10005101 | Ga0114129_1000510115 | 97 |
| 161 | 3300009147 | Ga0114129_10864743 | Ga0114129_108647432 | 97 |
| 162 | 3300009147 | Ga0114129_12905855 | Ga0114129_129058551 | 97 |
| 163 | 3300009148 | Ga0105243_10652526 | Ga0105243_106525262 | 97 |
| 164 | 3300009148 | Ga0105243_11438064 | Ga0105243_114380642 | 97 |
| 165 | 3300009176 | Ga0105242_10804669 | Ga0105242_108046692 | 97 |
| 166 | 3300009176 | Ga0105242_10826239 | Ga0105242_108262391 | 97 |
| 167 | 3300009176 | Ga0105242_12215770 | Ga0105242_122157702 | 97 |
| 168 | 3300009177 | Ga0105248_10015876 | Ga0105248_100158766 | 97 |
| 169 | 3300009177 | Ga0105248_10946085 | Ga0105248_109460852 | 97 |
| 170 | 3300009551 | Ga0105238_10664902 | Ga0105238_106649022 | 97 |
| 171 | 3300009551 | Ga0105238_11282561 | Ga0105238_112825611 | 97 |
| 172 | 3300009553 | Ga0105249_10667680 | Ga0105249_106676802 | 97 |
| 173 | 3300009553 | Ga0105249_11492037 | Ga0105249_114920372 | 97 |
| 174 | 3300009553 | Ga0105249_12239715 | Ga0105249_122397151 | 97 |
| 175 | 3300010375 | Ga0105239_10237933 | Ga0105239_102379331 | 97 |
| 176 | 3300010375 | Ga0105239_12411293 | Ga0105239_124112932 | 97 |
| 177 | 3300011119 | Ga0105246_10058522 | Ga0105246_100585222 | 97 |
| 178 | 3300013297 | Ga0157378_10476722 | Ga0157378_104767222 | 97 |
| 179 | 3300013297 | Ga0157378_10725003 | Ga0157378_107250032 | 97 |
| 180 | 3300013306 | Ga0163162_10031609 | Ga0163162_100316095 | 97 |
| 181 | 3300013306 | Ga0163162_10214916 | Ga0163162_102149161 | 97 |
| 182 | 3300013308 | Ga0157375_11904439 | Ga0157375_119044392 | 97 |
| 183 | 3300013308 | Ga0157375_12462013 | Ga0157375_124620132 | 97 |
| 184 | 3300014325 | Ga0163163_10002186 | Ga0163163_100021867 | 97 |
| 185 | 3300014325 | Ga0163163_10068555 | Ga0163163_100685554 | 97 |
| 186 | 3300014326 | Ga0157380_10370769 | Ga0157380_103707692 | 97 |
| 187 | 3300014326 | Ga0157380_11546579 | Ga0157380_115465792 | 97 |
| 188 | 3300014326 | Ga0157380_12573056 | Ga0157380_125730561 | 97 |
| 189 | 3300014745 | Ga0157377_10137392 | Ga0157377_101373922 | 97 |
| 190 | 3300014968 | Ga0157379_10108231 | Ga0157379_101082314 | 97 |
| 191 | 3300014968 | Ga0157379_10540219 | Ga0157379_105402192 | 97 |
| 192 | 3300025315 | Ga0207697_10016668 | Ga0207697_100166683 | 97 |
| 193 | 3300025900 | Ga0207710_10203262 | Ga0207710_102032623 | 97 |
| 194 | 3300025901 | Ga0207688_10435040 | Ga0207688_104350402 | 97 |
| 195 | 3300025905 | Ga0207685_10156257 | Ga0207685_101562572 | 97 |
| 196 | 3300025906 | Ga0207699_10198601 | Ga0207699_101986012 | 97 |
| 197 | 3300025907 | Ga0207645_10038182 | Ga0207645_100381823 | 97 |
| 198 | 3300025913 | Ga0207695_10770129 | Ga0207695_107701293 | 97 |
| 199 | 3300025915 | Ga0207693_10096155 | Ga0207693_100961552 | 97 |
