F443202

General Info

Members Datasets Scaffolds Average Seq Length
434 249 429 337

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_94440_c1|nmdc:mga06z11_94440_c1_153_1265
Length 370
Sequence MQLAMIGLGRMGANMVRRLQKAGHDCIVHDVSAAAVTSLEEEGFAGAGSLEDLVAKLDAPRHLWIMVPAAFVAGTVAKLAPLLSPGDTIIDGGNSWYRDDVDASGPLAEIGLHYLDVGTSGGVFGLERGYCLMVGGNSEAVAQMAPIFDSLAPGVASAERTPGLTGPPSTAERGWLHCGPSGAGHFVKMVHNGIEYGLMASYAEGLNILAHANIGLEEHARDAETAPLTHPEYYQYDLDLGAITEVWRRGSVVASWLLDLTAAAMNADPLLDAFEGQVSDSGEGRWTIHAAIDEGVPAPVLSAALYQRFSSRGHAGIADKVLSAMRAQFGGHIEKSEGELVDGRIKTVEEQPTEVRPSEVASQTAQAEKG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2643221692 Nocardia sp. Root136 Isolate Unclassified
3 2739367700 Dyella sp. YR388 Isolate Unclassified
4 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
155 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
156 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
157 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
158 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
159 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0.23
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 3.92
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10045419 3300005327 Bacteria 3552
2 Ga0070683_100061834 3300005329 Bacteria 3481
3 Ga0070683_100101085 3300005329 Bacteria 2715
4 Ga0070680_100023937 3300005336 Bacteria 4875
5 Ga0068868_100011240 3300005338 Bacteria 6520
6 Ga0070692_10004568 3300005345 Bacteria 5795
7 Ga0070668_100038673 3300005347 Bacteria 3648
8 Ga0070675_100339721 3300005354 Bacteria 1330
9 Ga0070671_100001807 3300005355 Bacteria 16266
10 Ga0070671_100006081 3300005355 Bacteria 9619
11 Ga0070659_100006640 3300005366 Bacteria 8361
12 Ga0070659_100234345 3300005366 Bacteria 1517
13 Ga0070667_100170015 3300005367 Bacteria 1924
14 Ga0070714_100006514 3300005435 Bacteria 9028
15 Ga0070713_100310211 3300005436 Bacteria 1455
16 Ga0070701_10011059 3300005438 Bacteria 4017
17 Ga0070700_100000905 3300005441 Bacteria 14646
18 Ga0070694_100103720 3300005444 Bacteria 2015
19 Ga0070708_100013534 3300005445 Bacteria 6684
20 Ga0070662_100024826 3300005457 Bacteria 4133
21 Ga0070662_100326167 3300005457 Bacteria 1253
22 Ga0070681_10021700 3300005458 Bacteria 6439
23 Ga0070681_10153536 3300005458 Bacteria 2228
24 Ga0068867_100138996 3300005459 Bacteria 1897
25 Ga0070679_100006472 3300005530 Bacteria 10917
26 Ga0070679_100102999 3300005530 Bacteria 2840
27 Ga0070684_100154672 3300005535 Bacteria 2079
28 Ga0070684_100181538 3300005535 Bacteria 1914
29 Ga0068853_100222629 3300005539 Bacteria 1724
30 Ga0070695_100001613 3300005545 Bacteria 12630
31 Ga0070695_100002384 3300005545 Bacteria 10798
32 Ga0070696_100002164 3300005546 Bacteria 12946
33 Ga0070693_100051200 3300005547 Bacteria 2364
34 Ga0070665_100005066 3300005548 Bacteria 13672
35 Ga0070704_100004175 3300005549 Bacteria 8337
36 Ga0068855_100343845 3300005563 Bacteria 1644
37 Ga0068857_100007483 3300005577 Bacteria 9401
38 Ga0068857_100235804 3300005577 Bacteria 1674
39 Ga0068859_100001348 3300005617 Bacteria 25055
40 Ga0068859_100388664 3300005617 Bacteria 1491
41 Ga0068864_100090428 3300005618 Bacteria 2699
42 Ga0068861_100340182 3300005719 Bacteria 1313
43 Ga0068860_100003791 3300005843 Bacteria 15553
44 Ga0068860_100078561 3300005843 Bacteria 3138
45 Ga0068862_100000857 3300005844 Bacteria 29811
46 Ga0081455_10005251 3300005937 Bacteria 14238
47 Ga0081538_10002653 3300005981 Bacteria 17264
48 Ga0081538_10006298 3300005981 Bacteria 10483
49 Ga0081538_10008161 3300005981 Bacteria 8934
50 Ga0081538_10032120 3300005981 Bacteria 3526
51 Ga0081540_1026541 3300005983 Bacteria 3303
52 Ga0081539_10030876 3300005985 Bacteria 3315
53 Ga0075365_10028261 3300006038 Bacteria 3576
54 Ga0075363_100068733 3300006048 Bacteria 1921
55 Ga0075364_10009629 3300006051 Bacteria 5804
56 Ga0075364_10029585 3300006051 Bacteria 3513
57 Ga0075364_10119525 3300006051 Bacteria 1763
58 Ga0075432_10039065 3300006058 Bacteria 1654
59 Ga0070712_100000166 3300006175 Bacteria 35924
60 Ga0075367_10033396 3300006178 Bacteria 2965
61 Ga0075369_10092378 3300006186 Bacteria 1352
62 Ga0097621_100090018 3300006237 Bacteria 2567
63 Ga0068871_100108987 3300006358 Bacteria 2328
64 Ga0075428_100033770 3300006844 Bacteria 5645
65 Ga0075431_100276086 3300006847 Bacteria 1702
66 Ga0075429_100034779 3300006880 Bacteria 4379
67 Ga0068865_100096598 3300006881 Bacteria 2155
68 Ga0097620_100001348 3300006931 Bacteria 25055
69 Ga0097620_100388686 3300006931 Bacteria 1491
70 Ga0105240_10021393 3300009093 Bacteria 8604
71 Ga0111539_10115992 3300009094 Bacteria 3140
72 Ga0111539_10199506 3300009094 Bacteria 2333
73 Ga0105245_10013354 3300009098 Bacteria 7157
74 Ga0105245_10061854 3300009098 Bacteria 3376
75 Ga0105245_10253108 3300009098 Bacteria 1712
76 Ga0105245_10414192 3300009098 Bacteria 1349
77 Ga0114129_10063287 3300009147 Bacteria 5166
78 Ga0114129_10201962 3300009147 Bacteria 2692
79 Ga0105248_10224640 3300009177 Bacteria 2114
80 Ga0105249_10000689 3300009553 Bacteria 30748
81 Ga0105249_10023074 3300009553 Bacteria 5579
82 Ga0105239_10050058 3300010375 Bacteria 4583
83 Ga0105239_10103787 3300010375 Bacteria 3147
84 Ga0105246_10077926 3300011119 Bacteria 2353
85 Ga0157373_10033415 3300013100 Bacteria 3700
86 Ga0157371_10293409 3300013102 Bacteria 1176
87 Ga0157369_10006567 3300013105 Bacteria 13460
88 Ga0163162_10041190 3300013306 Bacteria 4621
89 Ga0157372_10018223 3300013307 Bacteria 7547
90 Ga0157372_10300456 3300013307 Bacteria 1867
91 Ga0163163_10002512 3300014325 Bacteria 15524
92 Ga0157377_10012433 3300014745 Bacteria 4280
93 Ga0157379_10051750 3300014968 Bacteria 3667
94 Ga0157379_10198329 3300014968 Bacteria 1815
95 Ga0163161_10244340 3300017792 Bacteria 1397
96 Ga0206353_10738461 3300020082 Bacteria 1487
97 Ga0213876_10000006 3300021384 Bacteria 700803
98 Ga0207710_10000075 3300025900 Bacteria 146077
99 Ga0207688_10009792 3300025901 Bacteria 5216
100 Ga0207707_10318769 3300025912 Bacteria 1342
101 Ga0207693_10000568 3300025915 Bacteria 33238
102 Ga0207660_10003438 3300025917 Bacteria 10326
103 Ga0207660_10410627 3300025917 Bacteria 1091
104 Ga0207652_10016668 3300025921 Bacteria 6004
105 Ga0207652_10019417 3300025921 Bacteria 5590
106 Ga0207652_10090987 3300025921 Bacteria 2682
107 Ga0207652_10182707 3300025921 Bacteria 1885
