F443259

General Info

Members Datasets Scaffolds Average Seq Length
435 311 870 509

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100043907|Ga0070690_1000439072
Length 506
Sequence MSDLLVEMTGITKDFPGVHALADASFELRPGEVHALVGENGAGKSTLMKILAGVYVPDAGEIRFKGEPVQIPNPRTALDLGISMIHQELNLAPHLTVAQNIFLGREPRGRPRFLLDDRRLNQQTQELIDRLHLKLEATARVGDLKIAQQQMVEIAKALSLNAAVLVMDEPTAALTDTEIDELFRIIRDLRTDGVGVVHISHRLEELKQISDRVTVMRDGRYVATLDIADASIPVVINMMVGRTIYEEAPDIPVRSDEVVLEVRGLSRGRMVRDVSFVLHRGEILGVAGLVGAGRTELVRAIFGADRPESGEILVHGKLAAIASPADAVQLGIAYLSEDRKRYGLALGLDVETNVVLASLQTFLSSLGRVDTRRTRAVAEQRVQDLGIKTPSVRQHARNLSGGTQQKVVIAKWLTADTDILIFDEPTRGIDVGAKSEIYHLLNELARDGKAIIMISSELPEILRMSHRVIVMCEGRLTGELIGPAATQEAIMTLATQRESVAEAVPA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
162 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
163 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
176 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
177 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
185 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
237 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
240 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
241 2508501050 Microvirga lupini Lut6 Isolate Nodule
242 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
243 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
244 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
245 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
246 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
247 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
248 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
249 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
250 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
251 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
252 2519103095 Burkholderia sp. KJ006 Isolate Nodule
253 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
254 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
255 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
256 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
257 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
258 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
259 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
260 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
261 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
262 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
263 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
264 2773857925 Microvirga vignae BR3299 Isolate Unclassified
265 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
266 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
267 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
268 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
269 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
270 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
271 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
272 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
273 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
274 2818991436 Collimonas arenae 515 Isolate Unclassified
275 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
276 2818991452 Burkholderia cepacia 561 Isolate Unclassified
277 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
278 2857472729 Cohnella sp. R-74144 Isolate Unclassified
279 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
280 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
281 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
282 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
283 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
284 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
285 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
286 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
287 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
288 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
289 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
290 2904564687 Burkholderia sp. 571 Isolate Unclassified
291 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
292 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
293 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
294 2928163908 Burkholderia sp. 567 Isolate Unclassified
295 2928170801 Burkholderia sp. 572 Isolate Unclassified
296 2928536128 Burkholderia sola 565 Isolate Unclassified
297 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
298 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
299 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
300 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
301 8018221730 Enterobacter sp. CM29 Isolate Unclassified
302 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
303 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
304 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
305 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
306 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
307 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
308 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
309 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
310 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
311 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.3
Metatranscriptomes 0.92
Isolates 16.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.71
Nodule 3.45
Rhizoplane 1.84
Rhizosphere 57.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100043907 3300005330 Bacteria 2836
2 JGI24739J22299_10011619 3300001989 Bacteria 3248
3 JGI25155J39150_1000760 3300002704 Bacteria 5361
4 JGI25156J39149_1000043 3300002705 Bacteria 105452
5 JGI25156J39149_1000098 3300002705 Bacteria 64288
6 JGI25156J39149_1005401 3300002705 Bacteria 3693
7 JGI25162J39368_1000021 3300002737 Bacteria 248155
8 JGI25154J39366_1000062 3300002738 Bacteria 105525
9 JGI25154J39366_1000519 3300002738 Bacteria 19394
10 JGI25154J39366_1003133 3300002738 Bacteria 3686
11 JGI25157J39369_1000060 3300002741 Bacteria 105525
12 JGI25157J39369_1000102 3300002741 Bacteria 72343
13 JGI25157J39369_1000668 3300002741 Bacteria 18866
14 JGI25159J45721_1000163 3300002987 Bacteria 31237
15 JGI25165J46597_1000049 3300003214 Bacteria 248154
16 JGI25160J50197_1000174 3300003354 Bacteria 54817
17 JGI25160J50197_1000197 3300003354 Bacteria 50744
18 JGI25161J50226_1000057 3300003374 Bacteria 102462
19 Ga0055538_1000023 3300003751 Bacteria 248154
20 Ga0055539_1000030 3300003752 Bacteria 248154
21 Ga0055533_1000039 3300003756 Bacteria 248154
22 Ga0055532_1000034 3300003758 Bacteria 210984
23 Ga0055525_1000048 3300003759 Bacteria 248154
24 Ga0055535_1004980 3300003761 Bacteria 3040
25 Ga0055528_1001609 3300003790 Bacteria 13350
26 Ga0055541_1000021 3300003841 Bacteria 248154
27 Ga0055541_1002175 3300003841 Bacteria 3983
28 Ga0055543_1002755 3300004625 Bacteria 5581
29 Ga0065165_1014714 3300005262 Bacteria 3024
30 Ga0065165_1014734 3300005262 Bacteria 3020
31 Ga0065707_10121565 3300005295 Bacteria 2106
32 Ga0070658_10037674 3300005327 Bacteria 3899
33 Ga0070683_100179413 3300005329 Bacteria 2010
34 Ga0070680_100015442 3300005336 Bacteria 5986
35 Ga0070660_100000006 3300005339 Bacteria 166714
36 Ga0070660_100000824 3300005339 Bacteria 20581
37 Ga0070689_100009103 3300005340 Bacteria 7030
38 Ga0070692_10005707 3300005345 Bacteria 5343
39 Ga0070674_100024428 3300005356 Bacteria 3922
40 Ga0070673_100002446 3300005364 Bacteria 11313
41 Ga0070659_100000078 3300005366 Bacteria 74646
42 Ga0070701_10001168 3300005438 Bacteria 9615
43 Ga0070700_100000628 3300005441 Bacteria 17527
44 Ga0070694_100025120 3300005444 Bacteria 3853
45 Ga0070663_100000371 3300005455 Bacteria 23590
46 Ga0068867_100001785 3300005459 Bacteria 14965
47 Ga0070706_100011134 3300005467 Bacteria 8350
48 Ga0070706_100078987 3300005467 Bacteria 3045
49 Ga0070707_100019569 3300005468 Bacteria 6379
50 Ga0070707_100035033 3300005468 Bacteria 4787
51 Ga0070707_100052609 3300005468 Bacteria 3904
52 Ga0070707_100180248 3300005468 Bacteria 2059
53 Ga0070698_100000498 3300005471 Bacteria 41800
54 Ga0070686_100043432 3300005544 Bacteria 2820
55 Ga0070686_100122717 3300005544 Bacteria 1786
56 Ga0070695_100059167 3300005545 Bacteria 2480
57 Ga0070665_100001916 3300005548 Bacteria 23511
58 Ga0070704_100006762 3300005549 Bacteria 6787
59 Ga0068855_100002067 3300005563 Bacteria 24867
60 Ga0068855_100016635 3300005563 Bacteria 8842
61 Ga0070664_100109686 3300005564 Bacteria 2407
62 Ga0070702_100001192 3300005615 Bacteria 10482
63 Ga0068852_100002439 3300005616 Bacteria 12803
64 Ga0068852_100029314 3300005616 Bacteria 4520
65 Ga0068859_100030507 3300005617 Bacteria 5411
66 Ga0068864_100225812 3300005618 Bacteria 1730
67 Ga0068866_10002094 3300005718 Bacteria 8300
68 Ga0068861_100000984 3300005719 Bacteria 17406
69 Ga0068861_100006778 3300005719 Bacteria 7824
70 Ga0068863_100016059 3300005841 Bacteria 7180
71 Ga0068858_100008134 3300005842 Bacteria 10085
72 Ga0068858_100082165 3300005842 Bacteria 2995
73 Ga0068862_100017350 3300005844 Bacteria 5994
74 Ga0075364_10038405 3300006051 Bacteria 3102
75 Ga0070712_100057648 3300006175 Bacteria 2729
76 Ga0075367_10015048 3300006178 Bacteria 4195
77 Ga0075366_10003173 3300006195 Bacteria 8609
78 Ga0075370_10020484 3300006353 Bacteria 3616