| 200 | 3300025916 | Ga0207663_10141889 | Ga0207663_101418893 | 97 |
| 201 | 3300025917 | Ga0207660_10894409 | Ga0207660_108944092 | 97 |
| 202 | 3300025921 | Ga0207652_11165449 | Ga0207652_111654491 | 97 |
| 203 | 3300025923 | Ga0207681_10100813 | Ga0207681_101008133 | 97 |
| 204 | 3300025924 | Ga0207694_10324354 | Ga0207694_103243542 | 97 |
| 205 | 3300025925 | Ga0207650_10043607 | Ga0207650_100436073 | 97 |
| 206 | 3300025926 | Ga0207659_10321386 | Ga0207659_103213862 | 97 |
| 207 | 3300025928 | Ga0207700_10415987 | Ga0207700_104159872 | 97 |
| 208 | 3300025929 | Ga0207664_10276028 | Ga0207664_102760283 | 97 |
| 209 | 3300025932 | Ga0207690_10149735 | Ga0207690_101497353 | 97 |
| 210 | 3300025933 | Ga0207706_10045969 | Ga0207706_100459693 | 97 |
| 211 | 3300025934 | Ga0207686_10188493 | Ga0207686_101884933 | 97 |
| 212 | 3300025934 | Ga0207686_10672519 | Ga0207686_106725192 | 97 |
| 213 | 3300025936 | Ga0207670_10002860 | Ga0207670_100028606 | 97 |
| 214 | 3300025937 | Ga0207669_10634953 | Ga0207669_106349532 | 97 |
| 215 | 3300025938 | Ga0207704_10088038 | Ga0207704_100880383 | 97 |
| 216 | 3300025939 | Ga0207665_10129934 | Ga0207665_101299342 | 97 |
| 217 | 3300025939 | Ga0207665_10893079 | Ga0207665_108930792 | 97 |
| 218 | 3300025941 | Ga0207711_10009020 | Ga0207711_100090206 | 97 |
| 219 | 3300025941 | Ga0207711_10686113 | Ga0207711_106861132 | 97 |
| 220 | 3300025944 | Ga0207661_10173788 | Ga0207661_101737883 | 97 |
| 221 | 3300025945 | Ga0207679_10022390 | Ga0207679_100223904 | 97 |
| 222 | 3300025945 | Ga0207679_10218119 | Ga0207679_102181191 | 97 |
| 223 | 3300025961 | Ga0207712_10414302 | Ga0207712_104143022 | 97 |
| 224 | 3300025961 | Ga0207712_10761707 | Ga0207712_107617072 | 97 |
| 225 | 3300025986 | Ga0207658_10651126 | Ga0207658_106511262 | 97 |
| 226 | 3300026023 | Ga0207677_11076753 | Ga0207677_110767532 | 97 |
| 227 | 3300026035 | Ga0207703_10362637 | Ga0207703_103626372 | 97 |
| 228 | 3300026041 | Ga0207639_10402883 | Ga0207639_104028832 | 97 |
| 229 | 3300026067 | Ga0207678_10230815 | Ga0207678_102308152 | 97 |
| 230 | 3300026075 | Ga0207708_11275934 | Ga0207708_112759341 | 97 |
| 231 | 3300026088 | Ga0207641_10413121 | Ga0207641_104131212 | 97 |
| 232 | 3300026089 | Ga0207648_10273227 | Ga0207648_102732272 | 97 |
| 233 | 3300026095 | Ga0207676_10016782 | Ga0207676_100167823 | 97 |
| 234 | 3300026095 | Ga0207676_10702018 | Ga0207676_107020181 | 97 |
| 235 | 3300026118 | Ga0207675_100335249 | Ga0207675_1003352493 | 97 |
| 236 | 3300026142 | Ga0207698_10529503 | Ga0207698_105295031 | 97 |
| 237 | 3300026142 | Ga0207698_10658454 | Ga0207698_106584543 | 97 |
| 238 | 3300027907 | Ga0207428_10500372 | Ga0207428_105003721 | 97 |
