F443259
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 311 | 870 | 509 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100043907|Ga0070690_1000439072 |
| Length | 506 |
| Sequence | MSDLLVEMTGITKDFPGVHALADASFELRPGEVHALVGENGAGKSTLMKILAGVYVPDAGEIRFKGEPVQIPNPRTALDLGISMIHQELNLAPHLTVAQNIFLGREPRGRPRFLLDDRRLNQQTQELIDRLHLKLEATARVGDLKIAQQQMVEIAKALSLNAAVLVMDEPTAALTDTEIDELFRIIRDLRTDGVGVVHISHRLEELKQISDRVTVMRDGRYVATLDIADASIPVVINMMVGRTIYEEAPDIPVRSDEVVLEVRGLSRGRMVRDVSFVLHRGEILGVAGLVGAGRTELVRAIFGADRPESGEILVHGKLAAIASPADAVQLGIAYLSEDRKRYGLALGLDVETNVVLASLQTFLSSLGRVDTRRTRAVAEQRVQDLGIKTPSVRQHARNLSGGTQQKVVIAKWLTADTDILIFDEPTRGIDVGAKSEIYHLLNELARDGKAIIMISSELPEILRMSHRVIVMCEGRLTGELIGPAATQEAIMTLATQRESVAEAVPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 158 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 159 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 162 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 163 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 168 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 176 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 177 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 183 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 184 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 185 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 186 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 221 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 222 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 223 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 224 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 225 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 231 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 232 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 235 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 236 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 237 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 238 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 239 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 240 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 241 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 242 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 243 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 244 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 245 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 246 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 247 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 248 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 249 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 250 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 251 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 252 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 253 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 254 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 255 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 256 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 257 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 258 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 259 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 260 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 261 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 262 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 263 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 264 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 265 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 266 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 267 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 268 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 269 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 270 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 271 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 272 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 273 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 274 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 275 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 276 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 277 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 278 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 279 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 280 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 281 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 282 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 283 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 284 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 285 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 286 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 287 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 288 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 289 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 290 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 291 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 292 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 293 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 294 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 295 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 296 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 297 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 298 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 299 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 300 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 301 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 302 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 303 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 304 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 305 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 306 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 307 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 308 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 309 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 310 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 311 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.3 |