79 Ga0068871_100006608 3300006358 Bacteria 8222
80 Ga0068865_100003142 3300006881 Bacteria 9886
81 Ga0097620_100030508 3300006931 Bacteria 5411
82 Ga0079104_1000074 3300006946 Bacteria 150348
83 Ga0079104_1000675 3300006946 Bacteria 31832
84 Ga0105250_10000086 3300009092 Bacteria 81683
85 Ga0105240_10000799 3300009093 Bacteria 56992
86 Ga0105240_10001916 3300009093 Bacteria 34556
87 Ga0105240_10011310 3300009093 Bacteria 12432
88 Ga0111539_10012394 3300009094 Bacteria 10688
89 Ga0105245_10007509 3300009098 Bacteria 9554
90 Ga0105245_10090295 3300009098 Bacteria 2817
91 Ga0105245_10110347 3300009098 Bacteria 2557
92 Ga0114129_10154139 3300009147 Bacteria 3143
93 Ga0105243_10004749 3300009148 Bacteria 10683
94 Ga0105248_10024051 3300009177 Bacteria 6770
95 Ga0105248_10037513 3300009177 Bacteria 5422
96 Ga0105248_10200123 3300009177 Bacteria 2251
97 Ga0105237_10069052 3300009545 Bacteria 3528
98 Ga0105238_10009999 3300009551 Bacteria 9514
99 Ga0105239_10007147 3300010375 Bacteria 12844
100 Ga0105239_10022712 3300010375 Bacteria 6915
101 Ga0157371_10002771 3300013102 Bacteria 16461
102 Ga0157370_10002288 3300013104 Bacteria 23212
103 Ga0157370_10108586 3300013104 Bacteria 2594
104 Ga0157369_10001266 3300013105 Bacteria 31371
105 Ga0157369_10117049 3300013105 Bacteria 2829
106 Ga0157374_10000032 3300013296 Bacteria 202485
107 Ga0157378_10015230 3300013297 Bacteria 6735
108 Ga0157372_10010032 3300013307 Bacteria 10072
109 Ga0157372_10142487 3300013307 Bacteria 2763
110 Ga0157375_10065748 3300013308 Bacteria 3616
111 Ga0157375_10251382 3300013308 Bacteria 1928
112 Ga0163163_10052670 3300014325 Bacteria 4016
113 Ga0163163_10053304 3300014325 Bacteria 3992
114 Ga0157380_10046683 3300014326 Bacteria 3403
115 Ga0182008_10029486 3300014497 Bacteria 2773
116 Ga0157379_10022123 3300014968 Bacteria 5636
117 Ga0157379_10022425 3300014968 Bacteria 5593
118 Ga0157379_10025728 3300014968 Bacteria 5231
119 Ga0157376_10008622 3300014969 Bacteria 7370
120 Ga0213876_10001430 3300021384 Bacteria 14872
121 Ga0213876_10004490 3300021384 Bacteria 7798
122 Ga0209435_100007 3300025206 Bacteria 516857
123 Ga0209435_100041 3300025206 Bacteria 105577
124 Ga0209435_100124 3300025206 Bacteria 27904
125 Ga0209436_104378 3300025208 Bacteria 3506
126 Ga0209784_100004 3300025224 Bacteria 1378156
127 Ga0209784_100299 3300025224 Bacteria 26702
128 Ga0209566_100004 3300025225 Bacteria 1531866
129 Ga0209566_100436 3300025225 Bacteria 31141
130 Ga0209674_100006 3300025226 Bacteria 1531866
131 Ga0209674_100928 3300025226 Bacteria 9359
132 Ga0209672_100020 3300025228 Bacteria 429003
133 Ga0209672_100066 3300025228 Bacteria 189828
134 Ga0209147_100017 3300025229 Bacteria 516857
135 Ga0209147_100024 3300025229 Bacteria 429003
136 Ga0209147_100063 3300025229 Bacteria 241980
137 Ga0209147_100084 3300025229 Bacteria 189828
138 Ga0209563_100009 3300025230 Bacteria 1378156
139 Ga0207427_100321 3300025231 Bacteria 32350
140 Ga0209437_100004 3300025233 Bacteria 1378156
141 Ga0209437_100215 3300025233 Bacteria 106873
142 Ga0209258_100084 3300025242 Bacteria 244783
143 Ga0209258_100115 3300025242 Bacteria 190367
144 Ga0209258_100117 3300025242 Bacteria 189828
145 Ga0207425_1001486 3300025245 Bacteria 9746
146 Ga0209646_1000044 3300025246 Bacteria 334596
147 Ga0209646_1000144 3300025246 Bacteria 105691
148 Ga0209646_1000238 3300025246 Bacteria 57384
149 Ga0209026_1000063 3300025250 Bacteria 211324
150 Ga0209026_1000159 3300025250 Bacteria 105691
151 Ga0209026_1006502 3300025250 Bacteria 2840
152 Ga0209677_100005 3300025253 Bacteria 1378156
153 Ga0209148_1000148 3300025254 Bacteria 159642
154 Ga0209148_1001093 3300025254 Bacteria 16389
155 Ga0209759_1000001 3300025256 Bacteria 2799452
156 Ga0209759_1000048 3300025256 Bacteria 224817
157 Ga0209759_1000152 3300025256 Bacteria 119866
158 Ga0209759_1000991 3300025256 Bacteria 19486
159 Ga0209233_1000005 3300025261 Bacteria 1531866
160 Ga0209565_1001120 3300025263 Bacteria 13007
161 Ga0209455_1000110 3300025272 Bacteria 189828
162 Ga0209455_1000298 3300025272 Bacteria 51486
163 Ga0209673_1000056 3300025273 Bacteria 271069
164 Ga0209130_1000146 3300025284 Bacteria 111777
165 Ga0209675_1002535 3300025291 Bacteria 9279
166 Ga0209025_1005790 3300025294 Bacteria 9912
167 Ga0209050_1015090 3300025298 Bacteria 3274
168 Ga0207426_1000291 3300025302 Bacteria 99437
169 Ga0207696_1000024 3300025711 Bacteria 420123
170 Ga0207642_10002045 3300025899 Bacteria 6226
171 Ga0207647_10000667 3300025904 Bacteria 26815
172 Ga0207647_10002918 3300025904 Bacteria 12875
173 Ga0207705_10046147 3300025909 Bacteria 3130
174 Ga0207684_10109065 3300025910 Bacteria 2369