| 239 | 3300028379 | Ga0268266_10235478 | Ga0268266_102354782 | 97 |
| 240 | 3300028379 | Ga0268266_10604851 | Ga0268266_106048512 | 97 |
| 241 | 3300028380 | Ga0268265_10395839 | Ga0268265_103958391 | 97 |
| 242 | 3300028381 | Ga0268264_10055088 | Ga0268264_100550884 | 97 |
| 243 | 3300028381 | Ga0268264_12291804 | Ga0268264_122918041 | 97 |
| 244 | 3300031548 | Ga0307408_100162703 | Ga0307408_1001627032 | 97 |
| 245 | 3300031824 | Ga0307413_10206401 | Ga0307413_102064011 | 97 |
| 246 | 3300031852 | Ga0307410_11711769 | Ga0307410_117117692 | 97 |
| 247 | 3300031901 | Ga0307406_11464420 | Ga0307406_114644201 | 97 |
| 248 | 3300031903 | Ga0307407_10201929 | Ga0307407_102019293 | 97 |
| 249 | 3300031911 | Ga0307412_10144284 | Ga0307412_101442843 | 97 |
| 250 | 3300031995 | Ga0307409_100171723 | Ga0307409_1001717233 | 97 |
| 251 | 3300032002 | Ga0307416_102906001 | Ga0307416_1029060012 | 97 |
| 252 | 3300032002 | Ga0307416_103398235 | Ga0307416_1033982352 | 97 |
| 253 | 3300032002 | Ga0307416_103692198 | Ga0307416_1036921982 | 97 |
| 254 | 3300032005 | Ga0307411_10174206 | Ga0307411_101742062 | 97 |
| 255 | 3300032005 | Ga0307411_10393369 | Ga0307411_103933691 | 97 |
| 256 | 3300032126 | Ga0307415_101681261 | Ga0307415_1016812611 | 97 |
| 257 | 3300034816 | Ga0373930_0001772 | Ga0373930_0001772_2443_2784 | 97 |
| 258 | 3300034816 | Ga0373930_0060129 | Ga0373930_0060129_186_479 | 97 |
| 259 | 3300034957 | Ga0373938_0068493 | Ga0373938_0068493_82_423 | 97 |
| 260 | 3300034957 | Ga0373938_0082649 | Ga0373938_0082649_52_345 | 97 |
| 261 | 3300035084 | Ga0373928_0009951 | Ga0373928_0009951_323_664 | 97 |
| 262 | 3300035088 | Ga0373940_0078785 | Ga0373940_0078785_244_585 | 97 |
| 263 | 3300035088 | Ga0373940_0364701 | Ga0373940_0364701_177_470 | 97 |
| 264 | 3300035091 | Ga0373951_0074261 | Ga0373951_0074261_276_617 | 97 |
| 265 | 3300035092 | Ga0373952_0004860 | Ga0373952_0004860_1635_1976 | 97 |
| 266 | 3300035112 | Ga0373932_0058705 | Ga0373932_0058705_528_869 | 97 |
| 267 | 3300035112 | Ga0373932_0336758 | Ga0373932_0336758_75_368 | 97 |
| 268 | 3300035112 | Ga0373932_0395447 | Ga0373932_0395447_65_358 | 97 |
| 269 | 3300035114 | Ga0373939_0004798 | Ga0373939_0004798_1893_2234 | 97 |
| 270 | 3300035114 | Ga0373939_0039468 | Ga0373939_0039468_926_1219 | 97 |
| 271 | 3300035115 | Ga0373941_0094543 | Ga0373941_0094543_531_872 | 97 |
| 272 | 3300035115 | Ga0373941_0425242 | Ga0373941_0425242_78_383 | 97 |
| 273 | 3300035121 | Ga0373960_0003526 | Ga0373960_0003526_1079_1420 | 97 |
| 274 | 3300035207 | Ga0373942_0003945 | Ga0373942_0003945_3086_3427 | 97 |
| 275 | 3300035241 | Ga0373961_0007220 | Ga0373961_0007220_224_517 | 97 |
| 276 | 3300035241 | Ga0373961_0014770 | Ga0373961_0014770_482_823 | 97 |
