F443261

General Info

Members Datasets Scaffolds Average Seq Length
435 257 871 260

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100177995|Ga0068869_1001779952
Length 286
Sequence MKKKRKKYSAAMPPDFITCNYNRVMDLLLKDKVIIVTGGAKGIGEGIVKVLAKEGAIPVIVGRNREDNQKTATAVMADGGKTFEVVAELSDPKTCEQAVKEVIEQLGRIDGLVNNAGVNDGVGLENGNYQNFLASLHKNVIHYYLMAHFALPELKKSKGSIVNITSKTADTGQGGTSAYAASNGGRNAMTREWAVELLKYRIRVNAVSVAECYTPLYARWIESLPNPKEKLKEIESKIPLGNRMTTAEEIANMVAFLLSERSSHTTGQIIHVDGGYVHLDRALANA

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
134 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
194 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
195 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
196 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
207 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
210 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
211 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
212 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
215 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
218 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
219 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
222 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
223 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
226 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
227 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
228 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
229 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
230 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
231 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
246 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
247 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
248 2738541284 Pedobacter sp. YR016 Isolate Unclassified
249 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
250 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
251 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
252 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
253 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
254 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
255 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
256 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
257 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0.46
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0.69
Rhizoplane 0.92
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100177995 3300005334 Bacteria 1666
2 JGI24739J22299_10002789 3300001989 Bacteria 6712
3 JGI24737J22298_10003672 3300001990 Bacteria 5405
4 JGI24735J21928_10000324 3300002067 Bacteria 16589
5 JGI25162J39368_1004274 3300002737 Bacteria 3426
6 JGI25164J39214_1000814 3300002772 Bacteria 11009
7 JGI25165J46597_1000663 3300003214 Bacteria 27797
8 rootH1_10076361 3300003316 Bacteria 9005
9 rootH2_10094331 3300003320 Bacteria 1385
10 rootH2_10235801 3300003320 Bacteria 3036
11 rootL2_10040638 3300003322 Bacteria 11356
12 rootH1_10009528 3300003323 Bacteria 31356
13 rootH1_10022931 3300003323 Bacteria 51976
14 rootH1_10052755 3300003323 Bacteria 3579
15 rootH1_10062224 3300003316 Bacteria 2902
16 rootH1_10062224 3300003323 Bacteria 11182
17 rootH1_10105002 3300003323 Bacteria 3186
18 rootH1_10311811 3300003323 Unclassified 1619
19 rootH1_10379409 3300003323 Bacteria 1169
20 Ga0055536_1024067 3300003781 Bacteria 1774
21 Ga0058863_11101084 3300004799 Bacteria 948
22 Ga0065165_1000501 3300005262 Bacteria 60618
23 Ga0065714_10004250 3300005288 Bacteria 8027
24 Ga0065714_10009525 3300005288 Bacteria 4173
25 Ga0065714_10013800 3300005288 Bacteria 2604
26 Ga0065714_10079471 3300005288 Bacteria 2514
27 Ga0065714_10139919 3300005288 Bacteria 1180
28 Ga0065704_10000226 3300005289 Bacteria 67111
29 Ga0065704_10119969 3300005289 Bacteria 1791
30 Ga0065707_10090632 3300005295 Bacteria 4100
31 Ga0070658_10129286 3300005327 Bacteria 2104
32 Ga0070658_10441001 3300005327 Bacteria 1121
33 Ga0070676_10078696 3300005328 Bacteria 1995
34 Ga0070683_100017779 3300005329 Bacteria 6282
35 Ga0070683_100167866 3300005329 Unclassified 2083
36 Ga0070670_100078328 3300005331 Bacteria 2839
37 Ga0070670_100244878 3300005331 Bacteria 1561
38 Ga0068869_100038656 3300005334 Bacteria 3403
39 Ga0070666_10000375 3300005335 Bacteria 28142
40 Ga0070680_100015462 3300005336 Bacteria 5983
41 Ga0070680_100031279 3300005336 Bacteria 4279
42 Ga0070682_100000482 3300005337 Bacteria 25028
43 Ga0070682_100332961 3300005337 Bacteria 1126
44 Ga0068868_100131455 3300005338 Bacteria 2048
45 Ga0070660_100016725 3300005339 Bacteria 5332
46 Ga0070668_100002219 3300005347 Bacteria 14265
47 Ga0070669_100001299 3300005353 Bacteria 18039
48 Ga0070675_100004217 3300005354 Bacteria 10929
49 Ga0070671_100252694 3300005355 Bacteria 1497
50 Ga0070673_100102977 3300005364 Bacteria 2354
51 Ga0070688_100028086 3300005365 Bacteria 3355
52 Ga0070659_100001146 3300005366 Bacteria 19346
53 Ga0070659_100002774 3300005366 Bacteria 12470
54 Ga0070659_100337810 3300005366 Bacteria 1261
55 Ga0070667_100008498 3300005367 Bacteria 8512
56 Ga0070667_100224713 3300005367 Bacteria 1672
57 Ga0070700_100125275 3300005441 Bacteria 1726
58 Ga0070662_100012820 3300005457 Bacteria 5568
59 Ga0068867_100298589 3300005459 Bacteria 1327
60 Ga0070698_100336679 3300005471 Bacteria 1440
61 Ga0070679_100000549 3300005530 Bacteria 31843
62 Ga0070679_100005898 3300005530 Bacteria 11382
63 Ga0070679_100024113 3300005530 Bacteria 5961
64 Ga0070679_100069716 3300005530 Bacteria 3507
65 Ga0070679_100200938 3300005530 Unclassified 1959
66 Ga0070679_100594823 3300005530 Bacteria 1049
67 Ga0070679_100624425 3300005530 Bacteria 1021
68 Ga0070684_100019229 3300005535 Bacteria 5647
69 Ga0068853_100079978 3300005539 Bacteria 2859
70 Ga0068853_100181435 3300005539 Bacteria 1909
71 Ga0068853_100550687 3300005539 Bacteria 1093
72 Ga0070672_100109650 3300005543 Bacteria 2248
73 Ga0068855_100000019 3300005563 Bacteria 205963
74 Ga0068855_100000388 3300005563 Bacteria 54070
75 Ga0068855_100012783 3300005563 Bacteria 10126
76 Ga0068855_100013264 3300005563 Bacteria 9939
77 Ga0068855_100025873 3300005563 Bacteria 7018
78 Ga0068855_100027207 3300005563 Bacteria 6842
79 Ga0068855_100030245 3300005563 Bacteria 6478
80 Ga0068855_100444116 3300005563 Bacteria 1416
81 Ga0068857_100102605 3300005577 Bacteria 2568
82 Ga0068857_100669053 3300005577 Unclassified 985
83 Ga0068854_100008761 3300005578 Bacteria 6514
84 Ga0068854_100623402 3300005578 Bacteria 923
85 Ga0068856_100001034 3300005614 Bacteria 29577
86 Ga0068856_100075223 3300005614 Unclassified 3345
87 Ga0068856_100189912 3300005614 Bacteria 2068
88 Ga0068852_100025858 3300005616 Bacteria 4763
89 Ga0068852_100112751 3300005616 Bacteria 2475
90 Ga0068852_100615982 3300005616 Unclassified 1091
91 Ga0068859_100000086 3300005617 Bacteria 85696
92 Ga0068859_100039542 3300005617 Bacteria 4732
93 Ga0068864_100409164 3300005618 Bacteria 1290
94 Ga0068864_100740711 3300005618 Bacteria 963
95 Ga0068851_10025308 3300005834 Unclassified 2911
96 Ga0068870_10006552 3300005840 Bacteria 5137
97 Ga0068863_100013044 3300005841 Bacteria 8013
98 Ga0068863_100018526 3300005841 Bacteria 6663
99 Ga0068858_100002273 3300005842 Bacteria 19437
100 Ga0068858_100096352 3300005842 Bacteria 2757
101 Ga0068860_100002118 3300005843 Bacteria 20935
102 Ga0068860_100004278 3300005843 Bacteria 14603
103 Ga0081455_10118188 3300005937 Bacteria 2093
104 Ga0081539_10001743 3300005985 Bacteria 34704
105 Ga0075366_10002704 3300006195 Bacteria 9153
106 Ga0075366_10015888 3300006195 Bacteria 4320
107 Ga0075366_10077832 3300006195 Bacteria 1979
108 Ga0068871_100020799 3300006358 Bacteria 5033
109 Ga0068865_100627104 3300006881 Unclassified 911
110 Ga0097620_100000086 3300006931 Bacteria 85696
111 Ga0097620_100039542 3300006931 Bacteria 4732
112 Ga0099826_10059880 3300006948 Bacteria 2485
113 Ga0105240_10002660 3300009093 Bacteria 28423
114 Ga0105240_10063765 3300009093 Bacteria 4582
115 Ga0105240_10078201 3300009093 Bacteria 4074
116 Ga0105240_10172669 3300009093 Bacteria 2559
117 Ga0111539_10004188 3300009094 Bacteria 18932
118 Ga0111539_10022183 3300009094 Bacteria 7804
119 Ga0105245_10355338 3300009098 Bacteria 1453
120 Ga0105247_10002917 3300009101 Bacteria 11377
121 Ga0105243_10141359 3300009148 Bacteria 2054
122 Ga0105241_10000668 3300009174 Bacteria 25809
123 Ga0105241_10001385 3300009174 Bacteria 18527
124 Ga0105241_10015267 3300009174 Bacteria 5624
125 Ga0105241_10277378 3300009174 Bacteria 1430
126 Ga0105242_10376214 3300009176 Bacteria 1319
127 Ga0105237_10001001 3300009545 Bacteria 38035
128 Ga0105237_10001891 3300009545 Bacteria 26726
129 Ga0105237_10002720 3300009545 Bacteria 21581
130 Ga0105237_10011718 3300009545 Bacteria 9272
131 Ga0105237_10042255 3300009545 Bacteria 4598
132 Ga0105237_10144217 3300009545 Bacteria 2376
133 Ga0105237_10202771 3300009545 Bacteria 1984
134 Ga0105237_10202778 3300009545 Bacteria 1984
135 Ga0105237_10413352 3300009545 Bacteria 1354
136 Ga0105238_10011946 3300009551 Bacteria 8749
137 Ga0105238_10111589 3300009551 Bacteria 2714
138 Ga0105249_10003436 3300009553 Bacteria 13717
139 Ga0105239_10000004 3300010375 Bacteria 532483
140 Ga0105239_10000012 3300010375 Bacteria 332279
141 Ga0105239_10000249 3300010375 Bacteria 80515
142 Ga0105239_10000299 3300010375 Bacteria 73314
143 Ga0105239_10000976 3300010375 Bacteria 40167
144 Ga0105239_10002652 3300010375 Bacteria 22569
145 Ga0105239_10141943 3300010375 Bacteria 2677
146 Ga0105239_10154604 3300010375 Bacteria 2561
147 Ga0105239_10173365 3300010375 Unclassified 2413
148 Ga0157373_10000327 3300013100 Bacteria 38493
149 Ga0157373_10008374 3300013100 Bacteria 7681
150 Ga0157373_10050048 3300013100 Bacteria 2977
151 Ga0157373_10207440 3300013100 Bacteria 1381
152 Ga0157371_10023206 3300013102 Bacteria 4536
153 Ga0157371_10023855 3300013102 Unclassified 4471
154 Ga0157371_10028332 3300013102 Bacteria 4057
155 Ga0157371_10284657 3300013102 Unclassified 1195
156 Ga0157370_10000831 3300013104 Bacteria 39105
157 Ga0157370_10004819 3300013104 Bacteria 15338
158 Ga0157370_10085136 3300013104 Bacteria 2970
159 Ga0157370_10149180 3300013104 Unclassified 2176
160 Ga0157370_10283177 3300013104 Bacteria 1531
161 Ga0157370_10400819 3300013104 Bacteria 1263
162 Ga0157369_10010233 3300013105 Bacteria 10702
163 Ga0157369_10060549 3300013105 Bacteria 4082
164 Ga0157369_10508437 3300013105 Unclassified 1246
165 Ga0157374_10196854 3300013296 Unclassified 1972
166 Ga0157378_10017968 3300013297 Bacteria 6209
167 Ga0157378_10044100 3300013297 Bacteria 3960
168 Ga0163162_10003760 3300013306 Bacteria 14539
169 Ga0163162_10033338 3300013306 Bacteria 5117
170 Ga0157372_10000980 3300013307 Bacteria 31160
171 Ga0157372_10006396 3300013307 Bacteria 12533
172 Ga0157372_10006608 3300013307 Bacteria 12340
173 Ga0157372_10099048 3300013307 Bacteria 3325
174 Ga0157372_10112294 3300013307 Bacteria 3122
175 Ga0157372_10314118 3300013307 Bacteria 1824
176 Ga0157372_10444814 3300013307 Bacteria 1510
177 Ga0157372_10505936 3300013307 Unclassified 1408
178 Ga0157375_10021906 3300013308 Bacteria 5873
179 Ga0157375_10314087 3300013308 Bacteria 1731
180 Ga0163163_10651740 3300014325 Bacteria 1116
181 Ga0157380_10010487 3300014326 Bacteria 6666
182 Ga0157380_10162573 3300014326 Bacteria 1942
183 Ga0157380_10308635 3300014326 Unclassified 1461
184 Ga0182008_10000020 3300014497 Bacteria 228333
185 Ga0157377_10001601 3300014745 Bacteria 9848
186 Ga0157376_10044104 3300014969 Bacteria 3664
187 Ga0163161_10029273 3300017792 Bacteria 3915
188 Ga0206351_10242821 3300020077 Bacteria 4665
189 Ga0207427_100085 3300025231 Bacteria 142561
190 Ga0209437_100052 3300025233 Bacteria 380548
191 Ga0209437_100102 3300025233 Bacteria 224216
192 Ga0209233_1000067 3300025261 Bacteria 380554
193 Ga0209233_1009381 3300025261 Bacteria 2981
194 Ga0209455_1006064 3300025272 Bacteria 3632
195 Ga0209676_1001044 3300025292 Bacteria 31924
196 Ga0207656_10020596 3300025321 Unclassified 2624
197 Ga0207710_10117069 3300025900 Bacteria 1269
198 Ga0207680_10000117 3300025903 Bacteria 36819
199 Ga0207645_10008474 3300025907 Bacteria 7169
200 Ga0207645_10061460 3300025907 Bacteria 2399
201 Ga0207643_10042525 3300025908 Bacteria 2562
202 Ga0207705_10065283 3300025909 Bacteria 2631
203 Ga0207654_10000168 3300025911 Bacteria 41625
204 Ga0207654_10001156 3300025911 Bacteria 14193
205 Ga0207654_10040178 3300025911 Unclassified 2635
206 Ga0207707_10000117 3300025912 Bacteria 80929
207 Ga0207707_10088851 3300025912 Bacteria 2700
208 Ga0207695_10057507 3300025913 Bacteria 4039
209 Ga0207695_10371886 3300025913 Bacteria 1315
210 Ga0207671_10000905 3300025914 Bacteria 37474
211 Ga0207671_10001845 3300025914 Bacteria 23653
212 Ga0207671_10014324 3300025914 Bacteria 6274
213 Ga0207671_10021326 3300025914 Unclassified 4917
214 Ga0207671_10021367 3300025914 Bacteria 4911
215 Ga0207671_10058087 3300025914 Bacteria 2868
216 Ga0207660_10001028 3300025917 Bacteria 18473
217 Ga0207660_10032486 3300025917 Bacteria 3602
218 Ga0207660_10040992 3300025917 Bacteria 3243
219 Ga0207652_10000280 3300025921 Bacteria 53021
220 Ga0207652_10016686 3300025921 Bacteria 6001
221 Ga0207652_10039300 3300025921 Unclassified 4015
222 Ga0207652_10356930 3300025921 Unclassified 1319
223 Ga0207694_10071563 3300025924 Bacteria 2710
224 Ga0207694_10152248 3300025924 Bacteria 1864
225 Ga0207650_10045949 3300025925 Bacteria 3214
226 Ga0207650_10149109 3300025925 Bacteria 1844
227 Ga0207650_10183335 3300025925 Bacteria 1669
228 Ga0207659_10032248 3300025926 Bacteria 3593
229 Ga0207687_10272184 3300025927 Bacteria 1354
230 Ga0207644_10068500 3300025931 Bacteria 2589
231 Ga0207690_10000216 3300025932 Bacteria 43848
232 Ga0207690_10366231 3300025932 Bacteria 1143
233 Ga0207669_10314522 3300025937 Bacteria 1196
234 Ga0207691_10120168 3300025940 Bacteria 2329
235 Ga0207691_10402117 3300025940 Unclassified 1168
236 Ga0207689_10000260 3300025942 Bacteria 47416
237 Ga0207689_10018593 3300025942 Bacteria 5862
238 Ga0207661_10014978 3300025944 Bacteria 5694
239 Ga0207667_10000020 3300025949 Bacteria 374770
240 Ga0207667_10008655 3300025949 Bacteria 12069
241 Ga0207667_10020792 3300025949 Bacteria 7289
242 Ga0207667_10028694 3300025949 Bacteria 6042
243 Ga0207667_10044174 3300025949 Bacteria 4723
244 Ga0207667_10372558 3300025949 Bacteria 1455
245 Ga0207667_10423498 3300025949 Bacteria 1354
246 Ga0207651_10044937 3300025960 Bacteria 2960
247 Ga0207712_10113728 3300025961 Bacteria 2035
248 Ga0207668_10026622 3300025972 Bacteria 3757
249 Ga0207640_10005930 3300025981 Bacteria 6670
250 Ga0207658_10001959 3300025986 Bacteria 15364
251 Ga0207658_10356346 3300025986 Bacteria 1275
252 Ga0207677_10156040 3300026023 Bacteria 1767
253 Ga0207677_10237164 3300026023 Bacteria 1473
254 Ga0207703_10004860 3300026035 Bacteria 10936
255 Ga0207639_10313354 3300026041 Unclassified 1391
256 Ga0207639_10612097 3300026041 Bacteria 1005
257 Ga0207639_10616438 3300026041 Bacteria 1002
258 Ga0207708_10180962 3300026075 Bacteria 1674
259 Ga0207702_10000161 3300026078 Bacteria 79598
260 Ga0207641_10000061 3300026088 Bacteria 160161
261 Ga0207641_10081194 3300026088 Bacteria 2815
262 Ga0207648_10090916 3300026089 Bacteria 2668
263 Ga0207676_10666118 3300026095 Bacteria 1005
264 Ga0207674_10062977 3300026116 Bacteria 3745
265 Ga0207674_10083394 3300026116 Bacteria 3196
266 Ga0207674_10094772 3300026116 Unclassified 2971
267 Ga0207675_100000468 3300026118 Bacteria 39425
268 Ga0207698_10041111 3300026142 Bacteria 3442
269 Ga0207698_10088805 3300026142 Bacteria 2522
270 Ga0207698_10472968 3300026142 Bacteria 1214
271 Ga0209489_111689 3300027361 Bacteria 8728
272 Ga0209282_1209820 3300027666 Bacteria 890
273 Ga0268264_10001938 3300028381 Bacteria 18618
274 Ga0268264_10002707 3300028381 Bacteria 15465
275 Ga0307515_10000002 3300028794 Bacteria 1231751
276 Ga0307515_10000007 3300028794 Bacteria 719669
277 Ga0307515_10000667 3300028794 Bacteria 79135
278 Ga0307515_10001029 3300028794 Bacteria 63730
279 Ga0307515_10081240 3300028794 Bacteria 4213
280 Ga0265338_10241376 3300028800 Bacteria 1338
281 Ga0265338_10263803 3300028800 Bacteria 1265
282 Ga0265324_10049365 3300029957 Bacteria 1447
283 Ga0265327_10000488 3300031251 Bacteria 69809
284 Ga0265327_10066454 3300031251 Bacteria 1820
285 Ga0265327_10069666 3300031251 Bacteria 1765
286 Ga0265327_10112238 3300031251 Bacteria 1301
287 Ga0307509_10095704 3300031507 Bacteria 3024
288 Ga0307408_100000329 3300031548 Bacteria 45457
289 Ga0265313_10044902 3300031595 Bacteria 2154
290 Ga0307514_10026210 3300031649 Bacteria 4714
291 Ga0307406_10136118 3300031901 Bacteria 1731
292 Ga0307412_10000001 3300031911 Bacteria 822691
293 Ga0307412_10678387 3300031911 Bacteria 882
294 Ga0307416_100000066 3300032002 Bacteria 94549
295 Ga0307414_10003898 3300032004 Bacteria 8037
296 Ga0307414_10027173 3300032004 Bacteria 3694
297 Ga0307414_10141516 3300032004 Bacteria 1884
298 Ga0307414_10176763 3300032004 Bacteria 1713
299 Ga0307414_10181315 3300032004 Bacteria 1694
300 Ga0373924_0035378 3300035410 Bacteria 2026
301 Ga0373935_0185703 3300035692 Bacteria 1429
302 Ga0395899_0000001 3300037312 Bacteria 1750322
303 Ga0395899_0000182 3300037312 Bacteria 92470
304 Ga0395900_0586530 3300037418 Bacteria 1056
305 Ga0436365_1478753 3300039437 Unclassified 1981
306 Ga0451807_0262958 3300041486 Unclassified 887
307 Ga0439445_0010836 3300042004 Bacteria 2165
308 Ga0439445_0049394 3300042004 Bacteria 1133
309 Ga0439449_0014799 3300042007 Bacteria 2931
310 Ga0450898_003719 3300042134 Bacteria 2208
311 Ga0451577_0180708 3300042876 Bacteria 1902
312 Ga0451577_0189116 3300042876 Bacteria 1857
313 Ga0466961_0009336 3300044693 Bacteria 6248
314 Ga0466970_0044673 3300044765 Bacteria 2359
315 Ga0466960_0158363 3300044901 Bacteria 1214
316 Ga0466959_0011130 3300045049 Bacteria 6455
317 Ga0466958_0044661 3300045836 Bacteria 2671
318 Ga0495651_0176374 3300046462 Bacteria 1517
319 Ga0495650_0002914 3300046471 Bacteria 12995
320 Ga0495580_0329522 3300046472 Bacteria 1037
321 Ga0495585_0000091 3300046492 Bacteria 95620
322 Ga0495606_0003447 3300046507 Bacteria 16780
323 Ga0495606_0005837 3300046507 Bacteria 11609
324 Ga0495610_0000959 3300046512 Bacteria 26649
325 Ga0495616_0003738 3300046513 Bacteria 9708
326 Ga0495616_0004186 3300046513 Bacteria 9143
327 Ga0495632_0096051 3300046519 Bacteria 1400
328 Ga0495637_0076706 3300046520 Bacteria 1339
329 Ga0495648_0099288 3300046524 Bacteria 1611
330 Ga0495652_0338857 3300046529 Bacteria 1081
331 Ga0495633_0000006 3300046558 Bacteria 326774
332 Ga0495633_0004900 3300046558 Bacteria 8358
333 Ga0495668_0000918 3300046616 Bacteria 32911
334 Ga0495668_0154775 3300046616 Bacteria 1255
335 Ga0495625_0000059 3300046660 Bacteria 180330
336 Ga0495625_0002083 3300046660 Bacteria 22359
337 Ga0495625_0036200 3300046660 Bacteria 3630
338 Ga0495625_0066387 3300046660 Bacteria 2541
339 Ga0495625_0086825 3300046660 Unclassified 2170
340 Ga0495625_0184100 3300046660 Bacteria 1387
341 Ga0495635_0049691 3300046663 Bacteria 2891
342 Ga0495661_0000511 3300046665 Bacteria 40405
343 Ga0495657_0191170 3300046675 Bacteria 1251
344 Ga0495658_0002979 3300046683 Bacteria 8478
345 Ga0495671_0144986 3300046692 Bacteria 1156
346 Ga0495649_0001008 3300046694 Bacteria 22135
347 Ga0495589_0142276 3300046794 Bacteria 1148
348 Ga0495660_0020260 3300046810 Bacteria 3812
349 Ga0495676_0151436 3300047321 Bacteria 1650
350 Ga0495687_003426 3300047443 Bacteria 11505
351 Ga0495684_0070218 3300047471 Bacteria 2663
352 Ga0495686_0001059 3300047472 Bacteria 32862
353 Ga0495686_0026024 3300047472 Bacteria 3830
354 Ga0495686_0140579 3300047472 Bacteria 1425
355 Ga0495686_0206370 3300047472 Bacteria 1125
356 Ga0495614_0019603 3300048089 Bacteria 2927
357 Ga0496114_0478018 3300048917 Bacteria 1102
358 Ga0496115_0090369 3300048918 Bacteria 2502
359 Ga0495678_003800 3300049459 Bacteria 9110
360 Ga0501290_007613 3300049513 Bacteria 1359
361 Ga0501296_008386 3300049519 Bacteria 1197
362 Ga0501298_000487 3300049521 Bacteria 5356
363 Ga0501300_002270 3300049523 Bacteria 2876
364 Ga0501300_017145 3300049523 Bacteria 1057
365 Ga0501032_0005230 3300049569 Bacteria 9661
366 Ga0501034_0028044 3300049571 Bacteria 5726
367 Ga0501034_0064515 3300049571 Bacteria 3676
368 Ga0501036_0111632 3300049572 Bacteria 2310
369 Ga0501037_0113031 3300049573 Bacteria 1955
370 Ga0501038_0023587 3300049574 Bacteria 5498
371 Ga0501043_0024414 3300049579 Bacteria 4744
372 Ga0501043_0066386 3300049579 Bacteria 2833
373 Ga0501198_000671 3300049649 Bacteria 4262
374 Ga0501201_000292 3300049651 Bacteria 4554
375 Ga0501202_000022 3300049652 Bacteria 16472
376 Ga0501206_004994 3300049653 Bacteria 1704
377 Ga0501207_004358 3300049654 Bacteria 1920
378 Ga0501217_001283 3300049661 Bacteria 4664
379 Ga0501222_005096 3300049662 Bacteria 1778
380 Ga0501223_008431 3300049663 Bacteria 2101
381 Ga0501224_018034 3300049664 Bacteria 1051
382 Ga0501233_020250 3300049668 Bacteria 1418
383 Ga0501235_003884 3300049669 Bacteria 3231
384 Ga0501238_011693 3300049671 Bacteria 1182
385 Ga0501240_001027 3300049673 Bacteria 2580
386 Ga0501243_004826 3300049675 Bacteria 2024
387 Ga0501251_015843 3300049681 Bacteria 952
388 Ga0501252_019175 3300049682 Bacteria 881
389 Ga0501253_005186 3300049683 Bacteria 1693
390 Ga0501257_003705 3300049686 Bacteria 3300
391 Ga0501257_004825 3300049686 Bacteria 2952
392 Ga0501259_000349 3300049688 Bacteria 7232
393 Ga0501259_002575 3300049688 Bacteria 2925
394 Ga0501259_027308 3300049688 Bacteria 1056
395 Ga0501261_000251 3300049690 Bacteria 7363
396 Ga0501221_008138 3300049704 Bacteria 1816
397 Ga0501225_0012343 3300049705 Bacteria 2399
398 Ga0501234_000168 3300049707 Bacteria 8998
399 Ga0501245_001736 3300049708 Bacteria 2854
400 Ga0501232_001540 3300049757 Bacteria 1857
401 Ga0501241_012847 3300049758 Bacteria 1522
402 Ga0501268_024277 3300049765 Bacteria 1058
403 Ga0501279_008877 3300049775 Bacteria 1345
404 Ga0501280_008061 3300049776 Bacteria 1469
405 Ga0501035_0018034 3300049822 Bacteria 6505
406 Ga0501035_0118933 3300049822 Bacteria 2311
407 Ga0501044_0029038 3300049823 Bacteria 5833
408 Ga0501044_0070176 3300049823 Bacteria 3565
409 Ga0501212_005826 3300049851 Bacteria 1642
410 nmdc:mga0k408_105645_c1 3300050493 Bacteria 1663
411 nmdc:mga0k408_9670_c1 3300050493 Bacteria 5205
412 Ga0500578_0191869 3300053086 Bacteria 1254
413 Ga0500651_0000357 3300053093 Bacteria 25575
414 Ga0500556_0016763 3300053104 Bacteria 2284
415 Ga0500608_000365 3300053122 Bacteria 17523
416 Ga0500618_000010 3300053125 Bacteria 203909
417 Ga0500616_0000853 3300053153 Bacteria 33843
418 Ga0500616_0142589 3300053153 Bacteria 1118
419 Ga0500622_0000008 3300053156 Bacteria 423636
420 Ga0500622_0000417 3300053156 Bacteria 40427
421 Ga0500622_0001946 3300053156 Bacteria 15545
422 Ga0500611_000008 3300053727 Bacteria 198346
423 Ga0466962_0038765 3300061719 Bacteria 2282
424 2520880522 2519899754 Bacteria 5336938
425 2522552137 2522125168 Bacteria 7376607
426 2599482025 2599185184 Bacteria 6430550
427 2738763269 2738541284 Bacteria 5199923
428 2817414186 2816332280 Bacteria 5109718
429 2903895262 2903895155 Bacteria 5258610
430 2919190597 2919186247 Bacteria 6244071
431 2919443027 2919437846 Bacteria 6199444
432 2928082080 2928078545 Bacteria 6534839
433 2928153051 2928147474 Bacteria 6512076
434 2932087923 2932082852 Bacteria 6563563
435 2939669193 2939664404 Bacteria 6364494
436 2958459609 2958458903 Bacteria 5301041
437 Ga0068869_100177995
438 JGI24739J22299_10002789
439 JGI24737J22298_10003672
440 JGI24735J21928_10000324
441 JGI25162J39368_1004274
442 JGI25164J39214_1000814
443 JGI25165J46597_1000663
444 rootH1_10076361
445 rootH2_10094331
446 rootH2_10235801
447 rootL2_10040638
448 rootH1_10009528
449 rootH1_10022931
450 rootH1_10052755
451 rootH1_10062224
452 rootH1_10105002
453 rootH1_10311811
454 rootH1_10379409
455 Ga0055536_1024067
456 Ga0058863_11101084
457 Ga0065165_1000501
458 Ga0065714_10004250
459 Ga0065714_10009525
460 Ga0065714_10013800
461 Ga0065714_10079471
462 Ga0065714_10139919
463 Ga0065704_10000226
464 Ga0065704_10119969
465 Ga0065707_10090632
466 Ga0070658_10129286
467 Ga0070658_10441001
468 Ga0070676_10078696
469 Ga0070683_100017779
470 Ga0070683_100167866
471 Ga0070670_100078328
472 Ga0070670_100244878
473 Ga0068869_100038656
474 Ga0070666_10000375
475 Ga0070680_100015462
476 Ga0070680_100031279
477 Ga0070682_100000482
478 Ga0070682_100332961
479 Ga0068868_100131455
480 Ga0070660_100016725
481 Ga0070668_100002219
482 Ga0070669_100001299
483 Ga0070675_100004217
484 Ga0070671_100252694
485 Ga0070673_100102977
486 Ga0070688_100028086
487 Ga0070659_100001146
488 Ga0070659_100002774
489 Ga0070659_100337810
490 Ga0070667_100008498
491 Ga0070667_100224713
492 Ga0070700_100125275
493 Ga0070662_100012820
494 Ga0068867_100298589
495 Ga0070698_100336679
496 Ga0070679_100000549
497 Ga0070679_100005898
498 Ga0070679_100024113
499 Ga0070679_100069716
500 Ga0070679_100200938
501 Ga0070679_100594823
502 Ga0070679_100624425
503 Ga0070684_100019229
504 Ga0068853_100079978
505 Ga0068853_100181435
506 Ga0068853_100550687
507 Ga0070672_100109650
508 Ga0068855_100000019
509 Ga0068855_100000388
510 Ga0068855_100012783
511 Ga0068855_100013264
512 Ga0068855_100025873
513 Ga0068855_100027207
514 Ga0068855_100030245
515 Ga0068855_100444116
516 Ga0068857_100102605
517 Ga0068857_100669053
518 Ga0068854_100008761
519 Ga0068854_100623402
520 Ga0068856_100001034
521 Ga0068856_100075223
522 Ga0068856_100189912
523 Ga0068852_100025858
524 Ga0068852_100112751
525 Ga0068852_100615982
526 Ga0068859_100000086
527 Ga0068859_100039542
528 Ga0068864_100409164
529 Ga0068864_100740711
530 Ga0068851_10025308
531 Ga0068870_10006552
532 Ga0068863_100013044
533 Ga0068863_100018526
534 Ga0068858_100002273
535 Ga0068858_100096352
536 Ga0068860_100002118
537 Ga0068860_100004278
538 Ga0081455_10118188
539 Ga0081539_10001743
540 Ga0075366_10002704
541 Ga0075366_10015888
542 Ga0075366_10077832
543 Ga0068871_100020799
544 Ga0068865_100627104
545 Ga0097620_100000086
546 Ga0097620_100039542
547 Ga0099826_10059880
548 Ga0105240_10002660
549 Ga0105240_10063765
550 Ga0105240_10078201
551 Ga0105240_10172669
552 Ga0111539_10004188
553 Ga0111539_10022183
554 Ga0105245_10355338
555 Ga0105247_10002917
556 Ga0105243_10141359
557 Ga0105241_10000668
558 Ga0105241_10001385
559 Ga0105241_10015267
560 Ga0105241_10277378
561 Ga0105242_10376214
562 Ga0105237_10001001
563 Ga0105237_10001891
564 Ga0105237_10002720
565 Ga0105237_10011718
566 Ga0105237_10042255
567 Ga0105237_10144217
568 Ga0105237_10202771
569 Ga0105237_10202778
570 Ga0105237_10413352
571 Ga0105238_10011946
572 Ga0105238_10111589
573 Ga0105249_10003436
574 Ga0105239_10000004
575 Ga0105239_10000012
576 Ga0105239_10000249
577 Ga0105239_10000299
578 Ga0105239_10000976
579 Ga0105239_10002652
580 Ga0105239_10141943
581 Ga0105239_10154604
582 Ga0105239_10173365
583 Ga0157373_10000327
584 Ga0157373_10008374
585 Ga0157373_10050048
586 Ga0157373_10207440
587 Ga0157371_10023206
588 Ga0157371_10023855
589 Ga0157371_10028332
590 Ga0157371_10284657
591 Ga0157370_10000831
592 Ga0157370_10004819
593 Ga0157370_10085136
594 Ga0157370_10149180
595 Ga0157370_10283177
596 Ga0157370_10400819
597 Ga0157369_10010233
598 Ga0157369_10060549
599 Ga0157369_10508437
600 Ga0157374_10196854
601 Ga0157378_10017968
602 Ga0157378_10044100
603 Ga0163162_10003760
604 Ga0163162_10033338
605 Ga0157372_10000980
606 Ga0157372_10006396
607 Ga0157372_10006608
608 Ga0157372_10099048
609 Ga0157372_10112294
610 Ga0157372_10314118
611 Ga0157372_10444814
612 Ga0157372_10505936
613 Ga0157375_10021906
614 Ga0157375_10314087
615 Ga0163163_10651740
616 Ga0157380_10010487
617 Ga0157380_10162573
618 Ga0157380_10308635
619 Ga0182008_10000020
620 Ga0157377_10001601
621 Ga0157376_10044104
622 Ga0163161_10029273
623 Ga0206351_10242821
624 Ga0207427_100085
625 Ga0209437_100052
626 Ga0209437_100102
627 Ga0209233_1000067
628 Ga0209233_1009381
629 Ga0209455_1006064
630 Ga0209676_1001044
631 Ga0207656_10020596
632 Ga0207710_10117069
633 Ga0207680_10000117
634 Ga0207645_10008474
635 Ga0207645_10061460
636 Ga0207643_10042525
637 Ga0207705_10065283
638 Ga0207654_10000168
639 Ga0207654_10001156
640 Ga0207654_10040178
641 Ga0207707_10000117
642 Ga0207707_10088851
643 Ga0207695_10057507
644 Ga0207695_10371886
645 Ga0207671_10000905
646 Ga0207671_10001845
647 Ga0207671_10014324
648 Ga0207671_10021326
649 Ga0207671_10021367
650 Ga0207671_10058087
651 Ga0207660_10001028
652 Ga0207660_10032486
653 Ga0207660_10040992
654 Ga0207652_10000280
655 Ga0207652_10016686
656 Ga0207652_10039300
657 Ga0207652_10356930
658 Ga0207694_10071563
659 Ga0207694_10152248
660 Ga0207650_10045949
661 Ga0207650_10149109
662 Ga0207650_10183335
663 Ga0207659_10032248
664 Ga0207687_10272184
665 Ga0207644_10068500
666 Ga0207690_10000216
667 Ga0207690_10366231
668 Ga0207669_10314522
669 Ga0207691_10120168
670 Ga0207691_10402117
671 Ga0207689_10000260
672 Ga0207689_10018593
673 Ga0207661_10014978
674 Ga0207667_10000020
675 Ga0207667_10008655
676 Ga0207667_10020792
677 Ga0207667_10028694
678 Ga0207667_10044174
679 Ga0207667_10372558
680 Ga0207667_10423498
681 Ga0207651_10044937
682 Ga0207712_10113728
683 Ga0207668_10026622
684 Ga0207640_10005930
685 Ga0207658_10001959
686 Ga0207658_10356346
687 Ga0207677_10156040
688 Ga0207677_10237164
689 Ga0207703_10004860
690 Ga0207639_10313354
691 Ga0207639_10612097
692 Ga0207639_10616438
693 Ga0207708_10180962
694 Ga0207702_10000161
695 Ga0207641_10000061
696 Ga0207641_10081194
697 Ga0207648_10090916
698 Ga0207676_10666118
699 Ga0207674_10062977
700 Ga0207674_10083394
701 Ga0207674_10094772
702 Ga0207675_100000468
703 Ga0207698_10041111
704 Ga0207698_10088805
705 Ga0207698_10472968
706 Ga0209489_111689
707 Ga0209282_1209820
708 Ga0268264_10001938
709 Ga0268264_10002707
710 Ga0307515_10000002
711 Ga0307515_10000007
712 Ga0307515_10000667
713 Ga0307515_10001029
714 Ga0307515_10081240
715 Ga0265338_10241376
716 Ga0265338_10263803
717 Ga0265324_10049365
718 Ga0265327_10000488
719 Ga0265327_10066454
720 Ga0265327_10069666
721 Ga0265327_10112238
722 Ga0307509_10095704
723 Ga0307408_100000329
724 Ga0265313_10044902
725 Ga0307514_10026210
726 Ga0307406_10136118
727 Ga0307412_10000001
728 Ga0307412_10678387
729 Ga0307416_100000066
730 Ga0307414_10003898
731 Ga0307414_10027173
732 Ga0307414_10141516
733 Ga0307414_10176763
734 Ga0307414_10181315
735 Ga0373924_0035378
736 Ga0373935_0185703
737 Ga0395899_0000001
738 Ga0395899_0000182
739 Ga0395900_0586530
740 Ga0436365_1478753
741 Ga0451807_0262958
742 Ga0439445_0010836
743 Ga0439445_0049394
744 Ga0439449_0014799
745 Ga0450898_003719
746 Ga0451577_0180708
747 Ga0451577_0189116
748 Ga0466961_0009336
749 Ga0466970_0044673
750 Ga0466960_0158363
751 Ga0466959_0011130
752 Ga0466958_0044661
753 Ga0495651_0176374
754 Ga0495650_0002914
755 Ga0495580_0329522
756 Ga0495585_0000091
757 Ga0495606_0003447
758 Ga0495606_0005837
759 Ga0495610_0000959
760 Ga0495616_0003738
761 Ga0495616_0004186
762 Ga0495632_0096051
763 Ga0495637_0076706
764 Ga0495648_0099288
765 Ga0495652_0338857
766 Ga0495633_0000006
767 Ga0495633_0004900
768 Ga0495668_0000918
769 Ga0495668_0154775
770 Ga0495625_0000059
771 Ga0495625_0002083
772 Ga0495625_0036200
773 Ga0495625_0066387
774 Ga0495625_0086825
775 Ga0495625_0184100
776 Ga0495635_0049691
777 Ga0495661_0000511
778 Ga0495657_0191170
779 Ga0495658_0002979
780 Ga0495671_0144986
781 Ga0495649_0001008
782 Ga0495589_0142276
783 Ga0495660_0020260
784 Ga0495676_0151436
785 Ga0495687_003426
786 Ga0495684_0070218
787 Ga0495686_0001059
788 Ga0495686_0026024
789 Ga0495686_0140579
790 Ga0495686_0206370
791 Ga0495614_0019603
792 Ga0496114_0478018
793 Ga0496115_0090369
794 Ga0495678_003800
795 Ga0501290_007613
796 Ga0501296_008386
797 Ga0501298_000487
798 Ga0501300_002270
799 Ga0501300_017145
800 Ga0501032_0005230
801 Ga0501034_0028044
802 Ga0501034_0064515
803 Ga0501036_0111632
804 Ga0501037_0113031
805 Ga0501038_0023587
806 Ga0501043_0024414
807 Ga0501043_0066386
808 Ga0501198_000671
809 Ga0501201_000292
810 Ga0501202_000022
811 Ga0501206_004994
812 Ga0501207_004358
813 Ga0501217_001283
814 Ga0501222_005096
815 Ga0501223_008431
816 Ga0501224_018034
817 Ga0501233_020250
818 Ga0501235_003884
819 Ga0501238_011693
820 Ga0501240_001027
821 Ga0501243_004826
822 Ga0501251_015843
823 Ga0501252_019175
824 Ga0501253_005186
825 Ga0501257_003705
826 Ga0501257_004825
827 Ga0501259_000349
828 Ga0501259_002575
829 Ga0501259_027308
830 Ga0501261_000251
831 Ga0501221_008138
832 Ga0501225_0012343
833 Ga0501234_000168
834 Ga0501245_001736
835 Ga0501232_001540
836 Ga0501241_012847
837 Ga0501268_024277
838 Ga0501279_008877
839 Ga0501280_008061
840 Ga0501035_0018034
841 Ga0501035_0118933
842 Ga0501044_0029038
843 Ga0501044_0070176
844 Ga0501212_005826
845 nmdc:mga0k408_105645_c1
846 nmdc:mga0k408_9670_c1
847 Ga0500578_0191869
848 Ga0500651_0000357
849 Ga0500556_0016763
850 Ga0500608_000365
851 Ga0500618_000010
852 Ga0500616_0000853
853 Ga0500616_0142589
854 Ga0500622_0000008
855 Ga0500622_0000417
856 Ga0500622_0001946
857 Ga0500611_000008
858 Ga0466962_0038765
859 2520880522
860 2522552137
861 2599482025
862 2738763269
863 2817414186
864 2903895262
865 2919190597
866 2919443027
867 2928082080
868 2928153051
869 2932087923
870 2939669193
871 2958459609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

32

224

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

38

277

0.94

PF08659

KR

KR domain

33

210

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h0m-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase type 14 mutant k158a in complex with nicotinamide adenine dinucleotide 0.9617 5 251
2d1y-assembly1.cif.gz_C crystal structure of tt0321 from thermus thermophilus hb8 0.9611 5 251
2d1y-assembly1.cif.gz_A crystal structure of tt0321 from thermus thermophilus hb8 0.9592 5 251
2d1y-assembly1.cif.gz_D crystal structure of tt0321 from thermus thermophilus hb8 0.9586 5 251
3ai3-assembly1.cif.gz_G the crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with nadph and l-sorbose 0.958 1 251
ID Description Score Start End Superfamily
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9611 5 251 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 5 196 3.40.50.720
3ai1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9565 1 251 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 5 163 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 2 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3C1TIR6-F1-model_v4 Short chain dehydrogenase 0.9927 1 232
AF-A0A2V7WVV5-F1-model_v4 Short chain dehydrogenase 0.9919 1 224 GO:0016491
AF-A0A2W0ARM4-F1-model_v4 Short chain dehydrogenase 0.9889 1 248 GO:0016020
AF-A0A3C1TIR6-F1-model_v4 Short chain dehydrogenase 0.9842 1 232
AF-A0A2N2PXS5-F1-model_v4 Short-chain dehydrogenase 0.9799 4 250 GO:0016491

Map