175 Ga0207695_10000328 3300025913 Bacteria 113378
176 Ga0207695_10001014 3300025913 Bacteria 49482
177 Ga0207695_10002743 3300025913 Bacteria 25683
178 Ga0207695_10005541 3300025913 Bacteria 16696
179 Ga0207695_10034570 3300025913 Bacteria 5494
180 Ga0207657_10000003 3300025919 Bacteria 263148
181 Ga0207657_10002598 3300025919 Bacteria 19544
182 Ga0207646_10001976 3300025922 Bacteria 24616
183 Ga0207646_10025452 3300025922 Bacteria 5413
184 Ga0207646_10037364 3300025922 Bacteria 4378
185 Ga0207694_10022363 3300025924 Bacteria 4796
186 Ga0207650_10042242 3300025925 Bacteria 3345
187 Ga0207687_10003593 3300025927 Bacteria 10444
188 Ga0207644_10019557 3300025931 Bacteria 4595
189 Ga0207690_10000007 3300025932 Bacteria 388533
190 Ga0207706_10002765 3300025933 Bacteria 17065
191 Ga0207686_10001924 3300025934 Bacteria 11468
192 Ga0207709_10003509 3300025935 Bacteria 9284
193 Ga0207704_10079968 3300025938 Bacteria 2108
194 Ga0207704_10093364 3300025938 Bacteria 1983
195 Ga0207711_10008554 3300025941 Bacteria 8561
196 Ga0207711_10013392 3300025941 Bacteria 6814
197 Ga0207689_10000481 3300025942 Bacteria 37621
198 Ga0207667_10012674 3300025949 Bacteria 9688
199 Ga0207667_10059058 3300025949 Bacteria 4019
200 Ga0207651_10003772 3300025960 Bacteria 7507
201 Ga0207651_10048401 3300025960 Bacteria 2874
202 Ga0207668_10025190 3300025972 Bacteria 3848
203 Ga0207677_10050580 3300026023 Bacteria 2812
204 Ga0207677_10094187 3300026023 Bacteria 2186
205 Ga0207703_10184428 3300026035 Bacteria 1843
206 Ga0207678_10000064 3300026067 Bacteria 83470
207 Ga0207708_10003877 3300026075 Bacteria 11008
208 Ga0207641_10045809 3300026088 Bacteria 3685
209 Ga0207648_10003813 3300026089 Bacteria 15762
210 Ga0207676_10097375 3300026095 Bacteria 2430
211 Ga0207675_100003018 3300026118 Bacteria 16505
212 Ga0207675_100005712 3300026118 Bacteria 11906
213 Ga0207698_10021399 3300026142 Bacteria 4472
214 Ga0207698_10030297 3300026142 Bacteria 3888
215 Ga0209281_1000066 3300027111 Bacteria 284953
216 Ga0209281_1000075 3300027111 Bacteria 267114
217 Ga0209371_1000076 3300027312 Bacteria 195166
218 Ga0209371_1010480 3300027312 Bacteria 2846
219 Ga0268266_10044968 3300028379 Bacteria 3775
220 Ga0268265_10112762 3300028380 Bacteria 2223
221 Ga0307517_10000122 3300028786 Bacteria 116429
222 Ga0307515_10000030 3300028794 Bacteria 364482
223 Ga0307515_10009956 3300028794 Bacteria 18302
224 Ga0307515_10015014 3300028794 Bacteria 14306
225 Ga0265338_10000037 3300028800 Bacteria 237244
226 Ga0268256_1000087 3300030500 Bacteria 157659
227 Ga0268256_1015937 3300030500 Bacteria 2173
228 Ga0265320_10016590 3300031240 Bacteria 4121
229 Ga0265325_10031563 3300031241 Bacteria 2834
230 Ga0307509_10000098 3300031507 Bacteria 121442
231 Ga0307509_10005586 3300031507 Bacteria 17423
232 Ga0307408_100004032 3300031548 Bacteria 10014
233 Ga0307408_100040352 3300031548 Bacteria 3305
234 Ga0307408_100132493 3300031548 Bacteria 1946
235 Ga0307508_10008457 3300031616 Bacteria 9508
236 Ga0307508_10011145 3300031616 Bacteria 8221
237 Ga0316579_10000882 3300031691 Bacteria 10399
238 Ga0316576_10002076 3300031727 Bacteria 11250
239 Ga0316576_10002173 3300031727 Bacteria 11065
240 Ga0316576_10004965 3300031727 Bacteria 8058
241 Ga0307516_10077865 3300031730 Bacteria 3163
242 Ga0307406_10020916 3300031901 Bacteria 3863
243 Ga0316585_10000100 3300032137 Bacteria 15598
244 Ga0316585_10005848 3300032137 Bacteria 3488
245 Ga0316580_10000741 3300032139 Bacteria 7902
246 Ga0316593_10005370 3300032168 Bacteria 3372
247 Ga0307510_10056784 3300033180 Bacteria 4070
248 Ga0307510_10105420 3300033180 Bacteria 2587
249 Ga0316588_1002612 3300033528 Bacteria 3159
250 Ga0316588_1003628 3300033528 Bacteria 2841
251 Ga0316596_1000264 3300033541 Bacteria 8131
252 Ga0316574_0000861 3300035398 Bacteria 13357
253 Ga0316574_0046784 3300035398 Bacteria 2684
254 Ga0316584_0000743 3300036712 Bacteria 18138
255 Ga0316584_0004184 3300036712 Bacteria 9527
256 Ga0395900_0011347 3300037418 Bacteria 9116
257 Ga0395898_0005818 3300037466 Bacteria 13263
258 Ga0395898_0007951 3300037466 Bacteria 11245
259 Ga0395905_0007987 3300037471 Bacteria 10455
260 Ga0395905_0025846 3300037471 Bacteria 5534
261 Ga0316581_0015010 3300037588 Bacteria 2210
262 Ga0436364_0791886 3300037853 Bacteria 9156
263 Ga0395901_0000012 3300038443 Bacteria 381361
264 Ga0400484_01634 3300038725 Bacteria 10598
265 Ga0400490_05542 3300038726 Bacteria 4397
266 Ga0400488_61237 3300038741 Bacteria 3768
267 Ga0436365_0316342 3300039437 Bacteria 1740
268 Ga0436365_1909455 3300039437 Bacteria 3109
269 Ga0436363_0056306 3300039450 Bacteria 6681
270 Ga0436363_1082889 3300039450 Bacteria 2077