| 277 | 3300035691 | Ga0373931_0000416 | Ga0373931_0000416_5671_6012 | 97 |
| 278 | 3300035691 | Ga0373931_0001658 | Ga0373931_0001658_3311_3604 | 97 |
| 279 | 3300035691 | Ga0373931_0434591 | Ga0373931_0434591_487_792 | 97 |
| 280 | 3300036401 | Ga0373937_1323306 | Ga0373937_1323306_78_410 | 97 |
| 281 | 3300037068 | Ga0373925_0624939 | Ga0373925_0624939_161_502 | 97 |
| 282 | 3300041408 | Ga0439453_0049969 | Ga0439453_0049969_174_479 | 97 |
| 283 | 3300041458 | Ga0451798_0387576 | Ga0451798_0387576_375_668 | 97 |
| 284 | 3300042184 | Ga0450908_035710 | Ga0450908_035710_293_598 | 97 |
| 285 | 3300042436 | Ga0439435_0026640 | Ga0439435_0026640_633_926 | 97 |
| 286 | 3300044694 | Ga0466963_0186969 | Ga0466963_0186969_705_1013 | 97 |
| 287 | 3300046459 | Ga0495629_0020340 | Ga0495629_0020340_3275_3607 | 97 |
| 288 | 3300046460 | Ga0495638_0047138 | Ga0495638_0047138_1310_1633 | 97 |
| 289 | 3300046473 | Ga0495582_0245616 | Ga0495582_0245616_26_358 | 97 |
| 290 | 3300046499 | Ga0495594_0140888 | Ga0495594_0140888_12_317 | 97 |
| 291 | 3300046531 | Ga0495665_0544835 | Ga0495665_0544835_129_434 | 97 |
| 292 | 3300046537 | Ga0495598_0104095 | Ga0495598_0104095_439_744 | 97 |
| 293 | 3300047319 | Ga0495674_0272691 | Ga0495674_0272691_984_1316 | 97 |
| 294 | 3300047320 | Ga0495672_0450892 | Ga0495672_0450892_260_553 | 97 |
| 295 | 3300047447 | Ga0495685_008495 | Ga0495685_008495_1549_1854 | 97 |
| 296 | 3300047673 | Ga0495593_0174860 | Ga0495593_0174860_141_473 | 97 |
| 297 | 3300048090 | Ga0495615_0042932 | Ga0495615_0042932_304_609 | 97 |
| 298 | 3300048903 | Ga0496100_0000936 | Ga0496100_0000936_4357_4698 | 97 |
| 299 | 3300048904 | Ga0496101_0001406 | Ga0496101_0001406_9732_10073 | 97 |
| 300 | 3300048904 | Ga0496101_0063969 | Ga0496101_0063969_1732_2037 | 97 |
| 301 | 3300048904 | Ga0496101_1161860 | Ga0496101_1161860_202_507 | 97 |
| 302 | 3300048905 | Ga0496102_0024611 | Ga0496102_0024611_114_455 | 97 |
| 303 | 3300048905 | Ga0496102_0459249 | Ga0496102_0459249_246_551 | 97 |
| 304 | 3300048905 | Ga0496102_1795191 | Ga0496102_1795191_84_389 | 97 |
| 305 | 3300048906 | Ga0496103_0053335 | Ga0496103_0053335_34_330 | 97 |
| 306 | 3300048906 | Ga0496103_0388732 | Ga0496103_0388732_163_468 | 97 |
| 307 | 3300048907 | Ga0496104_0022209 | Ga0496104_0022209_146_487 | 97 |
| 308 | 3300048907 | Ga0496104_0025211 | Ga0496104_0025211_3335_3640 | 97 |
| 309 | 3300048908 | Ga0496105_0002256 | Ga0496105_0002256_10492_10833 | 97 |
| 310 | 3300048908 | Ga0496105_0022512 | Ga0496105_0022512_326_631 | 97 |
| 311 | 3300048909 | Ga0496106_0006550 | Ga0496106_0006550_1512_1853 | 97 |
| 312 | 3300048909 | Ga0496106_0024691 | Ga0496106_0024691_2786_3091 | 97 |