| Metatranscriptomes | 0.92 |
| Isolates | 16.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.71 |
| Nodule | 3.45 |
| Rhizoplane | 1.84 |
| Rhizosphere | 57.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100043907 | 3300005330 | Bacteria | 2836 |
| 2 | JGI24739J22299_10011619 | 3300001989 | Bacteria | 3248 |
| 3 | JGI25155J39150_1000760 | 3300002704 | Bacteria | 5361 |
| 4 | JGI25156J39149_1000043 | 3300002705 | Bacteria | 105452 |
| 5 | JGI25156J39149_1000098 | 3300002705 | Bacteria | 64288 |
| 6 | JGI25156J39149_1005401 | 3300002705 | Bacteria | 3693 |
| 7 | JGI25162J39368_1000021 | 3300002737 | Bacteria | 248155 |
| 8 | JGI25154J39366_1000062 | 3300002738 | Bacteria | 105525 |
| 9 | JGI25154J39366_1000519 | 3300002738 | Bacteria | 19394 |
| 10 | JGI25154J39366_1003133 | 3300002738 | Bacteria | 3686 |
| 11 | JGI25157J39369_1000060 | 3300002741 | Bacteria | 105525 |
| 12 | JGI25157J39369_1000102 | 3300002741 | Bacteria | 72343 |
| 13 | JGI25157J39369_1000668 | 3300002741 | Bacteria | 18866 |
| 14 | JGI25159J45721_1000163 | 3300002987 | Bacteria | 31237 |
| 15 | JGI25165J46597_1000049 | 3300003214 | Bacteria | 248154 |
| 16 | JGI25160J50197_1000174 | 3300003354 | Bacteria | 54817 |
| 17 | JGI25160J50197_1000197 | 3300003354 | Bacteria | 50744 |
| 18 | JGI25161J50226_1000057 | 3300003374 | Bacteria | 102462 |
| 19 | Ga0055538_1000023 | 3300003751 | Bacteria | 248154 |
| 20 | Ga0055539_1000030 | 3300003752 | Bacteria | 248154 |
| 21 | Ga0055533_1000039 | 3300003756 | Bacteria | 248154 |
| 22 | Ga0055532_1000034 | 3300003758 | Bacteria | 210984 |
| 23 | Ga0055525_1000048 | 3300003759 | Bacteria | 248154 |
| 24 | Ga0055535_1004980 | 3300003761 | Bacteria | 3040 |
| 25 | Ga0055528_1001609 | 3300003790 | Bacteria | 13350 |
| 26 | Ga0055541_1000021 | 3300003841 | Bacteria | 248154 |
| 27 | Ga0055541_1002175 | 3300003841 | Bacteria | 3983 |
| 28 | Ga0055543_1002755 | 3300004625 | Bacteria | 5581 |
| 29 | Ga0065165_1014714 | 3300005262 | Bacteria | 3024 |
| 30 | Ga0065165_1014734 | 3300005262 | Bacteria | 3020 |
| 31 | Ga0065707_10121565 | 3300005295 | Bacteria | 2106 |
| 32 | Ga0070658_10037674 | 3300005327 | Bacteria | 3899 |
| 33 | Ga0070683_100179413 | 3300005329 | Bacteria | 2010 |
| 34 | Ga0070680_100015442 | 3300005336 | Bacteria | 5986 |
| 35 | Ga0070660_100000006 | 3300005339 | Bacteria | 166714 |
| 36 | Ga0070660_100000824 | 3300005339 | Bacteria | 20581 |
| 37 | Ga0070689_100009103 | 3300005340 | Bacteria | 7030 |
| 38 | Ga0070692_10005707 | 3300005345 | Bacteria | 5343 |
| 39 | Ga0070674_100024428 | 3300005356 | Bacteria | 3922 |
| 40 | Ga0070673_100002446 | 3300005364 | Bacteria | 11313 |
| 41 | Ga0070659_100000078 | 3300005366 | Bacteria | 74646 |
| 42 | Ga0070701_10001168 | 3300005438 | Bacteria | 9615 |
| 43 | Ga0070700_100000628 | 3300005441 | Bacteria | 17527 |
| 44 | Ga0070694_100025120 | 3300005444 | Bacteria | 3853 |
| 45 | Ga0070663_100000371 | 3300005455 | Bacteria | 23590 |
| 46 | Ga0068867_100001785 | 3300005459 | Bacteria | 14965 |
| 47 | Ga0070706_100011134 | 3300005467 | Bacteria | 8350 |
| 48 | Ga0070706_100078987 | 3300005467 | Bacteria | 3045 |
| 49 | Ga0070707_100019569 | 3300005468 | Bacteria | 6379 |
| 50 | Ga0070707_100035033 | 3300005468 | Bacteria | 4787 |
| 51 | Ga0070707_100052609 | 3300005468 | Bacteria | 3904 |
| 52 | Ga0070707_100180248 | 3300005468 | Bacteria | 2059 |
| 53 | Ga0070698_100000498 | 3300005471 | Bacteria | 41800 |
| 54 | Ga0070686_100043432 | 3300005544 | Bacteria | 2820 |
| 55 | Ga0070686_100122717 | 3300005544 | Bacteria | 1786 |
| 56 | Ga0070695_100059167 | 3300005545 | Bacteria | 2480 |
| 57 | Ga0070665_100001916 | 3300005548 | Bacteria | 23511 |
| 58 | Ga0070704_100006762 | 3300005549 | Bacteria | 6787 |
| 59 | Ga0068855_100002067 | 3300005563 | Bacteria | 24867 |
| 60 | Ga0068855_100016635 | 3300005563 | Bacteria | 8842 |
| 61 | Ga0070664_100109686 | 3300005564 | Bacteria | 2407 |
| 62 | Ga0070702_100001192 | 3300005615 | Bacteria | 10482 |
| 63 | Ga0068852_100002439 | 3300005616 | Bacteria | 12803 |
| 64 | Ga0068852_100029314 | 3300005616 | Bacteria | 4520 |
| 65 | Ga0068859_100030507 | 3300005617 | Bacteria | 5411 |
| 66 | Ga0068864_100225812 | 3300005618 | Bacteria | 1730 |
| 67 | Ga0068866_10002094 | 3300005718 | Bacteria | 8300 |
| 68 | Ga0068861_100000984 | 3300005719 | Bacteria | 17406 |
| 69 | Ga0068861_100006778 | 3300005719 | Bacteria | 7824 |
| 70 | Ga0068863_100016059 | 3300005841 | Bacteria | 7180 |
| 71 | Ga0068858_100008134 | 3300005842 | Bacteria | 10085 |
| 72 | Ga0068858_100082165 | 3300005842 | Bacteria | 2995 |
| 73 | Ga0068862_100017350 | 3300005844 | Bacteria | 5994 |
| 74 | Ga0075364_10038405 | 3300006051 | Bacteria | 3102 |
| 75 | Ga0070712_100057648 | 3300006175 | Bacteria | 2729 |
| 76 | Ga0075367_10015048 | 3300006178 | Bacteria | 4195 |
| 77 | Ga0075366_10003173 | 3300006195 | Bacteria | 8609 |
| 78 | Ga0075370_10020484 | 3300006353 | Bacteria | 3616 |
| 79 | Ga0068871_100006608 | 3300006358 | Bacteria | 8222 |
| 80 | Ga0068865_100003142 | 3300006881 | Bacteria | 9886 |
| 81 | Ga0097620_100030508 | 3300006931 | Bacteria | 5411 |
| 82 | Ga0079104_1000074 | 3300006946 | Bacteria | 150348 |
| 83 | Ga0079104_1000675 | 3300006946 | Bacteria | 31832 |
| 84 | Ga0105250_10000086 | 3300009092 | Bacteria | 81683 |
| 85 | Ga0105240_10000799 | 3300009093 | Bacteria | 56992 |
| 86 | Ga0105240_10001916 | 3300009093 | Bacteria | 34556 |
| 87 | Ga0105240_10011310 | 3300009093 | Bacteria | 12432 |
| 88 | Ga0111539_10012394 | 3300009094 | Bacteria | 10688 |
| 89 | Ga0105245_10007509 | 3300009098 | Bacteria | 9554 |