108 Ga0207681_10131571 3300025923 Bacteria 1851
109 Ga0207687_10040244 3300025927 Bacteria 3203
110 Ga0207644_10000715 3300025931 Bacteria 21084
111 Ga0207690_10035209 3300025932 Bacteria 3232
112 Ga0207690_10063945 3300025932 Bacteria 2511
113 Ga0207706_10033120 3300025933 Bacteria 4600
114 Ga0207706_10109510 3300025933 Bacteria 2431
115 Ga0207669_10034654 3300025937 Bacteria 2863
116 Ga0207704_10034807 3300025938 Bacteria 2878
117 Ga0207691_10024313 3300025940 Bacteria 5697
118 Ga0207711_10003152 3300025941 Bacteria 14373
119 Ga0207661_10034492 3300025944 Bacteria 3936
120 Ga0207667_10118603 3300025949 Bacteria 2727
121 Ga0207667_10379127 3300025949 Bacteria 1441
122 Ga0207651_10134747 3300025960 Bacteria 1898
123 Ga0207712_10000968 3300025961 Bacteria 20670
124 Ga0207712_10105774 3300025961 Bacteria 2101
125 Ga0207668_10360280 3300025972 Bacteria 1218
126 Ga0207677_10028144 3300026023 Bacteria 3550
127 Ga0207639_10173179 3300026041 Bacteria 1830
128 Ga0207678_10007443 3300026067 Bacteria 9695
129 Ga0207708_10002109 3300026075 Bacteria 14648
130 Ga0207641_10223755 3300026088 Bacteria 1746
131 Ga0207648_10038173 3300026089 Bacteria 4227
132 Ga0207676_10263723 3300026095 Bacteria 1557
133 Ga0207674_10006620 3300026116 Bacteria 13615
134 Ga0207675_100003257 3300026118 Bacteria 15900
135 Ga0207675_100263777 3300026118 Bacteria 1670
136 Ga0209971_1004463 3300027682 Bacteria 3321
137 Ga0209998_10000642 3300027717 Bacteria 9370
138 Ga0209813_10014109 3300027866 Bacteria 2146
139 Ga0209974_10006069 3300027876 Bacteria 4229
140 Ga0207428_10008731 3300027907 Bacteria 9143
141 Ga0268266_10007788 3300028379 Bacteria 9605
142 Ga0268265_10000953 3300028380 Bacteria 26598
143 Ga0268264_10029231 3300028381 Bacteria 4513
144 Ga0268264_10091493 3300028381 Bacteria 2624
145 Ga0265337_1000773 3300028556 Bacteria 16880
146 Ga0265334_10039480 3300028573 Bacteria 1852
147 Ga0265338_10006913 3300028800 Bacteria 14279
148 Ga0265338_10024317 3300028800 Bacteria 6191
149 Ga0265330_10000334 3300031235 Bacteria 33914
150 Ga0265330_10116419 3300031235 Bacteria 1140
151 Ga0265332_10000011 3300031238 Bacteria 284299
152 Ga0265320_10000112 3300031240 Bacteria 70460
153 Ga0265325_10004351 3300031241 Bacteria 8964
154 Ga0265340_10029952 3300031247 Bacteria 2731
155 Ga0265327_10002260 3300031251 Bacteria 20786
156 Ga0307508_10018086 3300031616 Bacteria 6402
157 Ga0316579_10014802 3300031691 Bacteria 3380
158 Ga0265314_10000026 3300031711 Bacteria 284299
159 Ga0265314_10015998 3300031711 Bacteria 5938
160 Ga0316578_10044451 3300031728 Bacteria 2584
161 Ga0316578_10073047 3300031728 Bacteria 2033
162 Ga0307405_10009033 3300031731 Bacteria 5091
163 Ga0307405_10068022 3300031731 Bacteria 2278
164 Ga0307410_10103768 3300031852 Bacteria 2043
165 Ga0307406_10054646 3300031901 Bacteria 2549
166 Ga0307406_10074429 3300031901 Bacteria 2236
167 Ga0307407_10173547 3300031903 Bacteria 1422
168 Ga0307412_10135156 3300031911 Bacteria 1798
169 Ga0307412_10164645 3300031911 Bacteria 1652
170 Ga0307412_10208893 3300031911 Bacteria 1488
171 Ga0307409_100002536 3300031995 Bacteria 9577
172 Ga0307409_100006733 3300031995 Bacteria 6796
173 Ga0307409_100007311 3300031995 Bacteria 6595
174 Ga0307409_100144240 3300031995 Bacteria 2056
175 Ga0307416_100007237 3300032002 Bacteria 7032
176 Ga0307416_100030743 3300032002 Bacteria 4033
177 Ga0307416_100252178 3300032002 Bacteria 1718
178 Ga0307411_10188716 3300032005 Bacteria 1572
179 Ga0307415_100000408 3300032126 Bacteria 18358
180 Ga0307415_100053379 3300032126 Bacteria 2753
181 Ga0307415_100122832 3300032126 Bacteria 1950
182 Ga0307415_100192256 3300032126 Bacteria 1611
183 Ga0373923_0046122 3300035111 Bacteria 1812
184 Ga0373939_0057082 3300035114 Bacteria 1231
185 Ga0373957_0021606 3300035120 Bacteria 2286
186 Ga0373955_0005682 3300035172 Bacteria 5617
187 Ga0373924_0059384 3300035410 Bacteria 1597
188 Ga0373931_0004827 3300035691 Bacteria 6191
189 Ga0373933_0030727 3300035724 Bacteria 3112
190 Ga0373933_0043322 3300035724 Bacteria 2663
191 Ga0373933_0181537 3300035724 Bacteria 1342
192 Ga0373937_0007086 3300036401 Bacteria 9683
193 Ga0373937_0013759 3300036401 Bacteria 7129
194 Ga0316582_0056047 3300036647 Bacteria 2513
195 Ga0395898_0034173 3300037466 Bacteria 5069
196 Ga0395901_0005805 3300038443 Bacteria 12504
197 Ga0436365_0695157 3300039437 Bacteria 511493
198 Ga0436361_0719257 3300039447 Bacteria 3130
199 Ga0451791_0601961 3300041451 Bacteria 1002
200 Ga0439445_0020970 3300042004 Bacteria 1639
201 Ga0439450_000239 3300042008 Bacteria 6675
202 Ga0439454_002916 3300042011 Bacteria 1857
203 Ga0439454_003959 3300042011 Bacteria 1681
204 Ga0439455_0016417 3300042012 Bacteria 1712
205 Ga0439463_003650 3300042016 Bacteria 3880
206 Ga0450913_000570 3300042117 Bacteria 1643
207 Ga0450914_000018 3300042118 Bacteria 3609
208 Ga0450900_000024 3300042136 Bacteria 7195
209 Ga0450902_011412 3300042137 Bacteria 1412
210 Ga0450905_006030 3300042142 Bacteria 1633
211 Ga0450906_006789 3300042145 Bacteria 2292
212 Ga0439464_0000011 3300042439 Bacteria 27415
213 Ga0439460_0000304 3300042461 Bacteria 10261
214 Ga0439460_0026604 3300042461 Bacteria 1619
215 Ga0451577_0001248 3300042876 Bacteria 35193
216 Ga0439440_0000047 3300042993 Bacteria 15205
217 Ga0466972_0044203 3300044658 Bacteria 2161
218 Ga0453684_0013114 3300044712 Bacteria 13525
219 Ga0466970_0022748 3300044765 Bacteria 3270
220 Ga0466960_0002291 3300044901 Bacteria 7170
221 Ga0466967_0069873 3300045976 Bacteria 3140
222 Ga0466967_0291584 3300045976 Bacteria 1568
223 Ga0495603_0043807 3300046455 Bacteria 2671
224 Ga0495596_0079654 3300046500 Bacteria 1272
225 Ga0495652_0126877 3300046529 Bacteria 2026
226 Ga0495586_0039760 3300046535 Bacteria 2529
227 Ga0495587_0040405 3300046536 Bacteria 2789
228 Ga0495621_0031938 3300046539 Bacteria 1809
229 Ga0495645_0104401 3300046543 Bacteria 2013
230 Ga0495667_0017038 3300046559 Bacteria 4906
231 Ga0495661_0059452 3300046665 Bacteria 2275
232 Ga0495588_0100877 3300046674 Bacteria 1517
233 Ga0495657_0003529 3300046675 Bacteria 12756
234 Ga0495623_0010251 3300046679 Bacteria 6064
235 Ga0495623_0076282 3300046679 Bacteria 2080
236 Ga0495600_0012159 3300046809 Bacteria 5376
237 Ga0495604_0062499 3300047317 Bacteria 2844
238 Ga0495604_0133123 3300047317 Bacteria 1785