| 313 | 3300048910 | Ga0496107_0010746 | Ga0496107_0010746_5639_5980 | 97 |
| 314 | 3300048910 | Ga0496107_0568825 | Ga0496107_0568825_303_608 | 97 |
| 315 | 3300048911 | Ga0496108_0000400 | Ga0496108_0000400_4758_5063 | 97 |
| 316 | 3300048911 | Ga0496108_0096169 | Ga0496108_0096169_1197_1538 | 97 |
| 317 | 3300048912 | Ga0496109_0011907 | Ga0496109_0011907_5542_5847 | 97 |
| 318 | 3300048912 | Ga0496109_0044007 | Ga0496109_0044007_2970_3263 | 97 |
| 319 | 3300048912 | Ga0496109_0150811 | Ga0496109_0150811_1798_2139 | 97 |
| 320 | 3300048913 | Ga0496110_0025649 | Ga0496110_0025649_4513_4806 | 97 |
| 321 | 3300048913 | Ga0496110_0121068 | Ga0496110_0121068_109_414 | 97 |
| 322 | 3300048913 | Ga0496110_0368659 | Ga0496110_0368659_57_362 | 97 |
| 323 | 3300048914 | Ga0496111_0009679 | Ga0496111_0009679_4951_5292 | 97 |
| 324 | 3300048914 | Ga0496111_0460275 | Ga0496111_0460275_66_359 | 97 |
| 325 | 3300048915 | Ga0496112_0019174 | Ga0496112_0019174_2410_2715 | 97 |
| 326 | 3300048915 | Ga0496112_0038742 | Ga0496112_0038742_1303_1644 | 97 |
| 327 | 3300048916 | Ga0496113_0008141 | Ga0496113_0008141_2022_2327 | 97 |
| 328 | 3300048916 | Ga0496113_0072319 | Ga0496113_0072319_1531_1872 | 97 |
| 329 | 3300048916 | Ga0496113_0119420 | Ga0496113_0119420_1100_1393 | 97 |
| 330 | 3300048917 | Ga0496114_0194429 | Ga0496114_0194429_1421_1762 | 97 |
| 331 | 3300048918 | Ga0496115_0003984 | Ga0496115_0003984_2873_3214 | 97 |
| 332 | 3300048918 | Ga0496115_0276554 | Ga0496115_0276554_318_623 | 97 |
| 333 | 3300049568 | Ga0501031_0034456 | Ga0501031_0034456_1925_2236 | 97 |
| 334 | 3300049569 | Ga0501032_0019142 | Ga0501032_0019142_3111_3404 | 97 |
| 335 | 3300049569 | Ga0501032_0541316 | Ga0501032_0541316_89_382 | 97 |
| 336 | 3300049569 | Ga0501032_0653528 | Ga0501032_0653528_213_506 | 97 |
| 337 | 3300049570 | Ga0501033_0062034 | Ga0501033_0062034_1505_1816 | 97 |
| 338 | 3300049571 | Ga0501034_0000438 | Ga0501034_0000438_5423_5716 | 97 |
| 339 | 3300049571 | Ga0501034_0012727 | Ga0501034_0012727_541_852 | 97 |
| 340 | 3300049571 | Ga0501034_0139101 | Ga0501034_0139101_1093_1428 | 97 |
| 341 | 3300049571 | Ga0501034_0551739 | Ga0501034_0551739_710_1015 | 97 |
| 342 | 3300049572 | Ga0501036_0059398 | Ga0501036_0059398_368_703 | 97 |
| 343 | 3300049572 | Ga0501036_0093151 | Ga0501036_0093151_1446_1757 | 97 |
| 344 | 3300049572 | Ga0501036_0259865 | Ga0501036_0259865_273_566 | 97 |
| 345 | 3300049572 | Ga0501036_0298105 | Ga0501036_0298105_565_858 | 97 |
| 346 | 3300049573 | Ga0501037_0332507 | Ga0501037_0332507_62_397 | 97 |
| 347 | 3300049574 | Ga0501038_0019505 | Ga0501038_0019505_4353_4664 | 97 |
| 348 | 3300049574 | Ga0501038_0060337 | Ga0501038_0060337_490_825 | 97 |