| 90 | Ga0105245_10090295 | 3300009098 | Bacteria | 2817 |
| 91 | Ga0105245_10110347 | 3300009098 | Bacteria | 2557 |
| 92 | Ga0114129_10154139 | 3300009147 | Bacteria | 3143 |
| 93 | Ga0105243_10004749 | 3300009148 | Bacteria | 10683 |
| 94 | Ga0105248_10024051 | 3300009177 | Bacteria | 6770 |
| 95 | Ga0105248_10037513 | 3300009177 | Bacteria | 5422 |
| 96 | Ga0105248_10200123 | 3300009177 | Bacteria | 2251 |
| 97 | Ga0105237_10069052 | 3300009545 | Bacteria | 3528 |
| 98 | Ga0105238_10009999 | 3300009551 | Bacteria | 9514 |
| 99 | Ga0105239_10007147 | 3300010375 | Bacteria | 12844 |
| 100 | Ga0105239_10022712 | 3300010375 | Bacteria | 6915 |
| 101 | Ga0157371_10002771 | 3300013102 | Bacteria | 16461 |
| 102 | Ga0157370_10002288 | 3300013104 | Bacteria | 23212 |
| 103 | Ga0157370_10108586 | 3300013104 | Bacteria | 2594 |
| 104 | Ga0157369_10001266 | 3300013105 | Bacteria | 31371 |
| 105 | Ga0157369_10117049 | 3300013105 | Bacteria | 2829 |
| 106 | Ga0157374_10000032 | 3300013296 | Bacteria | 202485 |
| 107 | Ga0157378_10015230 | 3300013297 | Bacteria | 6735 |
| 108 | Ga0157372_10010032 | 3300013307 | Bacteria | 10072 |
| 109 | Ga0157372_10142487 | 3300013307 | Bacteria | 2763 |
| 110 | Ga0157375_10065748 | 3300013308 | Bacteria | 3616 |
| 111 | Ga0157375_10251382 | 3300013308 | Bacteria | 1928 |
| 112 | Ga0163163_10052670 | 3300014325 | Bacteria | 4016 |
| 113 | Ga0163163_10053304 | 3300014325 | Bacteria | 3992 |
| 114 | Ga0157380_10046683 | 3300014326 | Bacteria | 3403 |
| 115 | Ga0182008_10029486 | 3300014497 | Bacteria | 2773 |
| 116 | Ga0157379_10022123 | 3300014968 | Bacteria | 5636 |
| 117 | Ga0157379_10022425 | 3300014968 | Bacteria | 5593 |
| 118 | Ga0157379_10025728 | 3300014968 | Bacteria | 5231 |
| 119 | Ga0157376_10008622 | 3300014969 | Bacteria | 7370 |
| 120 | Ga0213876_10001430 | 3300021384 | Bacteria | 14872 |
| 121 | Ga0213876_10004490 | 3300021384 | Bacteria | 7798 |
| 122 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 123 | Ga0209435_100041 | 3300025206 | Bacteria | 105577 |
| 124 | Ga0209435_100124 | 3300025206 | Bacteria | 27904 |
| 125 | Ga0209436_104378 | 3300025208 | Bacteria | 3506 |
| 126 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 127 | Ga0209784_100299 | 3300025224 | Bacteria | 26702 |
| 128 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 129 | Ga0209566_100436 | 3300025225 | Bacteria | 31141 |
| 130 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 131 | Ga0209674_100928 | 3300025226 | Bacteria | 9359 |
| 132 | Ga0209672_100020 | 3300025228 | Bacteria | 429003 |
| 133 | Ga0209672_100066 | 3300025228 | Bacteria | 189828 |
| 134 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 135 | Ga0209147_100024 | 3300025229 | Bacteria | 429003 |
| 136 | Ga0209147_100063 | 3300025229 | Bacteria | 241980 |
| 137 | Ga0209147_100084 | 3300025229 | Bacteria | 189828 |
| 138 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 139 | Ga0207427_100321 | 3300025231 | Bacteria | 32350 |
| 140 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 141 | Ga0209437_100215 | 3300025233 | Bacteria | 106873 |
| 142 | Ga0209258_100084 | 3300025242 | Bacteria | 244783 |
| 143 | Ga0209258_100115 | 3300025242 | Bacteria | 190367 |
| 144 | Ga0209258_100117 | 3300025242 | Bacteria | 189828 |
| 145 | Ga0207425_1001486 | 3300025245 | Bacteria | 9746 |
| 146 | Ga0209646_1000044 | 3300025246 | Bacteria | 334596 |
| 147 | Ga0209646_1000144 | 3300025246 | Bacteria | 105691 |
| 148 | Ga0209646_1000238 | 3300025246 | Bacteria | 57384 |
| 149 | Ga0209026_1000063 | 3300025250 | Bacteria | 211324 |
| 150 | Ga0209026_1000159 | 3300025250 | Bacteria | 105691 |
| 151 | Ga0209026_1006502 | 3300025250 | Bacteria | 2840 |
| 152 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 153 | Ga0209148_1000148 | 3300025254 | Bacteria | 159642 |
| 154 | Ga0209148_1001093 | 3300025254 | Bacteria | 16389 |
| 155 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 156 | Ga0209759_1000048 | 3300025256 | Bacteria | 224817 |
| 157 | Ga0209759_1000152 | 3300025256 | Bacteria | 119866 |
| 158 | Ga0209759_1000991 | 3300025256 | Bacteria | 19486 |
| 159 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 160 | Ga0209565_1001120 | 3300025263 | Bacteria | 13007 |
| 161 | Ga0209455_1000110 | 3300025272 | Bacteria | 189828 |
| 162 | Ga0209455_1000298 | 3300025272 | Bacteria | 51486 |
| 163 | Ga0209673_1000056 | 3300025273 | Bacteria | 271069 |
| 164 | Ga0209130_1000146 | 3300025284 | Bacteria | 111777 |
| 165 | Ga0209675_1002535 | 3300025291 | Bacteria | 9279 |
| 166 | Ga0209025_1005790 | 3300025294 | Bacteria | 9912 |
| 167 | Ga0209050_1015090 | 3300025298 | Bacteria | 3274 |
| 168 | Ga0207426_1000291 | 3300025302 | Bacteria | 99437 |
| 169 | Ga0207696_1000024 | 3300025711 | Bacteria | 420123 |
| 170 | Ga0207642_10002045 | 3300025899 | Bacteria | 6226 |
| 171 | Ga0207647_10000667 | 3300025904 | Bacteria | 26815 |
| 172 | Ga0207647_10002918 | 3300025904 | Bacteria | 12875 |
| 173 | Ga0207705_10046147 | 3300025909 | Bacteria | 3130 |
| 174 | Ga0207684_10109065 | 3300025910 | Bacteria | 2369 |
| 175 | Ga0207695_10000328 | 3300025913 | Bacteria | 113378 |
| 176 | Ga0207695_10001014 | 3300025913 | Bacteria | 49482 |
| 177 | Ga0207695_10002743 | 3300025913 | Bacteria | 25683 |
| 178 | Ga0207695_10005541 | 3300025913 | Bacteria | 16696 |
| 179 | Ga0207695_10034570 | 3300025913 | Bacteria | 5494 |
| 180 | Ga0207657_10000003 | 3300025919 | Bacteria | 263148 |
| 181 | Ga0207657_10002598 | 3300025919 | Bacteria | 19544 |
| 182 | Ga0207646_10001976 | 3300025922 | Bacteria | 24616 |
| 183 | Ga0207646_10025452 | 3300025922 | Bacteria | 5413 |
| 184 | Ga0207646_10037364 | 3300025922 | Bacteria | 4378 |
| 185 | Ga0207694_10022363 | 3300025924 | Bacteria | 4796 |
| 186 | Ga0207650_10042242 | 3300025925 | Bacteria | 3345 |
| 187 | Ga0207687_10003593 | 3300025927 | Bacteria | 10444 |
| 188 | Ga0207644_10019557 | 3300025931 | Bacteria | 4595 |
| 189 | Ga0207690_10000007 | 3300025932 | Bacteria | 388533 |