239 Ga0495604_0166138 3300047317 Bacteria 1556
240 Ga0495674_0057900 3300047319 Bacteria 3390
241 Ga0495680_0003435 3300047322 Bacteria 15636
242 Ga0495677_0055770 3300047445 Bacteria 1459
243 Ga0495602_0089710 3300048088 Bacteria 2556
244 Ga0496101_0302785 3300048904 Bacteria 1252
245 Ga0496102_0007192 3300048905 Bacteria 9506
246 Ga0496102_0016252 3300048905 Bacteria 6503
247 Ga0496104_0176809 3300048907 Bacteria 2045
248 Ga0496105_0055659 3300048908 Bacteria 3266
249 Ga0496106_0002017 3300048909 Bacteria 15276
250 Ga0496107_0000548 3300048910 Bacteria 21012
251 Ga0496108_0041889 3300048911 Bacteria 3823
252 Ga0496109_0100151 3300048912 Bacteria 2688
253 Ga0496110_0001283 3300048913 Bacteria 17992
254 Ga0496110_0088882 3300048913 Bacteria 2760
255 Ga0496111_0032530 3300048914 Bacteria 3719
256 Ga0496111_0047167 3300048914 Bacteria 3103
257 Ga0496114_0145530 3300048917 Bacteria 2054
258 Ga0496114_0244696 3300048917 Bacteria 1578
259 Ga0496115_0037181 3300048918 Bacteria 3858
260 Ga0496119_0002598 3300048922 Bacteria 19602
261 Ga0496120_0000784 3300048923 Bacteria 45971
262 Ga0495682_0008035 3300049460 Bacteria 4173
263 Ga0501031_0001615 3300049568 Bacteria 14080
264 Ga0501031_0020481 3300049568 Bacteria 4312
265 Ga0501031_0047613 3300049568 Bacteria 2795
266 Ga0501031_0071940 3300049568 Bacteria 2251
267 Ga0501031_0125413 3300049568 Bacteria 1677
268 Ga0501032_0000399 3300049569 Bacteria 35904
269 Ga0501032_0009061 3300049569 Bacteria 7227
270 Ga0501033_0000076 3300049570 Bacteria 93921
271 Ga0501033_0063150 3300049570 Bacteria 2726
272 Ga0501033_0117247 3300049570 Bacteria 1934
273 Ga0501034_0000408 3300049571 Bacteria 72244
274 Ga0501034_0019794 3300049571 Bacteria 6879
275 Ga0501034_0029785 3300049571 Bacteria 5549
276 Ga0501034_0099854 3300049571 Bacteria 2897
277 Ga0501036_0000732 3300049572 Bacteria 24258
278 Ga0501036_0004136 3300049572 Bacteria 11673
279 Ga0501036_0008383 3300049572 Bacteria 8471
280 Ga0501036_0065059 3300049572 Bacteria 3086
281 Ga0501036_0184411 3300049572 Bacteria 1756
282 Ga0501036_0454822 3300049572 Bacteria 1067
283 Ga0501037_0001237 3300049573 Bacteria 18816
284 Ga0501037_0011560 3300049573 Bacteria 6497
285 Ga0501038_0000327 3300049574 Bacteria 40996
286 Ga0501038_0018426 3300049574 Bacteria 6303
287 Ga0501038_0077535 3300049574 Bacteria 2805
288 Ga0501038_0120811 3300049574 Bacteria 2161
289 Ga0501039_0000038 3300049575 Bacteria 119484
290 Ga0501039_0001634 3300049575 Bacteria 16529
291 Ga0501039_0012032 3300049575 Bacteria 6594
292 Ga0501039_0020593 3300049575 Bacteria 5054
293 Ga0501039_0046812 3300049575 Bacteria 3342
294 Ga0501039_0092456 3300049575 Bacteria 2358
295 Ga0501039_0156029 3300049575 Bacteria 1793
296 Ga0501040_0000644 3300049576 Bacteria 21398
297 Ga0501040_0006750 3300049576 Bacteria 7448
298 Ga0501040_0011470 3300049576 Bacteria 5803
299 Ga0501040_0019445 3300049576 Bacteria 4517
300 Ga0501040_0023149 3300049576 Bacteria 4163
301 Ga0501040_0123171 3300049576 Bacteria 1820
302 Ga0501041_0000041 3300049577 Bacteria 43676
303 Ga0501041_0018700 3300049577 Bacteria 4127
304 Ga0501041_0205262 3300049577 Bacteria 1236
305 Ga0501042_0004710 3300049578 Bacteria 8702
306 Ga0501042_0096304 3300049578 Bacteria 2126
307 Ga0501043_0000043 3300049579 Bacteria 115410
308 Ga0501043_0039334 3300049579 Bacteria 3717
309 Ga0501043_0065479 3300049579 Bacteria 2854
310 Ga0501043_0140568 3300049579 Bacteria 1891
311 Ga0501043_0236176 3300049579 Bacteria 1411
312 Ga0501046_0005202 3300049580 Bacteria 11644
313 Ga0501046_0039669 3300049580 Bacteria 3769
314 Ga0501046_0050621 3300049580 Bacteria 3280
315 Ga0501046_0440655 3300049580 Bacteria 937
316 Ga0501047_0403029 3300049581 Bacteria 1200
317 Ga0501048_0003684 3300049582 Bacteria 11679
318 Ga0501048_0008033 3300049582 Bacteria 7991
319 Ga0501048_0018650 3300049582 Bacteria 5102
320 Ga0501048_0021566 3300049582 Bacteria 4716
321 Ga0501048_0028936 3300049582 Bacteria 4021
322 Ga0501068_0014912 3300049584 Bacteria 4453
323 Ga0501068_0050017 3300049584 Bacteria 2526
324 Ga0501068_0066091 3300049584 Bacteria 2202
325 Ga0501068_0097067 3300049584 Bacteria 1823
326 Ga0501069_0016689 3300049585 Bacteria 3945
327 Ga0501069_0042773 3300049585 Bacteria 2507
328 Ga0501070_0003803 3300049586 Bacteria 13032
329 Ga0501070_0017371 3300049586 Bacteria 6038
330 Ga0501070_0022548 3300049586 Bacteria 5274
331 Ga0501070_0052488 3300049586 Bacteria 3384
332 Ga0501070_0130267 3300049586 Bacteria 2078
333 Ga0501070_0429868 3300049586 Bacteria 1066
334 Ga0501071_0002147 3300049587 Bacteria 11850
335 Ga0501071_0020088 3300049587 Bacteria 4641
336 Ga0501071_0028574 3300049587 Bacteria 3931
337 Ga0501071_0109389 3300049587 Bacteria 2042
338 Ga0501071_0143522 3300049587 Bacteria 1779
339 Ga0501071_0249642 3300049587 Bacteria 1339
340 Ga0501072_0004310 3300049588 Bacteria 10802
341 Ga0501072_0004987 3300049588 Bacteria 10098
342 Ga0501072_0009228 3300049588 Bacteria 7496
343 Ga0501072_0054446 3300049588 Bacteria 3152
344 Ga0501072_0071405 3300049588 Bacteria 2743
345 Ga0501072_0115259 3300049588 Bacteria 2140
346 Ga0501072_0194415 3300049588 Bacteria 1618
347 Ga0501072_0246035 3300049588 Bacteria 1424
348 Ga0501073_0025063 3300049589 Bacteria 4281
349 Ga0501073_0192654 3300049589 Bacteria 1411
350 Ga0501074_0091986 3300049590 Bacteria 2172
351 Ga0501074_0096150 3300049590 Bacteria 2121
352 Ga0501074_0104748 3300049590 Bacteria 2025
353 Ga0501075_0004593 3300049591 Bacteria 9363
354 Ga0501075_0030436 3300049591 Bacteria 3998
355 Ga0501075_0042203 3300049591 Bacteria 3419
356 Ga0501075_0050870 3300049591 Bacteria 3115
357 Ga0501075_0072902 3300049591 Bacteria 2596
358 Ga0501076_0000358 3300049592 Bacteria 28280
359 Ga0501076_0002210 3300049592 Bacteria 13326
360 Ga0501076_0010999 3300049592 Bacteria 6729
361 Ga0501076_0042829 3300049592 Bacteria 3565
362 Ga0501076_0052442 3300049592 Bacteria 3231
363 Ga0501076_0096494 3300049592 Bacteria 2381
364 Ga0501077_0001327 3300049593 Bacteria 14941
365 Ga0501077_0015170 3300049593 Bacteria 4845
366 Ga0501077_0028765 3300049593 Bacteria 3532
367 Ga0501077_0154474 3300049593 Bacteria 1456
368 Ga0501079_0005335 3300049741 Bacteria 9566
369 Ga0501079_0010368 3300049741 Bacteria 7082
370 Ga0501079_0020344 3300049741 Bacteria 5071
371 Ga0501079_0033238 3300049741 Bacteria 3967