| 349 | 3300049575 | Ga0501039_0073166 | Ga0501039_0073166_1031_1324 | 97 |
| 350 | 3300049575 | Ga0501039_0128901 | Ga0501039_0128901_1135_1446 | 97 |
| 351 | 3300049576 | Ga0501040_0163574 | Ga0501040_0163574_889_1194 | 97 |
| 352 | 3300049576 | Ga0501040_0771937 | Ga0501040_0771937_374_667 | 97 |
| 353 | 3300049577 | Ga0501041_0733254 | Ga0501041_0733254_53_346 | 97 |
| 354 | 3300049578 | Ga0501042_0427343 | Ga0501042_0427343_426_731 | 97 |
| 355 | 3300049579 | Ga0501043_0060077 | Ga0501043_0060077_2481_2816 | 97 |
| 356 | 3300049579 | Ga0501043_0712314 | Ga0501043_0712314_372_683 | 97 |
| 357 | 3300049580 | Ga0501046_0064018 | Ga0501046_0064018_371_676 | 97 |
| 358 | 3300049580 | Ga0501046_0649410 | Ga0501046_0649410_324_659 | 97 |
| 359 | 3300049580 | Ga0501046_1030074 | Ga0501046_1030074_246_539 | 97 |
| 360 | 3300049581 | Ga0501047_0061534 | Ga0501047_0061534_363_674 | 97 |
| 361 | 3300049581 | Ga0501047_0126186 | Ga0501047_0126186_330_665 | 97 |
| 362 | 3300049581 | Ga0501047_0477354 | Ga0501047_0477354_314_619 | 97 |
| 363 | 3300049582 | Ga0501048_0128859 | Ga0501048_0128859_61_396 | 97 |
| 364 | 3300049584 | Ga0501068_0106149 | Ga0501068_0106149_872_1165 | 97 |
| 365 | 3300049584 | Ga0501068_0481632 | Ga0501068_0481632_298_591 | 97 |
| 366 | 3300049586 | Ga0501070_0034993 | Ga0501070_0034993_1442_1777 | 97 |
| 367 | 3300049586 | Ga0501070_0190786 | Ga0501070_0190786_102_413 | 97 |
| 368 | 3300049586 | Ga0501070_0208451 | Ga0501070_0208451_643_936 | 97 |
| 369 | 3300049587 | Ga0501071_0094631 | Ga0501071_0094631_630_965 | 97 |
| 370 | 3300049587 | Ga0501071_0446367 | Ga0501071_0446367_26_319 | 97 |
| 371 | 3300049587 | Ga0501071_0833882 | Ga0501071_0833882_321_614 | 97 |
| 372 | 3300049588 | Ga0501072_1042102 | Ga0501072_1042102_12_317 | 97 |
| 373 | 3300049589 | Ga0501073_0574595 | Ga0501073_0574595_400_705 | 97 |
| 374 | 3300049589 | Ga0501073_0734990 | Ga0501073_0734990_224_517 | 97 |
| 375 | 3300049589 | Ga0501073_0923900 | Ga0501073_0923900_51_344 | 97 |
| 376 | 3300049590 | Ga0501074_0675638 | Ga0501074_0675638_139_432 | 97 |
| 377 | 3300049591 | Ga0501075_0245664 | Ga0501075_0245664_404_697 | 97 |
| 378 | 3300049592 | Ga0501076_0144193 | Ga0501076_0144193_1298_1603 | 97 |
| 379 | 3300049592 | Ga0501076_0194643 | Ga0501076_0194643_774_1067 | 97 |
| 380 | 3300049592 | Ga0501076_0827240 | Ga0501076_0827240_256_549 | 97 |
| 381 | 3300049593 | Ga0501077_0326473 | Ga0501077_0326473_237_542 | 97 |
| 382 | 3300049593 | Ga0501077_0367783 | Ga0501077_0367783_388_681 | 97 |
| 383 | 3300049593 | Ga0501077_0814164 | Ga0501077_0814164_24_323 | 97 |
| 384 | 3300049593 | Ga0501077_0937628 | Ga0501077_0937628_169_462 | 97 |
| 385 | 3300049741 | Ga0501079_1079954 | Ga0501079_1079954_73_366 | 97 |