271 Ga0436362_0940601 3300039453 Bacteria 3142
272 Ga0451853_2549014 3300041512 Bacteria 1995
273 Ga0439448_0000249 3300042005 Bacteria 11627
274 Ga0439452_000380 3300042010 Bacteria 26638
275 Ga0450919_000744 3300042121 Bacteria 4132
276 Ga0450923_002494 3300042125 Bacteria 2649
277 Ga0450918_000018 3300042531 Bacteria 32477
278 Ga0451577_0002882 3300042876 Bacteria 19756
279 Ga0451577_0191930 3300042876 Bacteria 1843
280 Ga0466972_0039297 3300044658 Bacteria 2309
281 Ga0453683_0011247 3300044673 Bacteria 5909
282 Ga0453683_0073949 3300044673 Bacteria 2133
283 Ga0453683_0104390 3300044673 Bacteria 1780
284 Ga0466966_0015353 3300044684 Bacteria 5064
285 Ga0466961_0008581 3300044693 Bacteria 6510
286 Ga0453684_0000265 3300044712 Bacteria 225591
287 Ga0453684_0000318 3300044712 Bacteria 203553
288 Ga0453684_0001413 3300044712 Bacteria 69115
289 Ga0453684_0004176 3300044712 Bacteria 31113
290 Ga0453684_0004293 3300044712 Bacteria 30381
291 Ga0453684_0007294 3300044712 Bacteria 20459
292 Ga0453684_0008244 3300044712 Bacteria 18782
293 Ga0453684_0022457 3300044712 Bacteria 9355
294 Ga0453684_0032145 3300044712 Bacteria 7354
295 Ga0453684_0062275 3300044712 Bacteria 4780
296 Ga0453684_0102919 3300044712 Bacteria 3491
297 Ga0453684_0120931 3300044712 Bacteria 3162
298 Ga0453684_0139622 3300044712 Bacteria 2896
299 Ga0453684_0282179 3300044712 Bacteria 1894
300 Ga0466971_0034810 3300044719 Bacteria 2257
301 Ga0466959_0134705 3300045049 Bacteria 1749
302 Ga0451576_0023787 3300045051 Bacteria 6628
303 Ga0451576_0026686 3300045051 Bacteria 6209
304 Ga0495592_0002697 3300046454 Bacteria 12561
305 Ga0495651_0014755 3300046462 Bacteria 6042
306 Ga0495653_0015666 3300046463 Bacteria 6179
307 Ga0495653_0056131 3300046463 Bacteria 3003
308 Ga0495650_0001359 3300046471 Bacteria 24265
309 Ga0495650_0018612 3300046471 Bacteria 3446
310 Ga0495664_0024219 3300046477 Bacteria 3527
311 Ga0495608_0018698 3300046511 Bacteria 4775
312 Ga0495618_0028926 3300046514 Bacteria 3455
313 Ga0495628_0009504 3300046516 Bacteria 8303
314 Ga0495628_0025832 3300046516 Bacteria 4796
315 Ga0495628_0031467 3300046516 Bacteria 4291
316 Ga0495628_0055384 3300046516 Bacteria 3124
317 Ga0495648_0023543 3300046524 Bacteria 4215
318 Ga0495652_0026929 3300046529 Bacteria 5071
319 Ga0495652_0065976 3300046529 Bacteria 3040
320 Ga0495645_0108065 3300046543 Bacteria 1971
321 Ga0495622_0000020 3300046557 Bacteria 166839
322 Ga0495625_0032386 3300046660 Bacteria 3876
323 Ga0495599_0005392 3300046678 Bacteria 7640
324 Ga0495624_0000704 3300046690 Bacteria 26244
325 Ga0495600_0002266 3300046809 Bacteria 10962
326 Ga0495604_0022023 3300047317 Bacteria 5087
327 Ga0495672_0000049 3300047320 Bacteria 240851
328 Ga0495687_000005 3300047443 Bacteria 610401
329 Ga0495602_0095440 3300048088 Bacteria 2455
330 Ga0495602_0120516 3300048088 Bacteria 2111
331 Ga0496105_0070602 3300048908 Bacteria 2887
332 Ga0496106_0000032 3300048909 Bacteria 134707
333 Ga0496109_0176561 3300048912 Bacteria 2005
334 Ga0496112_0184148 3300048915 Bacteria 2052
335 Ga0496116_0005552 3300048919 Bacteria 11636
336 Ga0496116_0022924 3300048919 Bacteria 4661
337 Ga0496116_0060522 3300048919 Bacteria 2456
338 Ga0496117_0002794 3300048920 Bacteria 21308
339 Ga0496118_0029359 3300048921 Bacteria 4612
340 Ga0496118_0069214 3300048921 Bacteria 2558
341 Ga0496121_0000207 3300048924 Bacteria 129797
342 Ga0496121_0010160 3300048924 Bacteria 10660
343 Ga0496122_0000854 3300048925 Bacteria 57341
344 Ga0496122_0043753 3300048925 Bacteria 3504
345 Ga0496123_0002790 3300048926 Bacteria 20756
346 Ga0496124_0014685 3300048927 Bacteria 7561
347 Ga0496125_0000081 3300048928 Bacteria 228069
348 Ga0496125_0000701 3300048928 Bacteria 55423
349 Ga0496125_0108990 3300048928 Bacteria 2012
350 Ga0496126_0000083 3300048929 Bacteria 217567
351 Ga0496126_0002091 3300048929 Bacteria 27956
352 Ga0501034_0024914 3300049571 Bacteria 6088
353 nmdc:mga03683_3947_c1 3300050489 Bacteria 4856
354 nmdc:mga0k408_25855_c1 3300050493 Bacteria 3327
355 nmdc:mga0k408_3002_c1 3300050493 Bacteria 8950
356 nmdc:mga0sz30_9862_c1 3300050516 Bacteria 3644
357 Ga0495601_0019367 3300053077 Bacteria 4151
358 Ga0500593_004650 3300053117 Bacteria 5343
359 Ga0500595_007434 3300053119 Bacteria 4546
360 Ga0500574_000292 3300053141 Bacteria 6158
361 Ga0500588_0024807 3300053146 Bacteria 1659
362 Ga0466962_0005954 3300061719 Bacteria 5859
363 2501072453 2501025501 Bacteria 7768574
364 2501409153 2501025504 Bacteria 8008976
365 2508735980 2508501050 Bacteria 9633614
366 2509129778 2508501125 Bacteria 7208311
367 2510248533 2510065045 Bacteria 7761063