372 Ga0501079_0062452 3300049741 Bacteria 2874
373 Ga0501080_0029601 3300049742 Bacteria 5099
374 Ga0501080_0058206 3300049742 Bacteria 3597
375 Ga0501080_0184913 3300049742 Bacteria 1916
376 Ga0501080_0406198 3300049742 Bacteria 1225
377 Ga0501081_0001548 3300049743 Bacteria 14146
378 Ga0501081_0002779 3300049743 Bacteria 11100
379 Ga0501081_0020348 3300049743 Bacteria 4422
380 Ga0501081_0033882 3300049743 Bacteria 3472
381 Ga0501081_0048971 3300049743 Bacteria 2908
382 Ga0501083_0014480 3300049744 Bacteria 5515
383 Ga0501035_0000297 3300049822 Bacteria 58749
384 Ga0501035_0052523 3300049822 Bacteria 3647
385 Ga0501035_0125150 3300049822 Bacteria 2244
386 Ga0501044_0002434 3300049823 Bacteria 21234
387 Ga0501044_0006808 3300049823 Bacteria 12594
388 Ga0501044_0008906 3300049823 Bacteria 10968
389 Ga0501044_0141134 3300049823 Bacteria 2397
390 Ga0501045_0003777 3300049824 Bacteria 10412
391 Ga0501045_0005096 3300049824 Bacteria 9094
392 Ga0501045_0054358 3300049824 Bacteria 2927
393 Ga0501045_0103653 3300049824 Bacteria 2107
394 nmdc:mga03n38_84888_c1 3300050490 Bacteria 1496
395 nmdc:mga00v17_107644_c1 3300050491 Bacteria 1766
396 nmdc:mga00v17_66853_c1 3300050491 Bacteria 2220
397 nmdc:mga00v17_7334_c1 3300050491 Bacteria 5878
398 nmdc:mga0yw44_113082_c1 3300050492 Bacteria 1742
399 nmdc:mga0yw44_31784_c1 3300050492 Bacteria 3072
400 nmdc:mga0yw44_42326_c1 3300050492 Bacteria 2716
401 nmdc:mga06z11_94440_c1 3300050494 Bacteria 1630
402 nmdc:mga04h51_30016_c1 3300050495 Bacteria 1708
403 nmdc:mga05p37_16158_c1 3300050507 Bacteria 8986
404 nmdc:mga05p37_365417_c1 3300050507 Bacteria 1695
405 nmdc:mga09592_10485_c1 3300050508 Bacteria 7541
406 nmdc:mga06r32_225755_c1 3300050510 Bacteria 1861
407 nmdc:mga06r32_336973_c1 3300050510 Bacteria 1493
408 nmdc:mga08y16_37034_c1 3300050511 Bacteria 5123
409 nmdc:mga08y16_523771_c1 3300050511 Bacteria 1202
410 nmdc:mga08y16_5412_c1 3300050511 Bacteria 13347
411 nmdc:mga0a205_86592_c1 3300050515 Bacteria 3026
412 Ga0500616_0000960 3300053153 Bacteria 31268
413 Ga0501084_0000537 3300054114 Bacteria 28931
414 Ga0501084_0011228 3300054114 Bacteria 7416
415 Ga0501084_0011521 3300054114 Bacteria 7322
416 Ga0501084_0042023 3300054114 Bacteria 3823
417 Ga0501084_0044728 3300054114 Bacteria 3707
418 Ga0501084_0101663 3300054114 Bacteria 2414
419 Ga0590077_009851 3300059426 Bacteria 1964
420 Ga0501082_0005062 3300060353 Bacteria 11490
421 Ga0501082_0007583 3300060353 Bacteria 9361
422 Ga0501082_0049885 3300060353 Bacteria 3609
423 Ga0501082_0113029 3300060353 Bacteria 2351
424 Ga0530510_0002990 3300061734 Bacteria 11592
425 Ga0530510_0008159 3300061734 Bacteria 7305
426 Ga0530510_0018623 3300061734 Bacteria 4923
427 Ga0530510_0026348 3300061734 Bacteria 4161
428 Ga0530510_0027665 3300061734 Bacteria 4063
429 Ga0530510_0086552 3300061734 Bacteria 2283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0062499 Ga0495604_0062499_1963_2820 231
2 3300049575 Ga0501039_0156029 Ga0501039_0156029_29_817 231
3 3300049580 Ga0501046_0440655 Ga0501046_0440655_11_898 247
4 3300047317 Ga0495604_0133123 Ga0495604_0133123_886_1767 250
5 3300041451 Ga0451791_0601961 Ga0451791_0601961_84_989 253
6 3300025912 Ga0207707_10318769 Ga0207707_103187692 255
7 3300049571 Ga0501034_0029785 Ga0501034_0029785_683_1720 258
8 3300036647 Ga0316582_0056047 Ga0316582_0056047_1565_2494 270
9 3300042876 Ga0451577_0001248 Ga0451577_0001248_26472_27500 272
10 3300044712 Ga0453684_0013114 Ga0453684_0013114_6649_7677 272
11 3300048914 Ga0496111_0047167 Ga0496111_0047167_10_969 272
12 3300006051 Ga0075364_10119525 Ga0075364_101195252 274
13 3300006178 Ga0075367_10033396 Ga0075367_100333962 274
14 3300050491 nmdc:mga00v17_107644_c1 nmdc:mga00v17_107644_c1_385_1422 274
15 3300035724 Ga0373933_0030727 Ga0373933_0030727_1017_2036 279
16 3300036401 Ga0373937_0007086 Ga0373937_0007086_1135_2154 279
17 3300046679 Ga0495623_0076282 Ga0495623_0076282_311_1330 279
18 3300048088 Ga0495602_0089710 Ga0495602_0089710_1286_2305 279
19 3300042145 Ga0450906_006789 Ga0450906_006789_438_1418 281
20 3300013102 Ga0157371_10293409 Ga0157371_102934091 283
21 3300050511 nmdc:mga08y16_37034_c1 nmdc:mga08y16_37034_c1_623_1660 283
22 3300042004 Ga0439445_0020970 Ga0439445_0020970_50_1030 286
23 3300042461 Ga0439460_0026604 Ga0439460_0026604_17_1006 286
24 3300048917 Ga0496114_0244696 Ga0496114_0244696_44_1027 286
25 3300050490 nmdc:mga03n38_84888_c1 nmdc:mga03n38_84888_c1_234_1304 286
26 3300050510 nmdc:mga06r32_336973_c1 nmdc:mga06r32_336973_c1_11_991 286
27 3300048913 Ga0496110_0088882 Ga0496110_0088882_21_1010 287
28 3300049568 Ga0501031_0071940 Ga0501031_0071940_18_1007 287
29 3300049570 Ga0501033_0063150 Ga0501033_0063150_997_1986 287
30 3300049572 Ga0501036_0008383 Ga0501036_0008383_579_1568 287
31 3300049574 Ga0501038_0077535 Ga0501038_0077535_787_1776 287
32 3300049575 Ga0501039_0020593 Ga0501039_0020593_3810_4799 287
33 3300049576 Ga0501040_0023149 Ga0501040_0023149_885_1874 287
34 3300049578 Ga0501042_0004710 Ga0501042_0004710_938_1927 287
35 3300049580 Ga0501046_0050621 Ga0501046_0050621_1256_2245 287
36 3300049582 Ga0501048_0008033 Ga0501048_0008033_6901_7890 287
37 3300049584 Ga0501068_0097067 Ga0501068_0097067_697_1686 287
38 3300049585 Ga0501069_0016689 Ga0501069_0016689_2790_3779 287
39 3300049586 Ga0501070_0052488 Ga0501070_0052488_1074_2063 287
40 3300049588 Ga0501072_0004310 Ga0501072_0004310_2842_3831 287
41 3300049589 Ga0501073_0025063 Ga0501073_0025063_3106_4095 287
42 3300049591 Ga0501075_0042203 Ga0501075_0042203_1501_2490 287
43 3300049593 Ga0501077_0028765 Ga0501077_0028765_254_1243 287
44 3300049741 Ga0501079_0033238 Ga0501079_0033238_137_1126 287
45 3300049742 Ga0501080_0058206 Ga0501080_0058206_2039_3028 287
46 3300049743 Ga0501081_0002779 Ga0501081_0002779_7041_8030 287
47 3300049822 Ga0501035_0125150 Ga0501035_0125150_10_999 287
48 3300049824 Ga0501045_0003777 Ga0501045_0003777_5809_6798 287
49 3300061734 Ga0530510_0008159 Ga0530510_0008159_3778_4767 287
50 3300031911 Ga0307412_10164645 Ga0307412_101646452 288
51 3300006038 Ga0075365_10028261 Ga0075365_100282612 292
52 3300006048 Ga0075363_100068733 Ga0075363_1000687332 292
53 3300006051 Ga0075364_10009629 Ga0075364_100096294 292
54 3300006051 Ga0075364_10029585 Ga0075364_100295851 292
55 3300006186 Ga0075369_10092378 Ga0075369_100923781 292
56 3300009094 Ga0111539_10199506 Ga0111539_101995062 292
57 3300009098 Ga0105245_10253108 Ga0105245_102531082 292
58 3300009177 Ga0105248_10224640 Ga0105248_102246402 292
59 3300027866 Ga0209813_10014109 Ga0209813_100141093 292
60 3300028381 Ga0268264_10029231 Ga0268264_100292314 292
61 3300049572 Ga0501036_0454822 Ga0501036_0454822_37_1056 292
62 3300049584 Ga0501068_0050017 Ga0501068_0050017_74_1087 292
63 3300049585 Ga0501069_0042773 Ga0501069_0042773_181_1194 292
64 3300049586 Ga0501070_0022548 Ga0501070_0022548_2633_3643 292
65 3300049586 Ga0501070_0130267 Ga0501070_0130267_264_1277 292
66 3300049590 Ga0501074_0091986 Ga0501074_0091986_680_1693 292
67 3300050491 nmdc:mga00v17_7334_c1 nmdc:mga00v17_7334_c1_1609_2697 292
68 3300050492 nmdc:mga0yw44_113082_c1 nmdc:mga0yw44_113082_c1_132_1226 292
69 3300050492 nmdc:mga0yw44_42326_c1 nmdc:mga0yw44_42326_c1_47_1135 292
70 3300050495 nmdc:mga04h51_30016_c1 nmdc:mga04h51_30016_c1_507_1607 292
71 iso_pu_bacteria 2547132424 2548699661 292
72 iso_pu_bacteria 2643221692 2644517915 292
73 iso_pu_bacteria 8054472261 8054478182 292
74 3300046535 Ga0495586_0039760 Ga0495586_0039760_1460_2464 293
75 iso_pu_bacteria 2915358134 2915361381 293
76 3300049581 Ga0501047_0403029 Ga0501047_0403029_34_1074 294
77 iso_pu_bacteria 2739367700 2739731862 295
78 3300005329 Ga0070683_100061834 Ga0070683_1000618344 296
79 3300005336 Ga0070680_100023937 Ga0070680_1000239373 296
80 3300005338 Ga0068868_100011240 Ga0068868_1000112407 296
81 3300005354 Ga0070675_100339721 Ga0070675_1003397211 296
82 3300005355 Ga0070671_100001807 Ga0070671_10000180712 296
83 3300005355 Ga0070671_100006081 Ga0070671_1000060814 296
84 3300005366 Ga0070659_100006640 Ga0070659_10000664011 296
85 3300005367 Ga0070667_100170015 Ga0070667_1001700152 296
86 3300005436 Ga0070713_100310211 Ga0070713_1003102111 296
87 3300005438 Ga0070701_10011059 Ga0070701_100110595 296
88 3300005441 Ga0070700_100000905 Ga0070700_1000009056 296
89 3300005444 Ga0070694_100103720 Ga0070694_1001037202 296
90 3300005445 Ga0070708_100013534 Ga0070708_1000135345 296
91 3300005457 Ga0070662_100024826 Ga0070662_1000248264 296
92 3300005457 Ga0070662_100326167 Ga0070662_1003261672 296
93 3300005459 Ga0068867_100138996 Ga0068867_1001389961 296
94 3300005545 Ga0070695_100001613 Ga0070695_1000016136 296
95 3300005545 Ga0070695_100002384 Ga0070695_1000023843 296
96 3300005546 Ga0070696_100002164 Ga0070696_1000021643 296
97 3300005547 Ga0070693_100051200 Ga0070693_1000512001 296
98 3300005548 Ga0070665_100005066 Ga0070665_1000050663 296
99 3300005549 Ga0070704_100004175 Ga0070704_1000041755 296
100 3300005563 Ga0068855_100343845 Ga0068855_1003438452 296
101 3300005577 Ga0068857_100007483 Ga0068857_1000074833 296
102 3300005617 Ga0068859_100001348 Ga0068859_10000134822 296
103 3300005617 Ga0068859_100388664 Ga0068859_1003886642 296
104 3300005618 Ga0068864_100090428 Ga0068864_1000904282 296
105 3300005843 Ga0068860_100003791 Ga0068860_10000379113 296
106 3300005843 Ga0068860_100078561 Ga0068860_1000785612 296
107 3300005844 Ga0068862_100000857 Ga0068862_10000085717 296
108 3300005937 Ga0081455_10005251 Ga0081455_100052514 296
109 3300005981 Ga0081538_10002653 Ga0081538_1000265320 296
110 3300005981 Ga0081538_10006298 Ga0081538_100062985 296
111 3300005981 Ga0081538_10008161 Ga0081538_100081617 296
112 3300005981 Ga0081538_10032120 Ga0081538_100321202 296
113 3300005983 Ga0081540_1026541 Ga0081540_10265411 296
114 3300005985 Ga0081539_10030876 Ga0081539_100308763 296
115 3300006175 Ga0070712_100000166 Ga0070712_10000016616 296
116 3300006237 Ga0097621_100090018 Ga0097621_1000900181 296
117 3300006358 Ga0068871_100108987 Ga0068871_1001089874 296
118 3300006881 Ga0068865_100096598 Ga0068865_1000965982 296
119 3300006931 Ga0097620_100001348 Ga0097620_10000134822 296
120 3300006931 Ga0097620_100388686 Ga0097620_1003886861 296
121 3300009093 Ga0105240_10021393 Ga0105240_100213935 296
122 3300009098 Ga0105245_10414192 Ga0105245_104141922 296
123 3300009147 Ga0114129_10201962 Ga0114129_102019622 296
124 3300009553 Ga0105249_10000689 Ga0105249_1000068921 296
125 3300009553 Ga0105249_10023074 Ga0105249_100230742 296
126 3300013306 Ga0163162_10041190 Ga0163162_100411903 296
127 3300014968 Ga0157379_10051750 Ga0157379_100517502 296
128 3300017792 Ga0163161_10244340 Ga0163161_102443402 296
129 3300021384 Ga0213876_10000006 Ga0213876_10000006364 296
130 3300025900 Ga0207710_10000075 Ga0207710_10000075102 296
131 3300025915 Ga0207693_10000568 Ga0207693_1000056814 296
132 3300025917 Ga0207660_10003438 Ga0207660_100034384 296
133 3300025921 Ga0207652_10182707 Ga0207652_101827072 296
134 3300025931 Ga0207644_10000715 Ga0207644_1000071518 296
135 3300025933 Ga0207706_10109510 Ga0207706_101095102 296
136 3300025940 Ga0207691_10024313 Ga0207691_100243135 296
137 3300025941 Ga0207711_10003152 Ga0207711_100031526 296
138 3300025944 Ga0207661_10034492 Ga0207661_100344922 296
139 3300025949 Ga0207667_10118603 Ga0207667_101186033 296
140 3300025961 Ga0207712_10000968 Ga0207712_100009685 296
141 3300025961 Ga0207712_10105774 Ga0207712_101057742 296
142 3300026023 Ga0207677_10028144 Ga0207677_100281442 296
143 3300026067 Ga0207678_10007443 Ga0207678_100074431 296
144 3300026075 Ga0207708_10002109 Ga0207708_1000210912 296
145 3300026088 Ga0207641_10223755 Ga0207641_102237552 296
146 3300026089 Ga0207648_10038173 Ga0207648_100381734 296
147 3300026095 Ga0207676_10263723 Ga0207676_102637232 296
148 3300026116 Ga0207674_10006620 Ga0207674_100066206 296
149 3300026118 Ga0207675_100003257 Ga0207675_1000032572 296
150 3300028379 Ga0268266_10007788 Ga0268266_100077883 296
151 3300028380 Ga0268265_10000953 Ga0268265_1000095314 296
152 3300028381 Ga0268264_10091493 Ga0268264_100914932 296
153 3300028556 Ga0265337_1000773 Ga0265337_100077310 296
154 3300028573 Ga0265334_10039480 Ga0265334_100394802 296
155 3300028800 Ga0265338_10006913 Ga0265338_100069138 296
156 3300028800 Ga0265338_10024317 Ga0265338_100243172 296
157 3300031235 Ga0265330_10000334 Ga0265330_1000033415 296
158 3300031235 Ga0265330_10116419 Ga0265330_101164191 296
159 3300031238 Ga0265332_10000011 Ga0265332_10000011253 296
160 3300031240 Ga0265320_10000112 Ga0265320_1000011226 296
161 3300031241 Ga0265325_10004351 Ga0265325_100043516 296
162 3300031247 Ga0265340_10029952 Ga0265340_100299522 296
163 3300031251 Ga0265327_10002260 Ga0265327_1000226011 296
164 3300031711 Ga0265314_10000026 Ga0265314_1000002615 296
165 3300031711 Ga0265314_10015998 Ga0265314_100159984 296
166 3300031728 Ga0316578_10073047 Ga0316578_100730472 296
167 3300031731 Ga0307405_10009033 Ga0307405_100090333 296
168 3300031731 Ga0307405_10068022 Ga0307405_100680222 296
169 3300031852 Ga0307410_10103768 Ga0307410_101037682 296
170 3300031901 Ga0307406_10054646 Ga0307406_100546463 296
171 3300031901 Ga0307406_10074429 Ga0307406_100744292 296
172 3300031903 Ga0307407_10173547 Ga0307407_101735471 296
173 3300031911 Ga0307412_10208893 Ga0307412_102088932 296
174 3300031995 Ga0307409_100002536 Ga0307409_1000025366 296
175 3300031995 Ga0307409_100006733 Ga0307409_1000067332 296
176 3300031995 Ga0307409_100007311 Ga0307409_1000073111 296
177 3300031995 Ga0307409_100144240 Ga0307409_1001442402 296
178 3300032002 Ga0307416_100007237 Ga0307416_1000072376 296
179 3300032002 Ga0307416_100030743 Ga0307416_1000307431 296
180 3300032002 Ga0307416_100252178 Ga0307416_1002521782 296
181 3300032005 Ga0307411_10188716 Ga0307411_101887161 296
182 3300032126 Ga0307415_100000408 Ga0307415_10000040810 296
183 3300032126 Ga0307415_100053379 Ga0307415_1000533792 296
184 3300032126 Ga0307415_100122832 Ga0307415_1001228322 296
185 3300032126 Ga0307415_100192256 Ga0307415_1001922562 296
186 3300035114 Ga0373939_0057082 Ga0373939_0057082_164_1180 296
187 3300035691 Ga0373931_0004827 Ga0373931_0004827_3661_4677 296
188 3300035724 Ga0373933_0181537 Ga0373933_0181537_234_1286 296
189 3300037466 Ga0395898_0034173 Ga0395898_0034173_3196_4218 296
190 3300038443 Ga0395901_0005805 Ga0395901_0005805_2489_3511 296
191 3300039437 Ga0436365_0695157 Ga0436365_0695157_220358_221371 296
192 3300039447 Ga0436361_0719257 Ga0436361_0719257_1953_2969 296
193 3300042008 Ga0439450_000239 Ga0439450_000239_242_1261 296
194 3300042011 Ga0439454_002916 Ga0439454_002916_796_1815 296
195 3300042011 Ga0439454_003959 Ga0439454_003959_564_1583 296
196 3300042012 Ga0439455_0016417 Ga0439455_0016417_384_1403 296
197 3300042016 Ga0439463_003650 Ga0439463_003650_2090_3109 296
198 3300042117 Ga0450913_000570 Ga0450913_000570_230_1249 296
199 3300042118 Ga0450914_000018 Ga0450914_000018_626_1645 296
200 3300042136 Ga0450900_000024 Ga0450900_000024_183_1202 296
201 3300042137 Ga0450902_011412 Ga0450902_011412_145_1164 296
202 3300042142 Ga0450905_006030 Ga0450905_006030_597_1616 296
203 3300042439 Ga0439464_0000011 Ga0439464_0000011_3645_4664 296
204 3300042461 Ga0439460_0000304 Ga0439460_0000304_2792_3811 296
205 3300042993 Ga0439440_0000047 Ga0439440_0000047_14126_15145 296
206 3300044658 Ga0466972_0044203 Ga0466972_0044203_994_2013 296
207 3300044765 Ga0466970_0022748 Ga0466970_0022748_1362_2381 296
208 3300044901 Ga0466960_0002291 Ga0466960_0002291_2240_3259 296
209 3300045976 Ga0466967_0069873 Ga0466967_0069873_1848_2870 296
210 3300045976 Ga0466967_0291584 Ga0466967_0291584_291_1313 296
211 3300046455 Ga0495603_0043807 Ga0495603_0043807_1013_2023 296
212 3300046500 Ga0495596_0079654 Ga0495596_0079654_31_1050 296
213 3300046529 Ga0495652_0126877 Ga0495652_0126877_867_1919 296
214 3300046536 Ga0495587_0040405 Ga0495587_0040405_1273_2325 296
215 3300046539 Ga0495621_0031938 Ga0495621_0031938_711_1730 296
216 3300046543 Ga0495645_0104401 Ga0495645_0104401_711_1763 296
217 3300046559 Ga0495667_0017038 Ga0495667_0017038_2653_3705 296
218 3300046665 Ga0495661_0059452 Ga0495661_0059452_721_1740 296
219 3300046674 Ga0495588_0100877 Ga0495588_0100877_302_1312 296
220 3300046675 Ga0495657_0003529 Ga0495657_0003529_1232_2284 296
221 3300046679 Ga0495623_0010251 Ga0495623_0010251_1427_2479 296
222 3300046809 Ga0495600_0012159 Ga0495600_0012159_3094_4146 296
223 3300047317 Ga0495604_0166138 Ga0495604_0166138_84_1097 296
224 3300047319 Ga0495674_0057900 Ga0495674_0057900_1770_2783 296
225 3300047322 Ga0495680_0003435 Ga0495680_0003435_14498_15550 296
226 3300047445 Ga0495677_0055770 Ga0495677_0055770_333_1352 296
227 3300048904 Ga0496101_0302785 Ga0496101_0302785_123_1103 296
228 3300048905 Ga0496102_0007192 Ga0496102_0007192_636_1616 296
229 3300048908 Ga0496105_0055659 Ga0496105_0055659_1144_2124 296
230 3300048909 Ga0496106_0002017 Ga0496106_0002017_6110_7090 296
231 3300048910 Ga0496107_0000548 Ga0496107_0000548_6489_7469 296
232 3300048912 Ga0496109_0100151 Ga0496109_0100151_413_1471 296
233 3300048917 Ga0496114_0145530 Ga0496114_0145530_461_1471 296
234 3300048918 Ga0496115_0037181 Ga0496115_0037181_577_1557 296
235 3300048922 Ga0496119_0002598 Ga0496119_0002598_17197_18213 296
236 3300048923 Ga0496120_0000784 Ga0496120_0000784_20500_21516 296
237 3300049568 Ga0501031_0001615 Ga0501031_0001615_7090_8109 296
238 3300049568 Ga0501031_0020481 Ga0501031_0020481_2353_3387 296
239 3300049568 Ga0501031_0047613 Ga0501031_0047613_607_1608 296
240 3300049569 Ga0501032_0000399 Ga0501032_0000399_18785_19786 296
241 3300049570 Ga0501033_0000076 Ga0501033_0000076_17472_18473 296
242 3300049570 Ga0501033_0117247 Ga0501033_0117247_668_1687 296
243 3300049571 Ga0501034_0000408 Ga0501034_0000408_35260_36261 296
244 3300049572 Ga0501036_0000732 Ga0501036_0000732_21360_22361 296
245 3300049572 Ga0501036_0004136 Ga0501036_0004136_10261_11280 296
246 3300049572 Ga0501036_0184411 Ga0501036_0184411_144_1178 296
247 3300049573 Ga0501037_0001237 Ga0501037_0001237_1508_2509 296
248 3300049574 Ga0501038_0000327 Ga0501038_0000327_16517_17518 296
249 3300049575 Ga0501039_0000038 Ga0501039_0000038_93889_94890 296
250 3300049575 Ga0501039_0001634 Ga0501039_0001634_6659_7678 296
251 3300049575 Ga0501039_0046812 Ga0501039_0046812_951_1985 296
252 3300049575 Ga0501039_0092456 Ga0501039_0092456_782_1816 296
253 3300049576 Ga0501040_0000644 Ga0501040_0000644_4509_5528 296
254 3300049576 Ga0501040_0019445 Ga0501040_0019445_1905_2939 296
255 3300049576 Ga0501040_0123171 Ga0501040_0123171_139_1173 296
256 3300049577 Ga0501041_0000041 Ga0501041_0000041_4415_5434 296
257 3300049577 Ga0501041_0018700 Ga0501041_0018700_1753_2787 296
258 3300049577 Ga0501041_0205262 Ga0501041_0205262_148_1167 296
259 3300049578 Ga0501042_0096304 Ga0501042_0096304_712_1692 296
260 3300049579 Ga0501043_0000043 Ga0501043_0000043_22195_23196 296
261 3300049579 Ga0501043_0065479 Ga0501043_0065479_1313_2332 296
262 3300049579 Ga0501043_0236176 Ga0501043_0236176_327_1361 296
263 3300049580 Ga0501046_0005202 Ga0501046_0005202_4672_5691 296
264 3300049582 Ga0501048_0003684 Ga0501048_0003684_9887_10906 296
265 3300049582 Ga0501048_0018650 Ga0501048_0018650_2569_3603 296
266 3300049584 Ga0501068_0014912 Ga0501068_0014912_67_1086 296
267 3300049586 Ga0501070_0017371 Ga0501070_0017371_4324_5337 296
268 3300049586 Ga0501070_0429868 Ga0501070_0429868_64_1044 296
269 3300049587 Ga0501071_0109389 Ga0501071_0109389_244_1278 296
270 3300049587 Ga0501071_0143522 Ga0501071_0143522_498_1478 296
271 3300049587 Ga0501071_0249642 Ga0501071_0249642_222_1316 296
272 3300049588 Ga0501072_0054446 Ga0501072_0054446_639_1673 296
273 3300049588 Ga0501072_0071405 Ga0501072_0071405_724_1704 296
274 3300049588 Ga0501072_0115259 Ga0501072_0115259_871_1905 296
275 3300049588 Ga0501072_0194415 Ga0501072_0194415_272_1255 296
276 3300049588 Ga0501072_0246035 Ga0501072_0246035_386_1405 296
277 3300049589 Ga0501073_0192654 Ga0501073_0192654_347_1327 296
278 3300049591 Ga0501075_0050870 Ga0501075_0050870_1403_2437 296
279 3300049592 Ga0501076_0002210 Ga0501076_0002210_7886_8905 296
280 3300049592 Ga0501076_0010999 Ga0501076_0010999_890_1870 296
281 3300049592 Ga0501076_0096494 Ga0501076_0096494_831_1865 296
282 3300049593 Ga0501077_0001327 Ga0501077_0001327_6395_7414 296
283 3300049593 Ga0501077_0154474 Ga0501077_0154474_394_1377 296
284 3300049741 Ga0501079_0005335 Ga0501079_0005335_3923_4942 296
285 3300049741 Ga0501079_0020344 Ga0501079_0020344_2902_3882 296
286 3300049741 Ga0501079_0062452 Ga0501079_0062452_1321_2355 296
287 3300049742 Ga0501080_0029601 Ga0501080_0029601_247_1227 296
288 3300049742 Ga0501080_0406198 Ga0501080_0406198_108_1127 296
289 3300049743 Ga0501081_0001548 Ga0501081_0001548_7160_8179 296
290 3300049743 Ga0501081_0033882 Ga0501081_0033882_1035_2018 296
291 3300049822 Ga0501035_0000297 Ga0501035_0000297_38057_39058 296
292 3300049823 Ga0501044_0006808 Ga0501044_0006808_9296_10315 296
293 3300049823 Ga0501044_0008906 Ga0501044_0008906_1448_2449 296
294 3300049824 Ga0501045_0054358 Ga0501045_0054358_1182_2216 296
295 3300050491 nmdc:mga00v17_66853_c1 nmdc:mga00v17_66853_c1_378_1487 296
296 3300050492 nmdc:mga0yw44_31784_c1 nmdc:mga0yw44_31784_c1_1592_2692 296
297 3300050494 nmdc:mga06z11_94440_c1 nmdc:mga06z11_94440_c1_153_1265 296
298 3300050507 nmdc:mga05p37_365417_c1 nmdc:mga05p37_365417_c1_96_1109 296
299 3300050510 nmdc:mga06r32_225755_c1 nmdc:mga06r32_225755_c1_614_1648 296
300 3300050511 nmdc:mga08y16_523771_c1 nmdc:mga08y16_523771_c1_10_1023 296
301 3300050511 nmdc:mga08y16_5412_c1 nmdc:mga08y16_5412_c1_1549_2532 296
302 3300050515 nmdc:mga0a205_86592_c1 nmdc:mga0a205_86592_c1_761_1831 296
303 3300053153 Ga0500616_0000960 Ga0500616_0000960_9847_10875 296
304 3300054114 Ga0501084_0011228 Ga0501084_0011228_1502_2521 296
305 3300054114 Ga0501084_0011521 Ga0501084_0011521_5616_6596 296
306 3300054114 Ga0501084_0101663 Ga0501084_0101663_1308_2342 296
307 3300059426 Ga0590077_009851 Ga0590077_009851_598_1668 296
308 3300060353 Ga0501082_0007583 Ga0501082_0007583_1339_2319 296
309 3300060353 Ga0501082_0049885 Ga0501082_0049885_1095_2078 296
310 3300061734 Ga0530510_0002990 Ga0530510_0002990_9887_10906 296
311 3300061734 Ga0530510_0027665 Ga0530510_0027665_188_1171 296
312 3300061734 Ga0530510_0086552 Ga0530510_0086552_966_1946 296
313 3300005329 Ga0070683_100101085 Ga0070683_1001010853 297
314 3300005345 Ga0070692_10004568 Ga0070692_100045684 297
315 3300005347 Ga0070668_100038673 Ga0070668_1000386732 297
316 3300005366 Ga0070659_100234345 Ga0070659_1002343452 297
317 3300005435 Ga0070714_100006514 Ga0070714_1000065142 297
318 3300005458 Ga0070681_10021700 Ga0070681_100217006 297
319 3300005530 Ga0070679_100006472 Ga0070679_1000064722 297
320 3300005535 Ga0070684_100154672 Ga0070684_1001546722 297
321 3300005535 Ga0070684_100181538 Ga0070684_1001815382 297
322 3300005539 Ga0068853_100222629 Ga0068853_1002226292 297
323 3300005577 Ga0068857_100235804 Ga0068857_1002358042 297
324 3300005719 Ga0068861_100340182 Ga0068861_1003401821 297
325 3300006058 Ga0075432_10039065 Ga0075432_100390652 297
326 3300006844 Ga0075428_100033770 Ga0075428_1000337704 297
327 3300006847 Ga0075431_100276086 Ga0075431_1002760863 297
328 3300006880 Ga0075429_100034779 Ga0075429_1000347792 297
329 3300009094 Ga0111539_10115992 Ga0111539_101159921 297
330 3300009098 Ga0105245_10013354 Ga0105245_100133543 297
331 3300009098 Ga0105245_10061854 Ga0105245_100618542 297
332 3300009147 Ga0114129_10063287 Ga0114129_100632875 297
333 3300010375 Ga0105239_10050058 Ga0105239_100500582 297
334 3300010375 Ga0105239_10103787 Ga0105239_101037873 297
335 3300011119 Ga0105246_10077926 Ga0105246_100779262 297
336 3300013307 Ga0157372_10300456 Ga0157372_103004562 297
337 3300014745 Ga0157377_10012433 Ga0157377_100124332 297
338 3300025901 Ga0207688_10009792 Ga0207688_100097924 297
339 3300025921 Ga0207652_10019417 Ga0207652_100194171 297
340 3300025921 Ga0207652_10090987 Ga0207652_100909873 297
341 3300025923 Ga0207681_10131571 Ga0207681_101315713 297
342 3300025927 Ga0207687_10040244 Ga0207687_100402443 297
343 3300025932 Ga0207690_10035209 Ga0207690_100352093 297
344 3300025933 Ga0207706_10033120 Ga0207706_100331204 297
345 3300025937 Ga0207669_10034654 Ga0207669_100346542 297
346 3300025938 Ga0207704_10034807 Ga0207704_100348072 297
347 3300025949 Ga0207667_10379127 Ga0207667_103791272 297
348 3300025960 Ga0207651_10134747 Ga0207651_101347472 297
349 3300025972 Ga0207668_10360280 Ga0207668_103602801 297
350 3300026041 Ga0207639_10173179 Ga0207639_101731792 297
351 3300026118 Ga0207675_100263777 Ga0207675_1002637772 297
352 3300027907 Ga0207428_10008731 Ga0207428_100087319 297
353 3300031616 Ga0307508_10018086 Ga0307508_100180863 297
354 3300031691 Ga0316579_10014802 Ga0316579_100148022 297
355 3300031728 Ga0316578_10044451 Ga0316578_100444512 297
356 3300035111 Ga0373923_0046122 Ga0373923_0046122_498_1493 297
357 3300035120 Ga0373957_0021606 Ga0373957_0021606_336_1331 297
358 3300035172 Ga0373955_0005682 Ga0373955_0005682_1013_2008 297
359 3300035410 Ga0373924_0059384 Ga0373924_0059384_302_1297 297
360 3300035724 Ga0373933_0043322 Ga0373933_0043322_1204_2199 297
361 3300036401 Ga0373937_0013759 Ga0373937_0013759_5311_6306 297
362 3300048914 Ga0496111_0032530 Ga0496111_0032530_2286_3323 297
363 3300049568 Ga0501031_0125413 Ga0501031_0125413_65_1102 297
364 3300049572 Ga0501036_0065059 Ga0501036_0065059_1566_2603 297
365 3300049574 Ga0501038_0120811 Ga0501038_0120811_59_1096 297
366 3300049575 Ga0501039_0012032 Ga0501039_0012032_4354_5391 297
367 3300049576 Ga0501040_0006750 Ga0501040_0006750_4604_5641 297
368 3300049576 Ga0501040_0011470 Ga0501040_0011470_3810_4847 297
369 3300049579 Ga0501043_0140568 Ga0501043_0140568_128_1165 297
370 3300049580 Ga0501046_0039669 Ga0501046_0039669_381_1418 297
371 3300049582 Ga0501048_0021566 Ga0501048_0021566_1699_2736 297
372 3300049582 Ga0501048_0028936 Ga0501048_0028936_982_2019 297
373 3300049584 Ga0501068_0066091 Ga0501068_0066091_755_1792 297
374 3300049587 Ga0501071_0002147 Ga0501071_0002147_5999_7036 297
375 3300049587 Ga0501071_0020088 Ga0501071_0020088_2886_3929 297
376 3300049587 Ga0501071_0028574 Ga0501071_0028574_1435_2472 297
377 3300049588 Ga0501072_0004987 Ga0501072_0004987_1314_2351 297
378 3300049588 Ga0501072_0009228 Ga0501072_0009228_2187_3224 297
379 3300049590 Ga0501074_0096150 Ga0501074_0096150_837_1880 297
380 3300049590 Ga0501074_0104748 Ga0501074_0104748_634_1671 297
381 3300049591 Ga0501075_0004593 Ga0501075_0004593_3321_4358 297
382 3300049591 Ga0501075_0030436 Ga0501075_0030436_2401_3438 297
383 3300049591 Ga0501075_0072902 Ga0501075_0072902_650_1693 297
384 3300049592 Ga0501076_0000358 Ga0501076_0000358_4556_5593 297
385 3300049592 Ga0501076_0042829 Ga0501076_0042829_1955_2992 297
386 3300049592 Ga0501076_0052442 Ga0501076_0052442_419_1462 297
387 3300049593 Ga0501077_0015170 Ga0501077_0015170_2695_3732 297
388 3300049741 Ga0501079_0010368 Ga0501079_0010368_4044_5081 297
389 3300049742 Ga0501080_0184913 Ga0501080_0184913_195_1232 297
390 3300049743 Ga0501081_0020348 Ga0501081_0020348_2239_3276 297
391 3300049743 Ga0501081_0048971 Ga0501081_0048971_1709_2746 297
392 3300049744 Ga0501083_0014480 Ga0501083_0014480_48_1085 297
393 3300049824 Ga0501045_0005096 Ga0501045_0005096_1280_2317 297
394 3300049824 Ga0501045_0103653 Ga0501045_0103653_669_1712 297
395 3300050507 nmdc:mga05p37_16158_c1 nmdc:mga05p37_16158_c1_646_1683 297
396 3300050508 nmdc:mga09592_10485_c1 nmdc:mga09592_10485_c1_619_1656 297
397 3300054114 Ga0501084_0000537 Ga0501084_0000537_22819_23856 297
398 3300054114 Ga0501084_0042023 Ga0501084_0042023_2078_3115 297
399 3300054114 Ga0501084_0044728 Ga0501084_0044728_1966_3009 297
400 3300060353 Ga0501082_0005062 Ga0501082_0005062_2454_3491 297
401 3300060353 Ga0501082_0113029 Ga0501082_0113029_1008_2045 297
402 3300061734 Ga0530510_0018623 Ga0530510_0018623_3305_4342 297
403 3300061734 Ga0530510_0026348 Ga0530510_0026348_3013_4050 297
404 3300014325 Ga0163163_10002512 Ga0163163_1000251213 298
405 3300014968 Ga0157379_10198329 Ga0157379_101983292 298
406 3300027682 Ga0209971_1004463 Ga0209971_10044632 298
407 3300027717 Ga0209998_10000642 Ga0209998_100006422 298
408 3300027876 Ga0209974_10006069 Ga0209974_100060693 298
409 3300031911 Ga0307412_10135156 Ga0307412_101351562 298
410 3300048905 Ga0496102_0016252 Ga0496102_0016252_3483_4520 298
411 3300048907 Ga0496104_0176809 Ga0496104_0176809_819_1856 298
412 3300048911 Ga0496108_0041889 Ga0496108_0041889_175_1212 298
413 3300048913 Ga0496110_0001283 Ga0496110_0001283_1508_2545 298
414 3300049569 Ga0501032_0009061 Ga0501032_0009061_4118_5224 298
415 3300049571 Ga0501034_0019794 Ga0501034_0019794_4446_5552 298
416 3300049571 Ga0501034_0099854 Ga0501034_0099854_531_1559 298
417 3300049573 Ga0501037_0011560 Ga0501037_0011560_4728_5834 298
418 3300049574 Ga0501038_0018426 Ga0501038_0018426_200_1252 298
419 3300049579 Ga0501043_0039334 Ga0501043_0039334_35_1141 298
420 3300049586 Ga0501070_0003803 Ga0501070_0003803_6534_7640 298
421 3300049822 Ga0501035_0052523 Ga0501035_0052523_367_1473 298
422 3300049823 Ga0501044_0002434 Ga0501044_0002434_16575_17681 298
423 3300049823 Ga0501044_0141134 Ga0501044_0141134_482_1510 298
424 3300005458 Ga0070681_10153536 Ga0070681_101535362 299
425 3300049460 Ga0495682_0008035 Ga0495682_0008035_541_1602 299
426 3300005327 Ga0070658_10045419 Ga0070658_100454192 300
427 3300005530 Ga0070679_100102999 Ga0070679_1001029993 300
428 3300013100 Ga0157373_10033415 Ga0157373_100334154 300
429 3300013105 Ga0157369_10006567 Ga0157369_100065678 300
430 3300013307 Ga0157372_10018223 Ga0157372_100182234 300
431 3300020082 Ga0206353_10738461 Ga0206353_107384612 300
432 3300025917 Ga0207660_10410627 Ga0207660_104106272 300
433 3300025921 Ga0207652_10016668 Ga0207652_100166684 300
434 3300025932 Ga0207690_10063945 Ga0207690_100639451 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

158

0.96

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

184

222

0.89

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

229

336

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9393 1 31
4bk1-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: h213s mutant in complex with 3-hydroxybenzoate 0.9345 2 31
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9336 2 31
7zca-assembly1.cif.gz_A-2 crystal structure of the f191m/f201a variant of variovorax paradoxus indole monooxygenase (vpinda1) in complex with benzyl phenyl sulfoxide 0.9335 1 32
2bra-assembly1.cif.gz_A structure of n-terminal fad binding motif of mouse mical 0.9334 2 31
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 2 168 3.40.50.720
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9497 2 167 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9463 1 137 3.40.50.720
3qhaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 2 162 3.40.50.720
af_O65404_36_399_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9347 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9966 1 115 GO:0004616
GO:0050661
AF-A0A525I822-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9962 1 88 GO:0004616
GO:0050661
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.996 1 153 GO:0004616
GO:0050661
AF-A0A0L0LZ89-F1-model_v4 deleted 0.995 1 115
AF-A0A521XLA1-F1-model_v4 6-phosphogluconate dehydrogenase 0.9925 1 144 GO:0004616
GO:0050661

Feature Viewer

pLDDT pTM Quality
91.28 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map