| 386 | 3300049741 | Ga0501079_1113660 | Ga0501079_1113660_82_375 | 97 |
| 387 | 3300049743 | Ga0501081_0407604 | Ga0501081_0407604_107_400 | 97 |
| 388 | 3300049744 | Ga0501083_0852746 | Ga0501083_0852746_15_308 | 97 |
| 389 | 3300049744 | Ga0501083_1101642 | Ga0501083_1101642_109_414 | 97 |
| 390 | 3300049822 | Ga0501035_0272415 | Ga0501035_0272415_1025_1336 | 97 |
| 391 | 3300049822 | Ga0501035_0842909 | Ga0501035_0842909_213_506 | 97 |
| 392 | 3300049823 | Ga0501044_0001788 | Ga0501044_0001788_18608_18901 | 97 |
| 393 | 3300049823 | Ga0501044_0072138 | Ga0501044_0072138_2484_2819 | 97 |
| 394 | 3300049823 | Ga0501044_0264173 | Ga0501044_0264173_476_781 | 97 |
| 395 | 3300049823 | Ga0501044_0589512 | Ga0501044_0589512_272_583 | 97 |
| 396 | 3300049823 | Ga0501044_1011973 | Ga0501044_1011973_134_445 | 97 |
| 397 | 3300049824 | Ga0501045_0176950 | Ga0501045_0176950_616_921 | 97 |
| 398 | 3300050489 | nmdc:mga03683_189045_c1 | nmdc:mga03683_189045_c1_498_836 | 97 |
| 399 | 3300050491 | nmdc:mga00v17_159912_c1 | nmdc:mga00v17_159912_c1_287_592 | 97 |
| 400 | 3300050493 | nmdc:mga0k408_17338_c1 | nmdc:mga0k408_17338_c1_627_965 | 97 |
| 401 | 3300050493 | nmdc:mga0k408_402919_c1 | nmdc:mga0k408_402919_c1_271_573 | 97 |
| 402 | 3300050493 | nmdc:mga0k408_79459_c1 | nmdc:mga0k408_79459_c1_59_412 | 97 |
| 403 | 3300050494 | nmdc:mga06z11_132390_c1 | nmdc:mga06z11_132390_c1_283_576 | 97 |
| 404 | 3300050494 | nmdc:mga06z11_44196_c1 | nmdc:mga06z11_44196_c1_14_352 | 97 |
| 405 | 3300050507 | nmdc:mga05p37_1314121_c1 | nmdc:mga05p37_1314121_c1_352_651 | 97 |
| 406 | 3300050507 | nmdc:mga05p37_56610_c1 | nmdc:mga05p37_56610_c1_2065_2370 | 97 |
| 407 | 3300050508 | nmdc:mga09592_290244_c1 | nmdc:mga09592_290244_c1_65_370 | 97 |
| 408 | 3300050509 | nmdc:mga0qj67_910884_c1 | nmdc:mga0qj67_910884_c1_89_394 | 97 |
| 409 | 3300050511 | nmdc:mga08y16_456580_c1 | nmdc:mga08y16_456580_c1_835_1143 | 97 |
| 410 | 3300050516 | nmdc:mga0sz30_209632_c1 | nmdc:mga0sz30_209632_c1_177_482 | 97 |
| 411 | 3300053085 | Ga0495619_0092429 | Ga0495619_0092429_1019_1351 | 97 |
| 412 | 3300053092 | Ga0500583_0218254 | Ga0500583_0218254_602_928 | 97 |
| 413 | 3300053093 | Ga0500651_0200485 | Ga0500651_0200485_676_999 | 97 |
| 414 | 3300053117 | Ga0500593_016715 | Ga0500593_016715_689_988 | 97 |
| 415 | 3300053119 | Ga0500595_137993 | Ga0500595_137993_250_555 | 97 |
| 416 | 3300053129 | Ga0500628_091315 | Ga0500628_091315_110_403 | 97 |
| 417 | 3300053130 | Ga0500642_0143398 | Ga0500642_0143398_541_864 | 97 |
| 418 | 3300053151 | Ga0500604_0012339 | Ga0500604_0012339_1087_1386 | 97 |
| 419 | 3300053153 | Ga0500616_0302576 | Ga0500616_0302576_122_415 | 97 |
| 420 | 3300053158 | Ga0500627_0072895 | Ga0500627_0072895_700_993 | 97 |