| 190 | Ga0207706_10002765 | 3300025933 | Bacteria | 17065 |
| 191 | Ga0207686_10001924 | 3300025934 | Bacteria | 11468 |
| 192 | Ga0207709_10003509 | 3300025935 | Bacteria | 9284 |
| 193 | Ga0207704_10079968 | 3300025938 | Bacteria | 2108 |
| 194 | Ga0207704_10093364 | 3300025938 | Bacteria | 1983 |
| 195 | Ga0207711_10008554 | 3300025941 | Bacteria | 8561 |
| 196 | Ga0207711_10013392 | 3300025941 | Bacteria | 6814 |
| 197 | Ga0207689_10000481 | 3300025942 | Bacteria | 37621 |
| 198 | Ga0207667_10012674 | 3300025949 | Bacteria | 9688 |
| 199 | Ga0207667_10059058 | 3300025949 | Bacteria | 4019 |
| 200 | Ga0207651_10003772 | 3300025960 | Bacteria | 7507 |
| 201 | Ga0207651_10048401 | 3300025960 | Bacteria | 2874 |
| 202 | Ga0207668_10025190 | 3300025972 | Bacteria | 3848 |
| 203 | Ga0207677_10050580 | 3300026023 | Bacteria | 2812 |
| 204 | Ga0207677_10094187 | 3300026023 | Bacteria | 2186 |
| 205 | Ga0207703_10184428 | 3300026035 | Bacteria | 1843 |
| 206 | Ga0207678_10000064 | 3300026067 | Bacteria | 83470 |
| 207 | Ga0207708_10003877 | 3300026075 | Bacteria | 11008 |
| 208 | Ga0207641_10045809 | 3300026088 | Bacteria | 3685 |
| 209 | Ga0207648_10003813 | 3300026089 | Bacteria | 15762 |
| 210 | Ga0207676_10097375 | 3300026095 | Bacteria | 2430 |
| 211 | Ga0207675_100003018 | 3300026118 | Bacteria | 16505 |
| 212 | Ga0207675_100005712 | 3300026118 | Bacteria | 11906 |
| 213 | Ga0207698_10021399 | 3300026142 | Bacteria | 4472 |
| 214 | Ga0207698_10030297 | 3300026142 | Bacteria | 3888 |
| 215 | Ga0209281_1000066 | 3300027111 | Bacteria | 284953 |
| 216 | Ga0209281_1000075 | 3300027111 | Bacteria | 267114 |
| 217 | Ga0209371_1000076 | 3300027312 | Bacteria | 195166 |
| 218 | Ga0209371_1010480 | 3300027312 | Bacteria | 2846 |
| 219 | Ga0268266_10044968 | 3300028379 | Bacteria | 3775 |
| 220 | Ga0268265_10112762 | 3300028380 | Bacteria | 2223 |
| 221 | Ga0307517_10000122 | 3300028786 | Bacteria | 116429 |
| 222 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 223 | Ga0307515_10009956 | 3300028794 | Bacteria | 18302 |
| 224 | Ga0307515_10015014 | 3300028794 | Bacteria | 14306 |
| 225 | Ga0265338_10000037 | 3300028800 | Bacteria | 237244 |
| 226 | Ga0268256_1000087 | 3300030500 | Bacteria | 157659 |
| 227 | Ga0268256_1015937 | 3300030500 | Bacteria | 2173 |
| 228 | Ga0265320_10016590 | 3300031240 | Bacteria | 4121 |
| 229 | Ga0265325_10031563 | 3300031241 | Bacteria | 2834 |
| 230 | Ga0307509_10000098 | 3300031507 | Bacteria | 121442 |
| 231 | Ga0307509_10005586 | 3300031507 | Bacteria | 17423 |
| 232 | Ga0307408_100004032 | 3300031548 | Bacteria | 10014 |
| 233 | Ga0307408_100040352 | 3300031548 | Bacteria | 3305 |
| 234 | Ga0307408_100132493 | 3300031548 | Bacteria | 1946 |
| 235 | Ga0307508_10008457 | 3300031616 | Bacteria | 9508 |
| 236 | Ga0307508_10011145 | 3300031616 | Bacteria | 8221 |
| 237 | Ga0316579_10000882 | 3300031691 | Bacteria | 10399 |
| 238 | Ga0316576_10002076 | 3300031727 | Bacteria | 11250 |
| 239 | Ga0316576_10002173 | 3300031727 | Bacteria | 11065 |
| 240 | Ga0316576_10004965 | 3300031727 | Bacteria | 8058 |
| 241 | Ga0307516_10077865 | 3300031730 | Bacteria | 3163 |
| 242 | Ga0307406_10020916 | 3300031901 | Bacteria | 3863 |
| 243 | Ga0316585_10000100 | 3300032137 | Bacteria | 15598 |
| 244 | Ga0316585_10005848 | 3300032137 | Bacteria | 3488 |
| 245 | Ga0316580_10000741 | 3300032139 | Bacteria | 7902 |
| 246 | Ga0316593_10005370 | 3300032168 | Bacteria | 3372 |
| 247 | Ga0307510_10056784 | 3300033180 | Bacteria | 4070 |
| 248 | Ga0307510_10105420 | 3300033180 | Bacteria | 2587 |
| 249 | Ga0316588_1002612 | 3300033528 | Bacteria | 3159 |
| 250 | Ga0316588_1003628 | 3300033528 | Bacteria | 2841 |
| 251 | Ga0316596_1000264 | 3300033541 | Bacteria | 8131 |
| 252 | Ga0316574_0000861 | 3300035398 | Bacteria | 13357 |
| 253 | Ga0316574_0046784 | 3300035398 | Bacteria | 2684 |
| 254 | Ga0316584_0000743 | 3300036712 | Bacteria | 18138 |
| 255 | Ga0316584_0004184 | 3300036712 | Bacteria | 9527 |
| 256 | Ga0395900_0011347 | 3300037418 | Bacteria | 9116 |
| 257 | Ga0395898_0005818 | 3300037466 | Bacteria | 13263 |
| 258 | Ga0395898_0007951 | 3300037466 | Bacteria | 11245 |
| 259 | Ga0395905_0007987 | 3300037471 | Bacteria | 10455 |
| 260 | Ga0395905_0025846 | 3300037471 | Bacteria | 5534 |
| 261 | Ga0316581_0015010 | 3300037588 | Bacteria | 2210 |
| 262 | Ga0436364_0791886 | 3300037853 | Bacteria | 9156 |
| 263 | Ga0395901_0000012 | 3300038443 | Bacteria | 381361 |
| 264 | Ga0400484_01634 | 3300038725 | Bacteria | 10598 |
| 265 | Ga0400490_05542 | 3300038726 | Bacteria | 4397 |
| 266 | Ga0400488_61237 | 3300038741 | Bacteria | 3768 |
| 267 | Ga0436365_0316342 | 3300039437 | Bacteria | 1740 |
| 268 | Ga0436365_1909455 | 3300039437 | Bacteria | 3109 |
| 269 | Ga0436363_0056306 | 3300039450 | Bacteria | 6681 |
| 270 | Ga0436363_1082889 | 3300039450 | Bacteria | 2077 |
| 271 | Ga0436362_0940601 | 3300039453 | Bacteria | 3142 |
| 272 | Ga0451853_2549014 | 3300041512 | Bacteria | 1995 |
| 273 | Ga0439448_0000249 | 3300042005 | Bacteria | 11627 |
| 274 | Ga0439452_000380 | 3300042010 | Bacteria | 26638 |
| 275 | Ga0450919_000744 | 3300042121 | Bacteria | 4132 |
| 276 | Ga0450923_002494 | 3300042125 | Bacteria | 2649 |
| 277 | Ga0450918_000018 | 3300042531 | Bacteria | 32477 |
| 278 | Ga0451577_0002882 | 3300042876 | Bacteria | 19756 |
| 279 | Ga0451577_0191930 | 3300042876 | Bacteria | 1843 |
| 280 | Ga0466972_0039297 | 3300044658 | Bacteria | 2309 |
| 281 | Ga0453683_0011247 | 3300044673 | Bacteria | 5909 |
| 282 | Ga0453683_0073949 | 3300044673 | Bacteria | 2133 |
| 283 | Ga0453683_0104390 | 3300044673 | Bacteria | 1780 |
| 284 | Ga0466966_0015353 | 3300044684 | Bacteria | 5064 |
| 285 | Ga0466961_0008581 | 3300044693 | Bacteria | 6510 |
| 286 | Ga0453684_0000265 | 3300044712 | Bacteria | 225591 |
| 287 | Ga0453684_0000318 | 3300044712 | Bacteria | 203553 |
| 288 | Ga0453684_0001413 | 3300044712 | Bacteria | 69115 |
| 289 | Ga0453684_0004176 | 3300044712 | Bacteria | 31113 |
| 290 | Ga0453684_0004293 | 3300044712 | Bacteria | 30381 |
| 291 | Ga0453684_0007294 | 3300044712 | Bacteria | 20459 |
| 292 | Ga0453684_0008244 | 3300044712 | Bacteria | 18782 |
| 293 | Ga0453684_0022457 | 3300044712 | Bacteria | 9355 |
| 294 | Ga0453684_0032145 | 3300044712 | Bacteria | 7354 |
| 295 | Ga0453684_0062275 | 3300044712 | Bacteria | 4780 |
| 296 | Ga0453684_0102919 | 3300044712 | Bacteria | 3491 |
| 297 | Ga0453684_0120931 | 3300044712 | Bacteria | 3162 |
| 298 | Ga0453684_0139622 | 3300044712 | Bacteria | 2896 |
| 299 | Ga0453684_0282179 | 3300044712 | Bacteria | 1894 |
| 300 | Ga0466971_0034810 | 3300044719 | Bacteria | 2257 |
| 301 | Ga0466959_0134705 | 3300045049 | Bacteria | 1749 |
| 302 | Ga0451576_0023787 | 3300045051 | Bacteria | 6628 |
| 303 | Ga0451576_0026686 | 3300045051 | Bacteria | 6209 |
| 304 | Ga0495592_0002697 | 3300046454 | Bacteria | 12561 |
| 305 | Ga0495651_0014755 | 3300046462 | Bacteria | 6042 |
| 306 | Ga0495653_0015666 | 3300046463 | Bacteria | 6179 |
| 307 | Ga0495653_0056131 | 3300046463 | Bacteria | 3003 |
| 308 | Ga0495650_0001359 | 3300046471 | Bacteria | 24265 |
| 309 | Ga0495650_0018612 | 3300046471 | Bacteria | 3446 |
| 310 | Ga0495664_0024219 | 3300046477 | Bacteria | 3527 |
| 311 | Ga0495608_0018698 | 3300046511 | Bacteria | 4775 |
| 312 | Ga0495618_0028926 | 3300046514 | Bacteria | 3455 |
| 313 | Ga0495628_0009504 | 3300046516 | Bacteria | 8303 |
| 314 | Ga0495628_0025832 | 3300046516 | Bacteria | 4796 |
| 315 | Ga0495628_0031467 | 3300046516 | Bacteria | 4291 |
| 316 | Ga0495628_0055384 | 3300046516 | Bacteria | 3124 |
| 317 | Ga0495648_0023543 | 3300046524 | Bacteria | 4215 |
| 318 | Ga0495652_0026929 | 3300046529 | Bacteria | 5071 |
| 319 | Ga0495652_0065976 | 3300046529 | Bacteria | 3040 |
| 320 | Ga0495645_0108065 | 3300046543 | Bacteria | 1971 |
| 321 | Ga0495622_0000020 | 3300046557 | Bacteria | 166839 |
| 322 | Ga0495625_0032386 | 3300046660 | Bacteria | 3876 |
| 323 | Ga0495599_0005392 | 3300046678 | Bacteria | 7640 |
| 324 | Ga0495624_0000704 | 3300046690 | Bacteria | 26244 |
| 325 | Ga0495600_0002266 | 3300046809 | Bacteria | 10962 |
| 326 | Ga0495604_0022023 | 3300047317 | Bacteria | 5087 |
| 327 | Ga0495672_0000049 | 3300047320 | Bacteria | 240851 |
| 328 | Ga0495687_000005 | 3300047443 | Bacteria | 610401 |
| 329 | Ga0495602_0095440 | 3300048088 | Bacteria | 2455 |
| 330 | Ga0495602_0120516 | 3300048088 | Bacteria | 2111 |
| 331 | Ga0496105_0070602 | 3300048908 | Bacteria | 2887 |
| 332 | Ga0496106_0000032 | 3300048909 | Bacteria | 134707 |
| 333 | Ga0496109_0176561 | 3300048912 | Bacteria | 2005 |
| 334 | Ga0496112_0184148 | 3300048915 | Bacteria | 2052 |
| 335 | Ga0496116_0005552 | 3300048919 | Bacteria | 11636 |
| 336 | Ga0496116_0022924 | 3300048919 | Bacteria | 4661 |
| 337 | Ga0496116_0060522 | 3300048919 | Bacteria | 2456 |
| 338 | Ga0496117_0002794 | 3300048920 | Bacteria | 21308 |
| 339 | Ga0496118_0029359 | 3300048921 | Bacteria | 4612 |
| 340 | Ga0496118_0069214 | 3300048921 | Bacteria | 2558 |
| 341 | Ga0496121_0000207 | 3300048924 | Bacteria | 129797 |
| 342 | Ga0496121_0010160 | 3300048924 | Bacteria | 10660 |
| 343 | Ga0496122_0000854 | 3300048925 | Bacteria | 57341 |
| 344 | Ga0496122_0043753 | 3300048925 | Bacteria | 3504 |
| 345 | Ga0496123_0002790 | 3300048926 | Bacteria | 20756 |
| 346 | Ga0496124_0014685 | 3300048927 | Bacteria | 7561 |
| 347 | Ga0496125_0000081 | 3300048928 | Bacteria | 228069 |
| 348 | Ga0496125_0000701 | 3300048928 | Bacteria | 55423 |
| 349 | Ga0496125_0108990 | 3300048928 | Bacteria | 2012 |
| 350 | Ga0496126_0000083 | 3300048929 | Bacteria | 217567 |
| 351 | Ga0496126_0002091 | 3300048929 | Bacteria | 27956 |
| 352 | Ga0501034_0024914 | 3300049571 | Bacteria | 6088 |
| 353 | nmdc:mga03683_3947_c1 | 3300050489 | Bacteria | 4856 |
| 354 | nmdc:mga0k408_25855_c1 | 3300050493 | Bacteria | 3327 |
| 355 | nmdc:mga0k408_3002_c1 | 3300050493 | Bacteria | 8950 |
| 356 | nmdc:mga0sz30_9862_c1 | 3300050516 | Bacteria | 3644 |
| 357 | Ga0495601_0019367 | 3300053077 | Bacteria | 4151 |
| 358 | Ga0500593_004650 | 3300053117 | Bacteria | 5343 |
| 359 | Ga0500595_007434 | 3300053119 | Bacteria | 4546 |
| 360 | Ga0500574_000292 | 3300053141 | Bacteria | 6158 |
| 361 | Ga0500588_0024807 | 3300053146 | Bacteria | 1659 |
| 362 | Ga0466962_0005954 | 3300061719 | Bacteria | 5859 |
| 363 | 2501072453 | 2501025501 | Bacteria | 7768574 |
| 364 | 2501409153 | 2501025504 | Bacteria | 8008976 |
| 365 | 2508735980 | 2508501050 | Bacteria | 9633614 |
| 366 | 2509129778 | 2508501125 | Bacteria | 7208311 |
| 367 | 2510248533 | 2510065045 | Bacteria | 7761063 |
| 368 | 2511101102 | 2510917014 | Bacteria | 8296963 |
| 369 | 2511107151 | 2510917015 | Bacteria | 7950052 |
| 370 | 2511243051 | 2511231002 | Bacteria | 5042903 |
| 371 | 2511251597 | 2511231003 | Bacteria | 5606035 |
| 372 | 2512349457 | 2512047030 | Bacteria | 9031815 |
| 373 | 2513960158 | 2513237151 | Bacteria | 6309801 |
| 374 | 2515686037 | 2515154122 | Bacteria | 8609520 |
| 375 | 2516018961 | 2515154189 | Bacteria | 9629850 |
| 376 | 2519460284 | 2519103095 | Bacteria | 6629912 |
| 377 | 2527075542 | 2526164713 | Bacteria | 6780608 |
| 378 | 2550694878 | 2548876994 | Bacteria | 4904866 |
| 379 | 2585292596 | 2582581311 | Bacteria | 6763856 |
| 380 | 2587745259 | 2585428059 | Bacteria | 8696589 |
| 381 | 2599739733 | 2599185239 | Bacteria | 8686614 |
| 382 | 2599747324 | 2599185240 | Bacteria | 7968121 |
| 383 | 2600209051 | 2599185355 | Bacteria | 7968906 |
| 384 | 2644423533 | 2643221676 | Bacteria | 8119172 |
| 385 | 2676745079 | 2675903129 | Bacteria | 7964495 |
| 386 | 2719643040 | 2718217991 | Bacteria | 7829542 |
| 387 | 2753565733 | 2751185846 | Bacteria | 7242164 |
| 388 | 2774874019 | 2773857925 | Bacteria | 6472445 |
| 389 | 2776259953 | 2775506901 | Bacteria | 9631051 |
| 390 | 2792836830 | 2791355137 | Bacteria | 9654227 |
| 391 | 2808983636 | 2808606386 | Bacteria | 4471946 |
| 392 | 2809003631 | 2808606390 | Bacteria | 8476311 |
| 393 | 2809010908 | 2808606391 | Bacteria | 8308166 |
| 394 | 2809129300 | 2808606415 | Bacteria | 4576710 |
| 395 | 2809149645 | 2808606419 | Bacteria | 4576925 |
| 396 | 2817257918 | 2816332253 | Bacteria | 6764532 |
| 397 | 2817281691 | 2816332256 | Bacteria | 6891714 |
| 398 | 2819541753 | 2818991436 | Bacteria | 5376622 |
| 399 | 2819593967 | 2818991445 | Bacteria | 4955017 |
| 400 | 2819635266 | 2818991452 | Bacteria | 8442785 |
| 401 | 2852619797 | 2852618963 | Bacteria | 4577824 |
| 402 | 2857473620 | 2857472729 | Bacteria | 6568124 |
| 403 | 2863424324 | 2863421361 | Bacteria | 7300805 |
| 404 | 2868095362 | 2868088558 | Bacteria | 7609351 |
| 405 | 2870073480 | 2870068957 | Bacteria | 8925310 |
| 406 | 2882458154 | 2882456835 | Bacteria | 6863978 |
| 407 | 2883089337 | 2883087390 | Bacteria | 9532701 |
| 408 | 2884839788 | 2884836552 | Bacteria | 5219991 |
| 409 | 2884856401 | 2884852848 | Bacteria | 5221161 |
| 410 | 2885278250 | 2885270888 | Bacteria | 9831543 |
| 411 | 2891672227 | 2891670763 | Bacteria | 4967099 |
| 412 | 2896158766 | 2896154374 | Bacteria | 5221518 |
| 413 | 2902685679 | 2902682994 | Bacteria | 8951596 |
| 414 | 2904567490 | 2904564687 | Bacteria | 7609577 |
| 415 | 2904574535 | 2904571731 | Bacteria | 7608790 |
| 416 | 2904624415 | 2904615490 | Bacteria | 10047340 |
| 417 | 2928158424 | 2928157003 | Bacteria | 7522202 |
| 418 | 2928167364 | 2928163908 | Bacteria | 7561269 |
| 419 | 2928177087 | 2928170801 | Bacteria | 8785406 |
| 420 | 2928540349 | 2928536128 | Bacteria | 7657547 |
| 421 | 2939577113 | 2939573065 | Bacteria | 4926053 |
| 422 | 2981991890 | 2981990288 | Bacteria | 7590678 |
| 423 | 3006971017 | 3006969106 | Bacteria | 4739423 |
| 424 | 642414160 | 641736154 | Bacteria | 7689995 |
| 425 | 8018224598 | 8018221730 | Bacteria | 4616064 |
| 426 | 8018851725 | 8018845410 | Bacteria | 8933938 |
| 427 | 8020812184 | 8020807995 | Bacteria | 6801506 |
| 428 | 8020942961 | 8020938398 | Bacteria | 7472757 |
| 429 | 8020946652 | 8020945358 | Bacteria | 8467355 |
| 430 | 8020959641 | 8020953355 | Bacteria | 7439080 |
| 431 | 8021123949 | 8021120328 | Bacteria | 8782274 |
| 432 | 8039100314 | 8039098773 | Bacteria | 6602928 |
| 433 | 8040170704 | 8040167225 | Bacteria | 6542727 |
| 434 | 8040176907 | 8040173305 | Bacteria | 6827067 |
| 435 | 8055633765 | 8055632911 | Bacteria | 5283357 |
| 436 | Ga0070690_100043907 | |||
| 437 | JGI24739J22299_10011619 | |||
| 438 | JGI25155J39150_1000760 | |||
| 439 | JGI25156J39149_1000043 | |||
| 440 | JGI25156J39149_1000098 | |||
| 441 | JGI25156J39149_1005401 | |||
| 442 | JGI25162J39368_1000021 | |||
| 443 | JGI25154J39366_1000062 | |||
| 444 | JGI25154J39366_1000519 | |||
| 445 | JGI25154J39366_1003133 | |||
| 446 | JGI25157J39369_1000060 | |||
| 447 | JGI25157J39369_1000102 | |||
| 448 | JGI25157J39369_1000668 | |||
| 449 | JGI25159J45721_1000163 | |||
| 450 | JGI25165J46597_1000049 | |||
| 451 | JGI25160J50197_1000174 | |||
| 452 | JGI25160J50197_1000197 | |||
| 453 | JGI25161J50226_1000057 | |||
| 454 | Ga0055538_1000023 | |||
| 455 | Ga0055539_1000030 | |||
| 456 | Ga0055533_1000039 | |||
| 457 | Ga0055532_1000034 | |||
| 458 | Ga0055525_1000048 | |||
| 459 | Ga0055535_1004980 | |||
| 460 | Ga0055528_1001609 | |||
| 461 | Ga0055541_1000021 | |||
| 462 | Ga0055541_1002175 | |||
| 463 | Ga0055543_1002755 | |||
| 464 | Ga0065165_1014714 | |||
| 465 | Ga0065165_1014734 | |||
| 466 | Ga0065707_10121565 | |||
| 467 | Ga0070658_10037674 | |||
| 468 | Ga0070683_100179413 | |||
| 469 | Ga0070680_100015442 | |||
| 470 | Ga0070660_100000006 | |||
| 471 | Ga0070660_100000824 | |||
| 472 | Ga0070689_100009103 | |||
| 473 | Ga0070692_10005707 | |||
| 474 | Ga0070674_100024428 | |||
| 475 | Ga0070673_100002446 | |||
| 476 | Ga0070659_100000078 | |||
| 477 | Ga0070701_10001168 | |||
| 478 | Ga0070700_100000628 | |||
| 479 | Ga0070694_100025120 | |||
| 480 | Ga0070663_100000371 | |||
| 481 | Ga0068867_100001785 | |||
| 482 | Ga0070706_100011134 | |||
| 483 | Ga0070706_100078987 | |||
| 484 | Ga0070707_100019569 | |||
| 485 | Ga0070707_100035033 | |||
| 486 | Ga0070707_100052609 | |||
| 487 | Ga0070707_100180248 | |||
| 488 | Ga0070698_100000498 | |||
| 489 | Ga0070686_100043432 | |||
| 490 | Ga0070686_100122717 | |||
| 491 | Ga0070695_100059167 | |||
| 492 | Ga0070665_100001916 | |||
| 493 | Ga0070704_100006762 | |||
| 494 | Ga0068855_100002067 | |||
| 495 | Ga0068855_100016635 | |||
| 496 | Ga0070664_100109686 | |||
| 497 | Ga0070702_100001192 | |||
| 498 | Ga0068852_100002439 | |||
| 499 | Ga0068852_100029314 | |||
| 500 | Ga0068859_100030507 | |||
| 501 | Ga0068864_100225812 | |||
| 502 | Ga0068866_10002094 | |||
| 503 | Ga0068861_100000984 | |||
| 504 | Ga0068861_100006778 | |||
| 505 | Ga0068863_100016059 | |||
| 506 | Ga0068858_100008134 | |||
| 507 | Ga0068858_100082165 | |||
| 508 | Ga0068862_100017350 | |||
| 509 | Ga0075364_10038405 | |||
| 510 | Ga0070712_100057648 | |||
| 511 | Ga0075367_10015048 | |||
| 512 | Ga0075366_10003173 | |||
| 513 | Ga0075370_10020484 | |||
| 514 | Ga0068871_100006608 | |||
| 515 | Ga0068865_100003142 | |||
| 516 | Ga0097620_100030508 | |||
| 517 | Ga0079104_1000074 | |||
| 518 | Ga0079104_1000675 | |||
| 519 | Ga0105250_10000086 | |||
| 520 | Ga0105240_10000799 | |||
| 521 | Ga0105240_10001916 | |||
| 522 | Ga0105240_10011310 | |||
| 523 | Ga0111539_10012394 | |||
| 524 | Ga0105245_10007509 | |||
| 525 | Ga0105245_10090295 | |||
| 526 | Ga0105245_10110347 | |||
| 527 | Ga0114129_10154139 | |||
| 528 | Ga0105243_10004749 | |||
| 529 | Ga0105248_10024051 | |||
| 530 | Ga0105248_10037513 | |||
| 531 | Ga0105248_10200123 | |||
| 532 | Ga0105237_10069052 | |||
| 533 | Ga0105238_10009999 | |||
| 534 | Ga0105239_10007147 | |||
| 535 | Ga0105239_10022712 | |||
| 536 | Ga0157371_10002771 | |||
| 537 | Ga0157370_10002288 | |||
| 538 | Ga0157370_10108586 | |||
| 539 | Ga0157369_10001266 | |||
| 540 | Ga0157369_10117049 | |||
| 541 | Ga0157374_10000032 | |||
| 542 | Ga0157378_10015230 | |||
| 543 | Ga0157372_10010032 | |||
| 544 | Ga0157372_10142487 | |||
| 545 | Ga0157375_10065748 | |||
| 546 | Ga0157375_10251382 | |||
| 547 | Ga0163163_10052670 | |||
| 548 | Ga0163163_10053304 | |||
| 549 | Ga0157380_10046683 | |||
| 550 | Ga0182008_10029486 | |||
| 551 | Ga0157379_10022123 | |||
| 552 | Ga0157379_10022425 | |||
| 553 | Ga0157379_10025728 | |||
| 554 | Ga0157376_10008622 | |||
| 555 | Ga0213876_10001430 | |||
| 556 | Ga0213876_10004490 | |||
| 557 | Ga0209435_100007 | |||
| 558 | Ga0209435_100041 | |||
| 559 | Ga0209435_100124 | |||
| 560 | Ga0209436_104378 | |||
| 561 | Ga0209784_100004 | |||
| 562 | Ga0209784_100299 | |||
| 563 | Ga0209566_100004 | |||
| 564 | Ga0209566_100436 | |||
| 565 | Ga0209674_100006 | |||
| 566 | Ga0209674_100928 | |||
| 567 | Ga0209672_100020 | |||
| 568 | Ga0209672_100066 | |||
| 569 | Ga0209147_100017 | |||
| 570 | Ga0209147_100024 | |||
| 571 | Ga0209147_100063 | |||
| 572 | Ga0209147_100084 | |||
| 573 | Ga0209563_100009 | |||
| 574 | Ga0207427_100321 | |||
| 575 | Ga0209437_100004 | |||
| 576 | Ga0209437_100215 | |||
| 577 | Ga0209258_100084 | |||
| 578 | Ga0209258_100115 | |||
| 579 | Ga0209258_100117 | |||
| 580 | Ga0207425_1001486 | |||
| 581 | Ga0209646_1000044 | |||
| 582 | Ga0209646_1000144 | |||
| 583 | Ga0209646_1000238 | |||
| 584 | Ga0209026_1000063 | |||
| 585 | Ga0209026_1000159 | |||
| 586 | Ga0209026_1006502 | |||
| 587 | Ga0209677_100005 | |||
| 588 | Ga0209148_1000148 | |||
| 589 | Ga0209148_1001093 | |||
| 590 | Ga0209759_1000001 | |||
| 591 | Ga0209759_1000048 | |||
| 592 | Ga0209759_1000152 | |||
| 593 | Ga0209759_1000991 | |||
| 594 | Ga0209233_1000005 | |||
| 595 | Ga0209565_1001120 | |||
| 596 | Ga0209455_1000110 | |||
| 597 | Ga0209455_1000298 | |||
| 598 | Ga0209673_1000056 | |||
| 599 | Ga0209130_1000146 | |||
| 600 | Ga0209675_1002535 | |||
| 601 | Ga0209025_1005790 | |||
| 602 | Ga0209050_1015090 | |||
| 603 | Ga0207426_1000291 | |||
| 604 | Ga0207696_1000024 | |||
| 605 | Ga0207642_10002045 | |||
| 606 | Ga0207647_10000667 | |||
| 607 | Ga0207647_10002918 | |||
| 608 | Ga0207705_10046147 | |||
| 609 | Ga0207684_10109065 | |||
| 610 | Ga0207695_10000328 | |||
| 611 | Ga0207695_10001014 | |||
| 612 | Ga0207695_10002743 | |||
| 613 | Ga0207695_10005541 | |||
| 614 | Ga0207695_10034570 | |||
| 615 | Ga0207657_10000003 | |||
| 616 | Ga0207657_10002598 | |||
| 617 | Ga0207646_10001976 | |||
| 618 | Ga0207646_10025452 | |||
| 619 | Ga0207646_10037364 | |||
| 620 | Ga0207694_10022363 | |||
| 621 | Ga0207650_10042242 | |||
| 622 | Ga0207687_10003593 | |||
| 623 | Ga0207644_10019557 | |||
| 624 | Ga0207690_10000007 | |||
| 625 | Ga0207706_10002765 | |||
| 626 | Ga0207686_10001924 | |||
| 627 | Ga0207709_10003509 | |||
| 628 | Ga0207704_10079968 | |||
| 629 | Ga0207704_10093364 | |||
| 630 | Ga0207711_10008554 | |||
| 631 | Ga0207711_10013392 | |||
| 632 | Ga0207689_10000481 | |||
| 633 | Ga0207667_10012674 | |||
| 634 | Ga0207667_10059058 | |||
| 635 | Ga0207651_10003772 | |||
| 636 | Ga0207651_10048401 | |||
| 637 | Ga0207668_10025190 | |||
| 638 | Ga0207677_10050580 | |||
| 639 | Ga0207677_10094187 | |||
| 640 | Ga0207703_10184428 | |||
| 641 | Ga0207678_10000064 | |||
| 642 | Ga0207708_10003877 | |||
| 643 | Ga0207641_10045809 | |||
| 644 | Ga0207648_10003813 | |||
| 645 | Ga0207676_10097375 | |||
| 646 | Ga0207675_100003018 | |||
| 647 | Ga0207675_100005712 | |||
| 648 | Ga0207698_10021399 | |||
| 649 | Ga0207698_10030297 | |||
| 650 | Ga0209281_1000066 | |||
| 651 | Ga0209281_1000075 | |||
| 652 | Ga0209371_1000076 | |||
| 653 | Ga0209371_1010480 | |||
| 654 | Ga0268266_10044968 | |||
| 655 | Ga0268265_10112762 | |||
| 656 | Ga0307517_10000122 | |||
| 657 | Ga0307515_10000030 | |||
| 658 | Ga0307515_10009956 | |||
| 659 | Ga0307515_10015014 | |||
| 660 | Ga0265338_10000037 | |||
| 661 | Ga0268256_1000087 | |||
| 662 | Ga0268256_1015937 | |||
| 663 | Ga0265320_10016590 | |||
| 664 | Ga0265325_10031563 | |||
| 665 | Ga0307509_10000098 | |||
| 666 | Ga0307509_10005586 | |||
| 667 | Ga0307408_100004032 | |||
| 668 | Ga0307408_100040352 | |||
| 669 | Ga0307408_100132493 | |||
| 670 | Ga0307508_10008457 | |||
| 671 | Ga0307508_10011145 | |||
| 672 | Ga0316579_10000882 | |||
| 673 | Ga0316576_10002076 | |||
| 674 | Ga0316576_10002173 | |||
| 675 | Ga0316576_10004965 | |||
| 676 | Ga0307516_10077865 | |||
| 677 | Ga0307406_10020916 | |||
| 678 | Ga0316585_10000100 | |||
| 679 | Ga0316585_10005848 | |||
| 680 | Ga0316580_10000741 | |||
| 681 | Ga0316593_10005370 | |||
| 682 | Ga0307510_10056784 | |||
| 683 | Ga0307510_10105420 | |||
| 684 | Ga0316588_1002612 | |||
| 685 | Ga0316588_1003628 | |||
| 686 | Ga0316596_1000264 | |||
| 687 | Ga0316574_0000861 | |||
| 688 | Ga0316574_0046784 | |||
| 689 | Ga0316584_0000743 | |||
| 690 | Ga0316584_0004184 | |||
| 691 | Ga0395900_0011347 | |||
| 692 | Ga0395898_0005818 | |||
| 693 | Ga0395898_0007951 | |||
| 694 | Ga0395905_0007987 | |||
| 695 | Ga0395905_0025846 | |||
| 696 | Ga0316581_0015010 | |||
| 697 | Ga0436364_0791886 | |||
| 698 | Ga0395901_0000012 | |||
| 699 | Ga0400484_01634 | |||
| 700 | Ga0400490_05542 | |||
| 701 | Ga0400488_61237 | |||
| 702 | Ga0436365_0316342 | |||
| 703 | Ga0436365_1909455 | |||
| 704 | Ga0436363_0056306 | |||
| 705 | Ga0436363_1082889 | |||
| 706 | Ga0436362_0940601 | |||
| 707 | Ga0451853_2549014 | |||
| 708 | Ga0439448_0000249 | |||
| 709 | Ga0439452_000380 | |||
| 710 | Ga0450919_000744 | |||
| 711 | Ga0450923_002494 | |||
| 712 | Ga0450918_000018 | |||
| 713 | Ga0451577_0002882 | |||
| 714 | Ga0451577_0191930 | |||
| 715 | Ga0466972_0039297 | |||
| 716 | Ga0453683_0011247 | |||
| 717 | Ga0453683_0073949 | |||
| 718 | Ga0453683_0104390 | |||
| 719 | Ga0466966_0015353 | |||
| 720 | Ga0466961_0008581 | |||
| 721 | Ga0453684_0000265 | |||
| 722 | Ga0453684_0000318 | |||
| 723 | Ga0453684_0001413 | |||
| 724 | Ga0453684_0004176 | |||
| 725 | Ga0453684_0004293 | |||
| 726 | Ga0453684_0007294 | |||
| 727 | Ga0453684_0008244 | |||
| 728 | Ga0453684_0022457 | |||
| 729 | Ga0453684_0032145 | |||
| 730 | Ga0453684_0062275 | |||
| 731 | Ga0453684_0102919 | |||
| 732 | Ga0453684_0120931 | |||
| 733 | Ga0453684_0139622 | |||
| 734 | Ga0453684_0282179 | |||
| 735 | Ga0466971_0034810 | |||
| 736 | Ga0466959_0134705 | |||
| 737 | Ga0451576_0023787 | |||
| 738 | Ga0451576_0026686 | |||
| 739 | Ga0495592_0002697 | |||
| 740 | Ga0495651_0014755 | |||
| 741 | Ga0495653_0015666 | |||
| 742 | Ga0495653_0056131 | |||
| 743 | Ga0495650_0001359 | |||
| 744 | Ga0495650_0018612 | |||
| 745 | Ga0495664_0024219 | |||
| 746 | Ga0495608_0018698 | |||
| 747 | Ga0495618_0028926 | |||
| 748 | Ga0495628_0009504 | |||
| 749 | Ga0495628_0025832 | |||
| 750 | Ga0495628_0031467 | |||
| 751 | Ga0495628_0055384 | |||
| 752 | Ga0495648_0023543 | |||
| 753 | Ga0495652_0026929 | |||
| 754 | Ga0495652_0065976 | |||
| 755 | Ga0495645_0108065 | |||
| 756 | Ga0495622_0000020 | |||
| 757 | Ga0495625_0032386 | |||
| 758 | Ga0495599_0005392 | |||
| 759 | Ga0495624_0000704 | |||
| 760 | Ga0495600_0002266 | |||
| 761 | Ga0495604_0022023 | |||
| 762 | Ga0495672_0000049 | |||
| 763 | Ga0495687_000005 | |||
| 764 | Ga0495602_0095440 | |||
| 765 | Ga0495602_0120516 | |||
| 766 | Ga0496105_0070602 | |||
| 767 | Ga0496106_0000032 | |||
| 768 | Ga0496109_0176561 | |||
| 769 | Ga0496112_0184148 | |||
| 770 | Ga0496116_0005552 | |||
| 771 | Ga0496116_0022924 | |||
| 772 | Ga0496116_0060522 | |||
| 773 | Ga0496117_0002794 | |||
| 774 | Ga0496118_0029359 | |||
| 775 | Ga0496118_0069214 | |||
| 776 | Ga0496121_0000207 | |||
| 777 | Ga0496121_0010160 | |||
| 778 | Ga0496122_0000854 | |||
| 779 | Ga0496122_0043753 | |||
| 780 | Ga0496123_0002790 | |||
| 781 | Ga0496124_0014685 | |||
| 782 | Ga0496125_0000081 | |||
| 783 | Ga0496125_0000701 | |||
| 784 | Ga0496125_0108990 | |||
| 785 | Ga0496126_0000083 | |||
| 786 | Ga0496126_0002091 | |||
| 787 | Ga0501034_0024914 | |||
| 788 | nmdc:mga03683_3947_c1 | |||
| 789 | nmdc:mga0k408_25855_c1 | |||
| 790 | nmdc:mga0k408_3002_c1 | |||
| 791 | nmdc:mga0sz30_9862_c1 | |||
| 792 | Ga0495601_0019367 | |||
| 793 | Ga0500593_004650 | |||
| 794 | Ga0500595_007434 | |||
| 795 | Ga0500574_000292 | |||
| 796 | Ga0500588_0024807 | |||
| 797 | Ga0466962_0005954 | |||
| 798 | 2501072453 | |||
| 799 | 2501409153 | |||
| 800 | 2508735980 | |||
| 801 | 2509129778 | |||
| 802 | 2510248533 | |||
| 803 | 2511101102 | |||
| 804 | 2511107151 | |||
| 805 | 2511243051 | |||
| 806 | 2511251597 | |||
| 807 | 2512349457 | |||
| 808 | 2513960158 | |||
| 809 | 2515686037 | |||
| 810 | 2516018961 | |||
| 811 | 2519460284 | |||
| 812 | 2527075542 | |||
| 813 | 2550694878 | |||
| 814 | 2585292596 | |||
| 815 | 2587745259 | |||
| 816 | 2599739733 | |||
| 817 | 2599747324 | |||
| 818 | 2600209051 | |||
| 819 | 2644423533 | |||
| 820 | 2676745079 | |||
| 821 | 2719643040 | |||
| 822 | 2753565733 | |||
| 823 | 2774874019 | |||
| 824 | 2776259953 | |||
| 825 | 2792836830 | |||
| 826 | 2808983636 | |||
| 827 | 2809003631 | |||
| 828 | 2809010908 | |||
| 829 | 2809129300 | |||
| 830 | 2809149645 | |||
| 831 | 2817257918 | |||
| 832 | 2817281691 | |||
| 833 | 2819541753 | |||
| 834 | 2819593967 | |||
| 835 | 2819635266 | |||
| 836 | 2852619797 | |||
| 837 | 2857473620 | |||
| 838 | 2863424324 | |||
| 839 | 2868095362 | |||
| 840 | 2870073480 | |||
| 841 | 2882458154 | |||
| 842 | 2883089337 | |||
| 843 | 2884839788 | |||
| 844 | 2884856401 | |||
| 845 | 2885278250 | |||
| 846 | 2891672227 | |||
| 847 | 2896158766 | |||
| 848 | 2902685679 | |||
| 849 | 2904567490 | |||
| 850 | 2904574535 | |||
| 851 | 2904624415 | |||
| 852 | 2928158424 | |||
| 853 | 2928167364 | |||
| 854 | 2928177087 | |||
| 855 | 2928540349 | |||
| 856 | 2939577113 | |||
| 857 | 2981991890 | |||
| 858 | 3006971017 | |||
| 859 | 642414160 | |||
| 860 | 8018224598 | |||
| 861 | 8018851725 | |||
| 862 | 8020812184 | |||
| 863 | 8020942961 | |||
| 864 | 8020946652 | |||
| 865 | 8020959641 | |||
| 866 | 8021123949 | |||
| 867 | 8039100314 | |||
| 868 | 8040170704 | |||
| 869 | 8040176907 | |||
| 870 | 8055633765 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.8776 | 3 | 227 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.8727 | 5 | 226 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.8715 | 5 | 226 |
| 5x41-assembly2.cif.gz_D | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.8671 | 1 | 226 |
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.8635 | 5 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6BEX0_1_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9722 | 3 | 244 | 3.40.50.300 |
| af_P04983_256_497_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9698 | 259 | 494 | 3.40.50.300 |
| af_P0AAG8_265_500_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.967 | 260 | 489 | 3.40.50.300 |
| af_P0AAF3_266_503_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.961 | 266 | 496 | 3.40.50.300 |
| af_P77509_259_498_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9582 | 251 | 491 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A378GUS1-F1-model_v4 | deleted | 0.9737 | 1 | 195 |
|
| AF-A0A3M5GSI8-F1-model_v4 | Ribose/galactose/methyl galactoside import ATP-binding protein (EC 7.5.2.11) | 0.9724 | 1 | 200 |
GO:0005524
GO:0005886 GO:0016887 GO:0043211 |
| AF-A0A351KD13-F1-model_v4 | Ribose/galactose/methyl galactoside import ATP-binding protein (EC 7.5.2.11) | 0.9721 | 309 | 494 |
GO:0005524
GO:0005886 GO:0016887 GO:0043211 |
| AF-A0A703XM93-F1-model_v4 | Ribose/galactose/methyl galactoside import ATP-binding protein (EC 7.5.2.11) | 0.9705 | 384 | 494 |
GO:0005524
GO:0005886 GO:0016887 GO:0043211 |
| AF-A0A355RWD2-F1-model_v4 | Heme ABC transporter ATP-binding protein | 0.9692 | 3 | 229 |
GO:0005524
GO:0016887 |