368 2511101102 2510917014 Bacteria 8296963
369 2511107151 2510917015 Bacteria 7950052
370 2511243051 2511231002 Bacteria 5042903
371 2511251597 2511231003 Bacteria 5606035
372 2512349457 2512047030 Bacteria 9031815
373 2513960158 2513237151 Bacteria 6309801
374 2515686037 2515154122 Bacteria 8609520
375 2516018961 2515154189 Bacteria 9629850
376 2519460284 2519103095 Bacteria 6629912
377 2527075542 2526164713 Bacteria 6780608
378 2550694878 2548876994 Bacteria 4904866
379 2585292596 2582581311 Bacteria 6763856
380 2587745259 2585428059 Bacteria 8696589
381 2599739733 2599185239 Bacteria 8686614
382 2599747324 2599185240 Bacteria 7968121
383 2600209051 2599185355 Bacteria 7968906
384 2644423533 2643221676 Bacteria 8119172
385 2676745079 2675903129 Bacteria 7964495
386 2719643040 2718217991 Bacteria 7829542
387 2753565733 2751185846 Bacteria 7242164
388 2774874019 2773857925 Bacteria 6472445
389 2776259953 2775506901 Bacteria 9631051
390 2792836830 2791355137 Bacteria 9654227
391 2808983636 2808606386 Bacteria 4471946
392 2809003631 2808606390 Bacteria 8476311
393 2809010908 2808606391 Bacteria 8308166
394 2809129300 2808606415 Bacteria 4576710
395 2809149645 2808606419 Bacteria 4576925
396 2817257918 2816332253 Bacteria 6764532
397 2817281691 2816332256 Bacteria 6891714
398 2819541753 2818991436 Bacteria 5376622
399 2819593967 2818991445 Bacteria 4955017
400 2819635266 2818991452 Bacteria 8442785
401 2852619797 2852618963 Bacteria 4577824
402 2857473620 2857472729 Bacteria 6568124
403 2863424324 2863421361 Bacteria 7300805
404 2868095362 2868088558 Bacteria 7609351
405 2870073480 2870068957 Bacteria 8925310
406 2882458154 2882456835 Bacteria 6863978
407 2883089337 2883087390 Bacteria 9532701
408 2884839788 2884836552 Bacteria 5219991
409 2884856401 2884852848 Bacteria 5221161
410 2885278250 2885270888 Bacteria 9831543
411 2891672227 2891670763 Bacteria 4967099
412 2896158766 2896154374 Bacteria 5221518
413 2902685679 2902682994 Bacteria 8951596
414 2904567490 2904564687 Bacteria 7609577
415 2904574535 2904571731 Bacteria 7608790
416 2904624415 2904615490 Bacteria 10047340
417 2928158424 2928157003 Bacteria 7522202
418 2928167364 2928163908 Bacteria 7561269
419 2928177087 2928170801 Bacteria 8785406
420 2928540349 2928536128 Bacteria 7657547
421 2939577113 2939573065 Bacteria 4926053
422 2981991890 2981990288 Bacteria 7590678
423 3006971017 3006969106 Bacteria 4739423
424 642414160 641736154 Bacteria 7689995
425 8018224598 8018221730 Bacteria 4616064
426 8018851725 8018845410 Bacteria 8933938
427 8020812184 8020807995 Bacteria 6801506
428 8020942961 8020938398 Bacteria 7472757
429 8020946652 8020945358 Bacteria 8467355
430 8020959641 8020953355 Bacteria 7439080
431 8021123949 8021120328 Bacteria 8782274
432 8039100314 8039098773 Bacteria 6602928
433 8040170704 8040167225 Bacteria 6542727
434 8040176907 8040173305 Bacteria 6827067
435 8055633765 8055632911 Bacteria 5283357
436 Ga0070690_100043907
437 JGI24739J22299_10011619
438 JGI25155J39150_1000760
439 JGI25156J39149_1000043
440 JGI25156J39149_1000098
441 JGI25156J39149_1005401
442 JGI25162J39368_1000021
443 JGI25154J39366_1000062
444 JGI25154J39366_1000519
445 JGI25154J39366_1003133
446 JGI25157J39369_1000060
447 JGI25157J39369_1000102
448 JGI25157J39369_1000668
449 JGI25159J45721_1000163
450 JGI25165J46597_1000049
451 JGI25160J50197_1000174
452 JGI25160J50197_1000197
453 JGI25161J50226_1000057
454 Ga0055538_1000023
455 Ga0055539_1000030
456 Ga0055533_1000039
457 Ga0055532_1000034
458 Ga0055525_1000048
459 Ga0055535_1004980
460 Ga0055528_1001609
461 Ga0055541_1000021
462 Ga0055541_1002175
463 Ga0055543_1002755
464 Ga0065165_1014714
465 Ga0065165_1014734
466 Ga0065707_10121565
467 Ga0070658_10037674
468 Ga0070683_100179413
469 Ga0070680_100015442
470 Ga0070660_100000006
471 Ga0070660_100000824
472 Ga0070689_100009103
473 Ga0070692_10005707
474 Ga0070674_100024428
475 Ga0070673_100002446
476 Ga0070659_100000078
477 Ga0070701_10001168
478 Ga0070700_100000628
479 Ga0070694_100025120
480 Ga0070663_100000371
481 Ga0068867_100001785
482 Ga0070706_100011134
483 Ga0070706_100078987
484 Ga0070707_100019569
485 Ga0070707_100035033
486 Ga0070707_100052609
487 Ga0070707_100180248
488 Ga0070698_100000498
489 Ga0070686_100043432
490 Ga0070686_100122717
491 Ga0070695_100059167
492 Ga0070665_100001916
493 Ga0070704_100006762
494 Ga0068855_100002067
495 Ga0068855_100016635
496 Ga0070664_100109686
497 Ga0070702_100001192
498 Ga0068852_100002439
499 Ga0068852_100029314
500 Ga0068859_100030507
501 Ga0068864_100225812
502 Ga0068866_10002094
503 Ga0068861_100000984
504 Ga0068861_100006778
505 Ga0068863_100016059
506 Ga0068858_100008134
507 Ga0068858_100082165
508 Ga0068862_100017350
509 Ga0075364_10038405
510 Ga0070712_100057648
511 Ga0075367_10015048
512 Ga0075366_10003173
513 Ga0075370_10020484
514 Ga0068871_100006608
515 Ga0068865_100003142
516 Ga0097620_100030508
517 Ga0079104_1000074
518 Ga0079104_1000675
519 Ga0105250_10000086
520 Ga0105240_10000799
521 Ga0105240_10001916
522 Ga0105240_10011310
523 Ga0111539_10012394
524 Ga0105245_10007509
525 Ga0105245_10090295
526 Ga0105245_10110347
527 Ga0114129_10154139
528 Ga0105243_10004749
529 Ga0105248_10024051
530 Ga0105248_10037513
531 Ga0105248_10200123
532 Ga0105237_10069052
533 Ga0105238_10009999
534 Ga0105239_10007147
535 Ga0105239_10022712
536 Ga0157371_10002771
537 Ga0157370_10002288
538 Ga0157370_10108586
539 Ga0157369_10001266
540 Ga0157369_10117049
541 Ga0157374_10000032
542 Ga0157378_10015230
543 Ga0157372_10010032
544 Ga0157372_10142487
545 Ga0157375_10065748
546 Ga0157375_10251382
547 Ga0163163_10052670
548 Ga0163163_10053304
549 Ga0157380_10046683
550 Ga0182008_10029486
551 Ga0157379_10022123
552 Ga0157379_10022425
553 Ga0157379_10025728
554 Ga0157376_10008622
555 Ga0213876_10001430
556 Ga0213876_10004490
557 Ga0209435_100007
558 Ga0209435_100041
559 Ga0209435_100124
560 Ga0209436_104378
561 Ga0209784_100004
562 Ga0209784_100299
563 Ga0209566_100004
564 Ga0209566_100436
565 Ga0209674_100006
566 Ga0209674_100928
567 Ga0209672_100020
568 Ga0209672_100066
569 Ga0209147_100017
570 Ga0209147_100024
571 Ga0209147_100063
572 Ga0209147_100084
573 Ga0209563_100009
574 Ga0207427_100321
575 Ga0209437_100004
576 Ga0209437_100215
577 Ga0209258_100084
578 Ga0209258_100115
579 Ga0209258_100117
580 Ga0207425_1001486
581 Ga0209646_1000044
582 Ga0209646_1000144
583 Ga0209646_1000238
584 Ga0209026_1000063
585 Ga0209026_1000159
586 Ga0209026_1006502
587 Ga0209677_100005
588 Ga0209148_1000148
589 Ga0209148_1001093
590 Ga0209759_1000001
591 Ga0209759_1000048
592 Ga0209759_1000152
593 Ga0209759_1000991
594 Ga0209233_1000005
595 Ga0209565_1001120
596 Ga0209455_1000110
597 Ga0209455_1000298
598 Ga0209673_1000056
599 Ga0209130_1000146
600 Ga0209675_1002535
601 Ga0209025_1005790
602 Ga0209050_1015090
603 Ga0207426_1000291
604 Ga0207696_1000024
605 Ga0207642_10002045
606 Ga0207647_10000667
607 Ga0207647_10002918
608 Ga0207705_10046147
609 Ga0207684_10109065
610 Ga0207695_10000328
611 Ga0207695_10001014
612 Ga0207695_10002743
613 Ga0207695_10005541
614 Ga0207695_10034570
615 Ga0207657_10000003
616 Ga0207657_10002598
617 Ga0207646_10001976
618 Ga0207646_10025452
619 Ga0207646_10037364
620 Ga0207694_10022363
621 Ga0207650_10042242
622 Ga0207687_10003593
623 Ga0207644_10019557
624 Ga0207690_10000007
625 Ga0207706_10002765
626 Ga0207686_10001924
627 Ga0207709_10003509
628 Ga0207704_10079968
629 Ga0207704_10093364
630 Ga0207711_10008554
631 Ga0207711_10013392
632 Ga0207689_10000481
633 Ga0207667_10012674
634 Ga0207667_10059058
635 Ga0207651_10003772
636 Ga0207651_10048401
637 Ga0207668_10025190
638 Ga0207677_10050580
639 Ga0207677_10094187
640 Ga0207703_10184428
641 Ga0207678_10000064
642 Ga0207708_10003877
643 Ga0207641_10045809
644 Ga0207648_10003813
645 Ga0207676_10097375
646 Ga0207675_100003018
647 Ga0207675_100005712
648 Ga0207698_10021399
649 Ga0207698_10030297
650 Ga0209281_1000066
651 Ga0209281_1000075
652 Ga0209371_1000076
653 Ga0209371_1010480
654 Ga0268266_10044968
655 Ga0268265_10112762
656 Ga0307517_10000122
657 Ga0307515_10000030
658 Ga0307515_10009956
659 Ga0307515_10015014
660 Ga0265338_10000037
661 Ga0268256_1000087
662 Ga0268256_1015937
663 Ga0265320_10016590
664 Ga0265325_10031563
665 Ga0307509_10000098
666 Ga0307509_10005586
667 Ga0307408_100004032
668 Ga0307408_100040352
669 Ga0307408_100132493
670 Ga0307508_10008457
671 Ga0307508_10011145
672 Ga0316579_10000882
673 Ga0316576_10002076
674 Ga0316576_10002173
675 Ga0316576_10004965
676 Ga0307516_10077865
677 Ga0307406_10020916
678 Ga0316585_10000100
679 Ga0316585_10005848
680 Ga0316580_10000741
681 Ga0316593_10005370
682 Ga0307510_10056784
683 Ga0307510_10105420
684 Ga0316588_1002612
685 Ga0316588_1003628
686 Ga0316596_1000264
687 Ga0316574_0000861
688 Ga0316574_0046784
689 Ga0316584_0000743
690 Ga0316584_0004184
691 Ga0395900_0011347
692 Ga0395898_0005818
693 Ga0395898_0007951
694 Ga0395905_0007987
695 Ga0395905_0025846
696 Ga0316581_0015010
697 Ga0436364_0791886
698 Ga0395901_0000012
699 Ga0400484_01634
700 Ga0400490_05542
701 Ga0400488_61237
702 Ga0436365_0316342
703 Ga0436365_1909455
704 Ga0436363_0056306
705 Ga0436363_1082889
706 Ga0436362_0940601
707 Ga0451853_2549014
708 Ga0439448_0000249
709 Ga0439452_000380
710 Ga0450919_000744
711 Ga0450923_002494
712 Ga0450918_000018
713 Ga0451577_0002882
714 Ga0451577_0191930
715 Ga0466972_0039297
716 Ga0453683_0011247
717 Ga0453683_0073949
718 Ga0453683_0104390
719 Ga0466966_0015353
720 Ga0466961_0008581
721 Ga0453684_0000265
722 Ga0453684_0000318
723 Ga0453684_0001413
724 Ga0453684_0004176
725 Ga0453684_0004293
726 Ga0453684_0007294
727 Ga0453684_0008244
728 Ga0453684_0022457
729 Ga0453684_0032145
730 Ga0453684_0062275
731 Ga0453684_0102919
732 Ga0453684_0120931
733 Ga0453684_0139622
734 Ga0453684_0282179
735 Ga0466971_0034810
736 Ga0466959_0134705
737 Ga0451576_0023787
738 Ga0451576_0026686
739 Ga0495592_0002697
740 Ga0495651_0014755
741 Ga0495653_0015666
742 Ga0495653_0056131
743 Ga0495650_0001359
744 Ga0495650_0018612
745 Ga0495664_0024219
746 Ga0495608_0018698
747 Ga0495618_0028926
748 Ga0495628_0009504
749 Ga0495628_0025832
750 Ga0495628_0031467
751 Ga0495628_0055384
752 Ga0495648_0023543
753 Ga0495652_0026929
754 Ga0495652_0065976
755 Ga0495645_0108065
756 Ga0495622_0000020
757 Ga0495625_0032386
758 Ga0495599_0005392
759 Ga0495624_0000704
760 Ga0495600_0002266
761 Ga0495604_0022023
762 Ga0495672_0000049
763 Ga0495687_000005
764 Ga0495602_0095440
765 Ga0495602_0120516
766 Ga0496105_0070602
767 Ga0496106_0000032
768 Ga0496109_0176561
769 Ga0496112_0184148
770 Ga0496116_0005552
771 Ga0496116_0022924
772 Ga0496116_0060522
773 Ga0496117_0002794
774 Ga0496118_0029359
775 Ga0496118_0069214
776 Ga0496121_0000207
777 Ga0496121_0010160
778 Ga0496122_0000854
779 Ga0496122_0043753
780 Ga0496123_0002790
781 Ga0496124_0014685
782 Ga0496125_0000081
783 Ga0496125_0000701
784 Ga0496125_0108990
785 Ga0496126_0000083
786 Ga0496126_0002091
787 Ga0501034_0024914
788 nmdc:mga03683_3947_c1
789 nmdc:mga0k408_25855_c1
790 nmdc:mga0k408_3002_c1
791 nmdc:mga0sz30_9862_c1
792 Ga0495601_0019367
793 Ga0500593_004650
794 Ga0500595_007434
795 Ga0500574_000292
796 Ga0500588_0024807
797 Ga0466962_0005954
798 2501072453
799 2501409153
800 2508735980
801 2509129778
802 2510248533
803 2511101102
804 2511107151
805 2511243051
806 2511251597
807 2512349457
808 2513960158
809 2515686037
810 2516018961
811 2519460284
812 2527075542
813 2550694878
814 2585292596
815 2587745259
816 2599739733
817 2599747324
818 2600209051
819 2644423533
820 2676745079
821 2719643040
822 2753565733
823 2774874019
824 2776259953
825 2792836830
826 2808983636
827 2809003631
828 2809010908
829 2809129300
830 2809149645
831 2817257918
832 2817281691
833 2819541753
834 2819593967
835 2819635266
836 2852619797
837 2857473620
838 2863424324
839 2868095362
840 2870073480
841 2882458154
842 2883089337
843 2884839788
844 2884856401
845 2885278250
846 2891672227
847 2896158766
848 2902685679
849 2904567490
850 2904574535
851 2904624415
852 2928158424
853 2928167364
854 2928177087
855 2928540349
856 2939577113
857 2981991890
858 3006971017
859 642414160
860 8018224598
861 8018851725
862 8020812184
863 8020942961
864 8020946652
865 8020959641
866 8021123949
867 8039100314
868 8040170704
869 8040176907
870 8055633765

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

172

0.97

PF00005

ABC_tran

ABC transporter

271

427

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8776 3 227
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8727 5 226
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8715 5 226
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.8671 1 226
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.8635 5 226
ID Description Score Start End Superfamily
af_Q6BEX0_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9722 3 244 3.40.50.300
af_P04983_256_497_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9698 259 494 3.40.50.300
af_P0AAG8_265_500_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 260 489 3.40.50.300
af_P0AAF3_266_503_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 266 496 3.40.50.300
af_P77509_259_498_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9582 251 491 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A378GUS1-F1-model_v4 deleted 0.9737 1 195
AF-A0A3M5GSI8-F1-model_v4 Ribose/galactose/methyl galactoside import ATP-binding protein (EC 7.5.2.11) 0.9724 1 200 GO:0005524
GO:0005886
GO:0016887
GO:0043211
AF-A0A351KD13-F1-model_v4 Ribose/galactose/methyl galactoside import ATP-binding protein (EC 7.5.2.11) 0.9721 309 494 GO:0005524
GO:0005886
GO:0016887
GO:0043211
AF-A0A703XM93-F1-model_v4 Ribose/galactose/methyl galactoside import ATP-binding protein (EC 7.5.2.11) 0.9705 384 494 GO:0005524
GO:0005886
GO:0016887
GO:0043211
AF-A0A355RWD2-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9692 3 229 GO:0005524
GO:0016887

Map