| 421 | 3300053177 | Ga0500636_0263157 | Ga0500636_0263157_242_547 | 97 |
| 422 | 3300053727 | Ga0500611_015228 | Ga0500611_015228_858_1181 | 97 |
| 423 | 3300054114 | Ga0501084_0115123 | Ga0501084_0115123_224_517 | 97 |
| 424 | 3300054114 | Ga0501084_0266029 | Ga0501084_0266029_1048_1341 | 97 |
| 425 | 3300054114 | Ga0501084_0468506 | Ga0501084_0468506_205_498 | 97 |
| 426 | 3300059626 | Ga0587115_053055 | Ga0587115_053055_335_643 | 97 |
| 427 | 3300059647 | Ga0587079_002805 | Ga0587079_002805_333_641 | 97 |
| 428 | 3300060353 | Ga0501082_0002950 | Ga0501082_0002950_14490_14795 | 97 |
| 429 | 3300060353 | Ga0501082_0176758 | Ga0501082_0176758_615_920 | 97 |
| 430 | 3300060353 | Ga0501082_0346979 | Ga0501082_0346979_818_1111 | 97 |
| 431 | 3300060353 | Ga0501082_0377295 | Ga0501082_0377295_403_696 | 97 |
| 432 | 3300060353 | Ga0501082_1333953 | Ga0501082_1333953_41_346 | 97 |
| 433 | 3300060353 | Ga0501082_1514314 | Ga0501082_1514314_166_459 | 97 |
| 434 | 3300061734 | Ga0530510_0031201 | Ga0530510_0031201_106_399 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1adr-assembly1.cif.gz_A | determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor | 0.8937 | 18 | 77 |
| 7xi5-assembly1.cif.gz_A | anti-crispr-associated aca10 | 0.8914 | 18 | 67 |
| 1utx-assembly1.cif.gz_B | regulation of cytolysin expression by enterococcus faecalis: role of cylr2 | 0.8896 | 21 | 75 |
| 2xi8-assembly1.cif.gz_A | high resolution structure of native cylr2 | 0.8884 | 21 | 74 |
| 3bs3-assembly1.cif.gz_A-2 | crystal structure of a putative dna-binding protein from bacteroides fragilis | 0.8879 | 21 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1adrA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8937 | 18 | 77 | 1.10.260.40 |
| 2r1jL00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8863 | 18 | 76 | 1.10.260.40 |
| 3jxbD00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8858 | 18 | 76 | 1.10.260.40 |
| 4ybaA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8762 | 18 | 70 | 1.10.260.40 |
| af_Q58006_80_170_1.10.260.40 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.876 | 18 | 72 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E8GU32-F1-model_v4 | Helix-turn-helix protein | 0.9991 | 9 | 92 |
GO:0003677
|
| AF-B6IXD2-F1-model_v4 | DNA-binding protein, putative | 0.9984 | 9 | 94 |
GO:0003677
|
| AF-A0A832DUV6-F1-model_v4 | XRE family transcriptional regulator | 0.9977 | 9 | 94 |
GO:0003677
|
| AF-A0A2S6QIJ8-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9971 | 9 | 94 |
GO:0003677
|
| AF-A0A1W2EV98-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.997 | 9 | 95 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar