F443281

General Info

Members Datasets Scaffolds Average Seq Length
435 270 413 207

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100278951|Ga0070699_1002789512
Length 235
Sequence MLLDWLTHQQTSLKVDQSTFASVKTGHLMSSISIIGTGNMARAIGALAVAGGNTVEILGRDQSKAADLARALGGSATTGEWGAVPAGDIVIVALLHASVVPVVAQYGDALAGKIIVDISNPFNSAADGLAHREDTSIAQEVAKAAPASASVVKAFNTIFGHVLEKGRPDVFIAGDNAQAKAAVEAFIESLGLRPLDVGGLKMAHWLEGTGLVVMGLARHGVGNWDFALGVTEFPG

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221647 Streptomyces sp. Root369 Isolate Unclassified
6 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
7 2687453737 Frankia sp. BMG5.36 Isolate Nodule
8 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
9 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
10 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
11 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
12 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
13 2862574272 Streptomyces sp. AcE210 Isolate Nodule
14 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
15 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
16 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
17 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
18 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
247 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
248 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
251 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
256 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
257 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
258 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
261 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
262 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
266 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
267 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
268 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
269 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
270 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 0.46
Isolates 5.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 1.38
Rhizoplane 9.2
Rhizosphere 69.43
Stem 0
Stem Tuber 0
Unclassified 13.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026212 3300001979 Bacteria 1955
2 JGI24739J22299_10002752 3300001989 Bacteria 6762
3 JGI24737J22298_10027289 3300001990 Bacteria 1801
4 JGI24738J21930_10028156 3300002075 Bacteria 1150
5 JGI25404J52841_10008005 3300003659 Bacteria 2243
6 Ga0070660_100185554 3300005339 Bacteria 1684
7 Ga0070660_100767776 3300005339 Bacteria 810
8 Ga0070661_100313339 3300005344 Bacteria 1224
9 Ga0070668_100043101 3300005347 Bacteria 3460
10 Ga0070668_100848581 3300005347 Bacteria 814
11 Ga0070671_100686136 3300005355 Bacteria 888
12 Ga0070674_100260982 3300005356 Bacteria 1365
13 Ga0070709_10073514 3300005434 Bacteria 2213
14 Ga0070709_10236973 3300005434 Bacteria 1308
15 Ga0070714_100019981 3300005435 Bacteria 5465
16 Ga0070714_100063694 3300005435 Bacteria 3171
17 Ga0070714_100232678 3300005435 Bacteria 1698
18 Ga0070713_100693880 3300005436 Bacteria 971
19 Ga0070710_10009462 3300005437 Bacteria 4768
20 Ga0070710_10034932 3300005437 Bacteria 2737
21 Ga0070710_10059811 3300005437 Bacteria 2165
22 Ga0070710_10138545 3300005437 Bacteria 1490
23 Ga0070710_10298695 3300005437 Bacteria 1050
24 Ga0070711_100577077 3300005439 Bacteria 936
25 Ga0070711_100702499 3300005439 Bacteria 851
26 Ga0070681_10025424 3300005458 Bacteria 5955
27 Ga0070706_100058870 3300005467 Bacteria 3545
28 Ga0070707_100312461 3300005468 Bacteria 1527
29 Ga0070699_100278951 3300005518 Bacteria 1497
30 Ga0070684_100563409 3300005535 Bacteria 1058
31 Ga0068853_100606702 3300005539 Bacteria 1040
32 Ga0070686_100512198 3300005544 Bacteria 933
33 Ga0070665_100179527 3300005548 Bacteria 2118
34 Ga0070665_100226228 3300005548 Bacteria 1871
35 Ga0068857_100235834 3300005577 Bacteria 1674
36 Ga0068858_100134485 3300005842 Bacteria 2319
37 Ga0081455_10031970 3300005937 Bacteria 4750
38 Ga0081540_1000074 3300005983 Bacteria 107172
39 Ga0070717_10079420 3300006028 Bacteria 2751
40 Ga0070717_10263741 3300006028 Bacteria 1524
41 Ga0075363_100033846 3300006048 Bacteria 2665
42 Ga0070716_100117234 3300006173 Bacteria 1661
43 Ga0068865_100469181 3300006881 Bacteria 1044
44 Ga0075436_100237839 3300006914 Bacteria 1295
45 Ga0111539_10304847 3300009094 Bacteria 1853
46 Ga0105245_10281137 3300009098 Bacteria 1626
47 Ga0105243_10630627 3300009148 Bacteria 1036
48 Ga0105238_10004346 3300009551 Bacteria 14059
49 Ga0105239_10227694 3300010375 Bacteria 2091
50 Ga0105246_10199613 3300011119 Bacteria 1554
51 Ga0157374_10974909 3300013296 Bacteria 867
52 Ga0157378_10100667 3300013297 Bacteria 2639
53 Ga0163162_10202597 3300013306 Bacteria 2113
54 Ga0157372_10120963 3300013307 Bacteria 3007
55 Ga0157375_10092289 3300013308 Bacteria 3091
56 Ga0206353_10371780 3300020082 Bacteria 1120
57 Ga0213875_10002715 3300021388 Bacteria 10449
58 Ga0213875_10090839 3300021388 Bacteria 1424
59 Ga0207426_1051589 3300025302 Bacteria 1221
60 Ga0207692_10062363 3300025898 Bacteria 1934
61 Ga0207692_10212726 3300025898 Bacteria 1142
62 Ga0207647_10033454 3300025904 Bacteria 3292
63 Ga0207699_10036172 3300025906 Bacteria 2813
64 Ga0207707_10123483 3300025912 Bacteria 2264
65 Ga0207693_10703070 3300025915 Bacteria 783
66 Ga0207663_10081704 3300025916 Bacteria 2117
67 Ga0207657_10324040 3300025919 Bacteria 1218
68 Ga0207646_10109074 3300025922 Bacteria 2484
69 Ga0207694_10010698 3300025924 Bacteria 6926
70 Ga0207694_10236965 3300025924 Bacteria 1491
71 Ga0207700_10413912 3300025928 Bacteria 1183
72 Ga0207664_10002394 3300025929 Bacteria 12407
73 Ga0207664_10117531 3300025929 Bacteria 2220
74 Ga0207664_10354965 3300025929 Bacteria 1298
75 Ga0207664_10361061 3300025929 Bacteria 1287
76 Ga0207644_10568835 3300025931 Bacteria 939
77 Ga0207665_10218684 3300025939 Bacteria 1395
78 Ga0207691_10080042 3300025940 Bacteria 2940
79 Ga0207661_10056757 3300025944 Bacteria 3145
80 Ga0207667_10264275 3300025949 Bacteria 1760
81 Ga0207668_10236138 3300025972 Bacteria 1476
82 Ga0207658_10206300 3300025986 Bacteria 1644
83 Ga0207658_10306574 3300025986 Bacteria 1370
84 Ga0207703_10364283 3300026035 Bacteria 1334
85 Ga0207708_10594796 3300026075 Bacteria 937
86 Ga0207641_10285903 3300026088 Bacteria 1553
87 Ga0207641_10726528 3300026088 Bacteria 979
88 Ga0207674_10544867 3300026116 Bacteria 1121
89 Ga0207428_10581877 3300027907 Bacteria 808
90 Ga0268264_10122807 3300028381 Bacteria 2291
91 Ga0265319_1017014 3300028563 Bacteria 2776
92 Ga0265336_10005155 3300028666 Bacteria 4856
93 Ga0307517_10113193 3300028786 Bacteria 2049
94 Ga0307515_10049581 3300028794 Bacteria 6311
95 Ga0265338_10017188 3300028800 Bacteria 7813
96 Ga0265338_10060601 3300028800 Bacteria 3323
97 Ga0265338_10107746 3300028800 Bacteria 2252
98 Ga0307511_10003090 3300030521 Bacteria 17155
99 Ga0307512_10040242 3300030522 Bacteria 3904
100 Ga0265325_10207353 3300031241 Bacteria 901
101 Ga0265339_10049880 3300031249 Bacteria 2290
102 Ga0265339_10095117 3300031249 Bacteria 1557
103 Ga0307513_10069471 3300031456 Bacteria 3686
104 Ga0307513_10180301 3300031456 Bacteria 1976
105 Ga0307509_10013229 3300031507 Bacteria 9791
106 Ga0307509_10093453 3300031507 Bacteria 3069
107 Ga0307508_10001782 3300031616 Bacteria 23942
108 Ga0307508_10009013 3300031616 Bacteria 9193
109 Ga0307514_10023311 3300031649 Bacteria 5022
110 Ga0307514_10208761 3300031649 Bacteria 1216
111 Ga0307514_10280492 3300031649 Bacteria 954
112 Ga0265342_10039802 3300031712 Bacteria 2854
113 Ga0307516_10053318 3300031730 Bacteria 3955
114 Ga0307516_10310089 3300031730 Bacteria 1251
115 Ga0307516_10332431 3300031730 Bacteria 1188
116 Ga0307518_10011034 3300031838 Bacteria 6457
117 Ga0307507_10001954 3300033179 Bacteria 44758
118 Ga0307507_10036156 3300033179 Bacteria 5055
119 Ga0307510_10232482 3300033180 Bacteria 1345
120 Ga0373926_0033563 3300035083 Bacteria 1814
121 Ga0373944_0190739 3300035089 Bacteria 738
122 Ga0373932_0084960 3300035112 Bacteria 1006
123 Ga0373936_0005116 3300035113 Bacteria 4936
124 Ga0373945_0118465 3300035116 Bacteria 1051
125 Ga0373953_0057503 3300035117 Bacteria 1584
126 Ga0373954_0017921 3300035118 Bacteria 3185
127 Ga0373957_0099825 3300035120 Bacteria 1161
128 Ga0373943_0014493 3300035170 Bacteria 3570
129 Ga0373924_0043622 3300035410 Bacteria 1842
130 Ga0373924_0159887 3300035410 Bacteria 988
131 Ga0373935_0032121 3300035692 Bacteria 3261
132 Ga0373927_0077352 3300035695 Bacteria 2155
133 Ga0373933_0042918 3300035724 Bacteria 2674
134 Ga0373933_0101478 3300035724 Bacteria 1785
135 Ga0373947_0276515 3300035725 Bacteria 1115
136 Ga0373937_0080216 3300036401 Bacteria 3017
137 Ga0373937_0091066 3300036401 Bacteria 2825
138 Ga0310109_010178 3300036534 Bacteria 1264
139 Ga0373925_0000101 3300037068 Bacteria 92997
140 Ga0373925_0016708 3300037068 Bacteria 5314
141 Ga0373925_0495939 3300037068 Bacteria 1002
142 Ga0395898_0454555 3300037466 Bacteria 1219
143 Ga0436364_0105595 3300037853 Bacteria 4764
144 Ga0436364_0291434 3300037853 Bacteria 947
145 Ga0436364_1078990 3300037853 Bacteria 1259
146 Ga0436364_1562947 3300037853 Bacteria 33891
147 Ga0395901_0228565 3300038443 Bacteria 1943
148 Ga0436363_1520515 3300039450 Bacteria 774
149 Ga0436362_0960067 3300039453 Bacteria 762
150 Ga0451807_2592432 3300041486 Bacteria 806
151 Ga0495592_0009428 3300046454 Bacteria 7339
152 Ga0495592_0013657 3300046454 Bacteria 6176
153 Ga0495590_0047031 3300046457 Bacteria 1505
154 Ga0495629_0011173 3300046459 Bacteria 6519
155 Ga0495629_0018578 3300046459 Bacteria 4972
156 Ga0495629_0038965 3300046459 Bacteria 3347
157 Ga0495638_0056845 3300046460 Bacteria 2428
158 Ga0495638_0122447 3300046460 Bacteria 1535
159 Ga0495638_0153456 3300046460 Bacteria 1334
160 Ga0495651_0001042 3300046462 Bacteria 21445
161 Ga0495651_0032955 3300046462 Bacteria 4040
162 Ga0495651_0161204 3300046462 Bacteria 1606
163 Ga0495651_0261828 3300046462 Bacteria 1176
164 Ga0495653_0018390 3300046463 Bacteria 5676
165 Ga0495653_0130267 3300046463 Bacteria 1782
166 Ga0495650_0025040 3300046471 Bacteria 2807
167 Ga0495580_0079072 3300046472 Bacteria 2293
168 Ga0495582_0038905 3300046473 Bacteria 2618
169 Ga0495662_0002474 3300046476 Bacteria 9305
170 Ga0495664_0000287 3300046477 Bacteria 24123
171 Ga0495664_0011602 3300046477 Bacteria 4970
172 Ga0495664_0015673 3300046477 Bacteria 4311
173 Ga0495584_0237868 3300046491 Bacteria 926
174 Ga0495585_0085531 3300046492 Bacteria 1704
175 Ga0495585_0088937 3300046492 Bacteria 1665
176 Ga0495585_0157404 3300046492 Bacteria 1181
177 Ga0495594_0066730 3300046499 Bacteria 1996
178 Ga0495583_0024147 3300046506 Bacteria 3061
179 Ga0495583_0044957 3300046506 Bacteria 2045
180 Ga0495606_0013133 3300046507 Bacteria 6574
181 Ga0495608_0006827 3300046511 Bacteria 8092
182 Ga0495608_0205873 3300046511 Bacteria 1238
183 Ga0495608_0226776 3300046511 Bacteria 1170
184 Ga0495610_0100705 3300046512 Bacteria 1295
185 Ga0495618_0039187 3300046514 Bacteria 2979
186 Ga0495618_0040374 3300046514 Bacteria 2937
187 Ga0495618_0085925 3300046514 Bacteria 2011
188 Ga0495620_0024378 3300046515 Bacteria 2877
189 Ga0495620_0180269 3300046515 Bacteria 817
190 Ga0495628_0078892 3300046516 Bacteria 2560
191 Ga0495628_0099134 3300046516 Bacteria 2250
192 Ga0495628_0118907 3300046516 Bacteria 2028
193 Ga0495630_0108027 3300046517 Bacteria 2107
194 Ga0495632_0212537 3300046519 Bacteria 877
195 Ga0495643_0006342 3300046522 Bacteria 7809
196 Ga0495648_0021550 3300046524 Bacteria 4459
197 Ga0495666_0007678 3300046526 Bacteria 5396
198 Ga0495666_0011577 3300046526 Bacteria 4397
199 Ga0495642_0130610 3300046528 Bacteria 1081
200 Ga0495652_0008645 3300046529 Bacteria 9279
201 Ga0495652_0104349 3300046529 Bacteria 2292
202 Ga0495652_0200263 3300046529 Bacteria 1516
203 Ga0495652_0339209 3300046529 Bacteria 1080
204 Ga0495652_0425595 3300046529 Bacteria 935
205 Ga0495665_0007483 3300046531 Bacteria 5909
206 Ga0495640_0039687 3300046533 Bacteria 3301
207 Ga0495586_0108428 3300046535 Bacteria 1544
208 Ga0495587_0061967 3300046536 Bacteria 2191
209 Ga0495645_0017306 3300046543 Bacteria 5162
210 Ga0495645_0127865 3300046543 Bacteria 1784
211 Ga0495667_0082116 3300046559 Bacteria 2094
212 Ga0495667_0102979 3300046559 Bacteria 1846
213 Ga0495667_0123332 3300046559 Bacteria 1672
214 Ga0495634_0001198 3300046642 Bacteria 23916
215 Ga0495634_0002799 3300046642 Bacteria 14330
216 Ga0495634_0015769 3300046642 Bacteria 5417
217 Ga0495634_0144291 3300046642 Bacteria 1509
218 Ga0495625_0159822 3300046660 Bacteria 1510
219 Ga0495635_0018136 3300046663 Bacteria 4914
220 Ga0495635_0028962 3300046663 Bacteria 3850
221 Ga0495635_0043084 3300046663 Bacteria 3115
222 Ga0495588_0079174 3300046674 Bacteria 1715
223 Ga0495657_0003480 3300046675 Bacteria 12840
224 Ga0495657_0024349 3300046675 Bacteria 4314
225 Ga0495657_0441560 3300046675 Bacteria 762
226 Ga0495599_0047225 3300046678 Bacteria 2698
227 Ga0495599_0052346 3300046678 Bacteria 2557
228 Ga0495623_0087437 3300046679 Bacteria 1920
229 Ga0495623_0097877 3300046679 Bacteria 1791
230 Ga0495646_0189527 3300046680 Bacteria 1124
231 Ga0495658_0164149 3300046683 Bacteria 1371
232 Ga0495613_0004110 3300046689 Bacteria 10885
233 Ga0495613_0021396 3300046689 Bacteria 4821
234 Ga0495613_0479149 3300046689 Bacteria 840
235 Ga0495624_0010785 3300046690 Bacteria 6298
236 Ga0495624_0131644 3300046690 Bacteria 1533
237 Ga0495671_0079334 3300046692 Bacteria 1609
238 Ga0495649_0070671 3300046694 Bacteria 1871
239 Ga0495589_0015740 3300046794 Bacteria 3888
240 Ga0495589_0059236 3300046794 Bacteria 1882
241 Ga0495600_0010883 3300046809 Bacteria 5658
242 Ga0495600_0273643 3300046809 Bacteria 1070
243 Ga0495581_0007085 3300047315 Bacteria 6492
244 Ga0495604_0000545 3300047317 Bacteria 33154
245 Ga0495604_0005331 3300047317 Bacteria 10194
246 Ga0495604_0362085 3300047317 Bacteria 961
247 Ga0495636_0001518 3300047318 Bacteria 8809
248 Ga0495636_0065503 3300047318 Bacteria 1543
249 Ga0495636_0156638 3300047318 Bacteria 1024
250 Ga0495674_0079786 3300047319 Bacteria 2809
251 Ga0495674_0143441 3300047319 Bacteria 2006
252 Ga0495676_0000488 3300047321 Bacteria 32524
253 Ga0495676_0000537 3300047321 Bacteria 31037
254 Ga0495676_0115771 3300047321 Bacteria 1959
255 Ga0495676_0244669 3300047321 Bacteria 1226
256 Ga0495676_0298214 3300047321 Bacteria 1087
257 Ga0495680_0032710 3300047322 Bacteria 4218
258 Ga0495680_0042923 3300047322 Bacteria 3584
259 Ga0495683_0092272 3300047323 Bacteria 1465
260 Ga0495687_002019 3300047443 Bacteria 17185
261 Ga0495687_011328 3300047443 Bacteria 4806
262 Ga0495687_015680 3300047443 Bacteria 3843
263 Ga0495687_073595 3300047443 Bacteria 1361
264 Ga0495679_014492 3300047446 Bacteria 2919
265 Ga0495685_002536 3300047447 Bacteria 5738
266 Ga0495685_054476 3300047447 Bacteria 1353
267 Ga0495681_0016827 3300047470 Bacteria 4080
268 Ga0495684_0046297 3300047471 Bacteria 3327
269 Ga0495684_0063413 3300047471 Bacteria 2809
270 Ga0495593_0000258 3300047673 Bacteria 28592
271 Ga0495593_0024057 3300047673 Bacteria 3379
272 Ga0495614_0001653 3300048089 Bacteria 9726
273 Ga0495614_0002843 3300048089 Bacteria 7703
274 Ga0496100_0015103 3300048903 Bacteria 4504
275 Ga0496101_0028521 3300048904 Bacteria 3897
276 Ga0496101_0490559 3300048904 Bacteria 970
277 Ga0496102_0000014 3300048905 Bacteria 310241
278 Ga0496102_0345243 3300048905 Bacteria 1401
279 Ga0496102_0678617 3300048905 Bacteria 953
280 Ga0496103_0000004 3300048906 Bacteria 510080
281 Ga0496103_0003660 3300048906 Bacteria 9358
282 Ga0496105_0525969 3300048908 Bacteria 926
283 Ga0496106_0005582 3300048909 Bacteria 9315
284 Ga0496107_0012225 3300048910 Bacteria 5989
285 Ga0496107_0019547 3300048910 Bacteria 4779
286 Ga0496108_0140686 3300048911 Bacteria 2079
287 Ga0496108_0477347 3300048911 Bacteria 1089
288 Ga0496109_0053072 3300048912 Bacteria 3696
289 Ga0496109_0169771 3300048912 Bacteria 2046
290 Ga0496109_0376243 3300048912 Bacteria 1341
291 Ga0496109_0626918 3300048912 Bacteria 1012
292 Ga0496109_0742715 3300048912 Bacteria 919
293 Ga0496109_0829574 3300048912 Bacteria 862
294 Ga0496110_0010392 3300048913 Bacteria 7567
295 Ga0496110_0030054 3300048913 Bacteria 4681
296 Ga0496110_0164153 3300048913 Bacteria 2014
297 Ga0496110_1065986 3300048913 Bacteria 716
298 Ga0496111_0020584 3300048914 Bacteria 4593
299 Ga0496111_0069152 3300048914 Bacteria 2567
300 Ga0496111_0461815 3300048914 Bacteria 936
301 Ga0496112_0032348 3300048915 Bacteria 5079
302 Ga0496112_0112890 3300048915 Bacteria 2688
303 Ga0496112_0158609 3300048915 Bacteria 2229
304 Ga0496112_1039865 3300048915 Bacteria 738
305 Ga0496112_1177681 3300048915 Bacteria 683
306 Ga0496113_0181722 3300048916 Bacteria 1667
307 Ga0496113_0639208 3300048916 Bacteria 851
308 Ga0496114_0014112 3300048917 Bacteria 6405
309 Ga0496114_0512349 3300048917 Bacteria 1061
310 Ga0496115_0093526 3300048918 Bacteria 2458
311 Ga0496115_0458175 3300048918 Bacteria 1029
312 Ga0496115_0484608 3300048918 Bacteria 995
313 Ga0496116_0000069 3300048919 Bacteria 252643
314 Ga0496117_0000003 3300048920 Bacteria 1881097
315 Ga0496117_0052280 3300048920 Bacteria 2879
316 Ga0496118_0000001 3300048921 Bacteria 1881100
317 Ga0496118_0108858 3300048921 Bacteria 1846
318 Ga0496119_0000267 3300048922 Bacteria 74039
319 Ga0496119_0017049 3300048922 Bacteria 5490
320 Ga0496119_0038081 3300048922 Bacteria 3113
321 Ga0496120_0004527 3300048923 Bacteria 11616
322 Ga0496121_0046983 3300048924 Bacteria 3688
323 Ga0496121_0131095 3300048924 Bacteria 1876
324 Ga0496122_0000305 3300048925 Bacteria 108235
325 Ga0496123_0000284 3300048926 Bacteria 99532
326 Ga0496125_0448088 3300048928 Bacteria 740
327 Ga0496126_0000006 3300048929 Bacteria 798804
328 Ga0496126_0000067 3300048929 Bacteria 249091
329 Ga0496126_0025895 3300048929 Bacteria 5634
330 Ga0496126_0111425 3300048929 Bacteria 2383
331 Ga0496126_0143568 3300048929 Bacteria 2052
332 Ga0496126_0158763 3300048929 Bacteria 1933
333 Ga0496126_0319966 3300048929 Bacteria 1275
334 Ga0501031_0166986 3300049568 Bacteria 1438
335 Ga0501032_0003786 3300049569 Bacteria 11478
336 Ga0501032_0070417 3300049569 Bacteria 2332
337 Ga0501032_0326565 3300049569 Bacteria 990
338 Ga0501033_0044526 3300049570 Bacteria 3304
339 Ga0501034_0005213 3300049571 Bacteria 14259
340 Ga0501034_0280850 3300049571 Bacteria 1604
341 Ga0501034_0386209 3300049571 Bacteria 1324
342 Ga0501034_0566212 3300049571 Bacteria 1044
343 Ga0501036_0011299 3300049572 Bacteria 7386
344 Ga0501036_0285331 3300049572 Bacteria 1381
345 Ga0501036_0541790 3300049572 Bacteria 967
346 Ga0501037_0056835 3300049573 Bacteria 2857
347 Ga0501037_0192066 3300049573 Bacteria 1445
348 Ga0501038_0024746 3300049574 Bacteria 5352
349 Ga0501038_0051420 3300049574 Bacteria 3555
350 Ga0501038_0103810 3300049574 Bacteria 2363
351 Ga0501038_0178966 3300049574 Bacteria 1712
352 Ga0501038_0209019 3300049574 Bacteria 1562
353 Ga0501039_0315799 3300049575 Bacteria 1228
354 Ga0501042_0001445 3300049578 Bacteria 13978
355 Ga0501043_0067766 3300049579 Bacteria 2802
356 Ga0501043_0139158 3300049579 Bacteria 1901
357 Ga0501043_0339698 3300049579 Bacteria 1142
358 Ga0501046_0058674 3300049580 Bacteria 3016
359 Ga0501047_0003526 3300049581 Bacteria 14766
360 Ga0501047_0004553 3300049581 Bacteria 13036
361 Ga0501047_0013474 3300049581 Bacteria 7749
362 Ga0501047_0285180 3300049581 Bacteria 1495
363 Ga0501048_0008014 3300049582 Bacteria 7997
364 Ga0501048_0031140 3300049582 Bacteria 3859
365 Ga0501069_0057041 3300049585 Bacteria 2177
366 Ga0501069_0238091 3300049585 Bacteria 1060
367 Ga0501070_0061016 3300049586 Bacteria 3125
368 Ga0501070_0387267 3300049586 Bacteria 1132
369 Ga0501073_0029923 3300049589 Bacteria 3889
370 Ga0501074_0033129 3300049590 Bacteria 3744
371 Ga0501035_0003898 3300049822 Bacteria 14232
372 Ga0501035_0057376 3300049822 Bacteria 3471
373 Ga0501044_0004950 3300049823 Bacteria 14901
374 Ga0501044_0006686 3300049823 Bacteria 12711
375 Ga0501044_0049494 3300049823 Bacteria 4338
376 Ga0501044_0477493 3300049823 Bacteria 1150
377 Ga0501044_0755236 3300049823 Bacteria 854
378 nmdc:mga03n38_215061_c1 3300050490 Bacteria 1001
379 nmdc:mga0yw44_692795_c1 3300050492 Bacteria 692
380 nmdc:mga04h51_214757_c1 3300050495 Bacteria 760
381 nmdc:mga08y16_332288_c1 3300050511 Bacteria 1563
382 nmdc:mga0n895_239858_c1 3300050512 Bacteria 1839
383 nmdc:mga0rr50_610934_c1 3300050513 Bacteria 930
384 Ga0495601_0000519 3300053077 Bacteria 20315
385 Ga0495601_0026027 3300053077 Bacteria 3610
386 Ga0495612_0142142 3300053078 Bacteria 1041
387 Ga0495612_0155160 3300053078 Bacteria 998
388 Ga0495595_0081765 3300053084 Bacteria 1540
389 Ga0500643_004136 3300053087 Bacteria 6664
390 Ga0500643_068085 3300053087 Bacteria 990
391 Ga0500646_0026907 3300053090 Bacteria 1562
392 Ga0500640_007318 3300053095 Bacteria 4286
393 Ga0500641_0039505 3300053096 Bacteria 1902
394 Ga0500553_030046 3300053101 Bacteria 2720
395 Ga0500569_012505 3300053109 Bacteria 2055
396 Ga0500618_036008 3300053125 Bacteria 1148
397 Ga0500628_004523 3300053129 Bacteria 2303
398 Ga0500652_000336 3300053131 Bacteria 16864
399 Ga0500652_017290 3300053131 Bacteria 2641
400 Ga0500561_0013747 3300053137 Bacteria 1761
401 Ga0500573_0186150 3300053140 Bacteria 1112
402 Ga0500579_048915 3300053143 Bacteria 2599
403 Ga0500600_0029597 3300053149 Bacteria 3230
404 Ga0500616_0035701 3300053153 Bacteria 2702
405 Ga0500627_0030192 3300053158 Bacteria 2267
406 Ga0500633_0020650 3300053160 Bacteria 1990
407 Ga0500633_0190278 3300053160 Bacteria 769
408 Ga0500634_0024326 3300053161 Bacteria 3293
409 Ga0500636_0154015 3300053177 Bacteria 1260
410 Ga0500645_000017 3300053730 Bacteria 146045
411 Ga0500645_017847 3300053730 Bacteria 2220
412 Ga0500656_000122 3300053732 Bacteria 4545
413 Ga0500587_002769 3300053739 Bacteria 2477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8001781756 8001786277 186
2 3300048922 Ga0496119_0017049 Ga0496119_0017049_4026_4769 187
3 3300049823 Ga0501044_0049494 Ga0501044_0049494_638_1261 189
4 3300048918 Ga0496115_0484608 Ga0496115_0484608_60_683 191
5 iso_pu_bacteria 2517572101 2517760076 193
6 3300005468 Ga0070707_100312461 Ga0070707_1003124611 194
7 3300025922 Ga0207646_10109074 Ga0207646_101090742 194
8 3300053730 Ga0500645_017847 Ga0500645_017847_258_878 194
9 3300046491 Ga0495584_0237868 Ga0495584_0237868_24_614 196
10 3300046492 Ga0495585_0088937 Ga0495585_0088937_505_1095 196
11 3300048903 Ga0496100_0015103 Ga0496100_0015103_2056_2646 196
12 3300048904 Ga0496101_0028521 Ga0496101_0028521_2139_2729 196
13 3300048905 Ga0496102_0345243 Ga0496102_0345243_667_1257 196
14 3300048906 Ga0496103_0003660 Ga0496103_0003660_145_735 196
15 3300048909 Ga0496106_0005582 Ga0496106_0005582_237_827 196
16 3300048910 Ga0496107_0012225 Ga0496107_0012225_904_1494 196
17 3300048911 Ga0496108_0477347 Ga0496108_0477347_17_607 196
18 3300048912 Ga0496109_0829574 Ga0496109_0829574_38_628 196
19 3300048913 Ga0496110_0010392 Ga0496110_0010392_3391_3981 196
20 3300048913 Ga0496110_0030054 Ga0496110_0030054_3416_4006 196
21 3300048914 Ga0496111_0020584 Ga0496111_0020584_258_848 196
22 3300048914 Ga0496111_0069152 Ga0496111_0069152_1958_2548 196
23 3300048917 Ga0496114_0014112 Ga0496114_0014112_173_763 196
24 3300048918 Ga0496115_0458175 Ga0496115_0458175_385_975 196
25 3300048928 Ga0496125_0448088 Ga0496125_0448088_52_642 196
26 3300031249 Ga0265339_10049880 Ga0265339_100498802 198
27 3300025302 Ga0207426_1051589 Ga0207426_10515892 199
28 iso_pu_bacteria 2558860280 2559432357 199
29 3300046514 Ga0495618_0085925 Ga0495618_0085925_621_1244 200
30 3300049571 Ga0501034_0280850 Ga0501034_0280850_253_960 200
31 3300041486 Ga0451807_2592432 Ga0451807_2592432_85_708 201
32 3300049568 Ga0501031_0166986 Ga0501031_0166986_360_1067 203
33 3300049569 Ga0501032_0070417 Ga0501032_0070417_522_1229 203
34 3300049572 Ga0501036_0285331 Ga0501036_0285331_36_743 203
35 3300049574 Ga0501038_0209019 Ga0501038_0209019_525_1232 203
36 3300049579 Ga0501043_0139158 Ga0501043_0139158_531_1238 203
37 3300049581 Ga0501047_0285180 Ga0501047_0285180_363_1070 203
38 3300049822 Ga0501035_0057376 Ga0501035_0057376_350_1057 203
39 iso_pu_bacteria 2582581314 2585315204 203
40 iso_pu_bacteria 2616644814 2616701630 203
41 iso_pu_bacteria 2643221647 2644262428 203
42 iso_pu_bacteria 2675902999 2676204081 203
43 iso_pu_bacteria 2687453737 2689963723 203
44 iso_pu_bacteria 2687453743 2689992797 203
45 iso_pu_bacteria 2758568621 2760624489 203
46 iso_pu_bacteria 2773857921 2774848657 203
47 iso_pu_bacteria 2816332139 2816507449 203
48 iso_pu_bacteria 2858895516 2858901502 203
49 iso_pu_bacteria 2862574272 2862582215 203
50 iso_pu_bacteria 2870721527 2870725418 203
51 iso_pu_bacteria 2880489317 2880491126 203
52 iso_pu_bacteria 2945941187 2945945105 203
53 iso_pu_bacteria 2954691527 2954694692 203
54 iso_pu_bacteria 2954701450 2954709895 203
55 iso_pu_bacteria 8047710418 8047717868 203
56 iso_pu_bacteria 8048127548 8048136041 203
57 iso_pu_bacteria 8055066027 8055068610 203
58 3300037068 Ga0373925_0016708 Ga0373925_0016708_2131_2751 205
59 3300005339 Ga0070660_100767776 Ga0070660_1007677761 206
60 3300005344 Ga0070661_100313339 Ga0070661_1003133391 206
61 3300005355 Ga0070671_100686136 Ga0070671_1006861362 206
62 3300005356 Ga0070674_100260982 Ga0070674_1002609822 206
63 3300005535 Ga0070684_100563409 Ga0070684_1005634091 206
64 3300005544 Ga0070686_100512198 Ga0070686_1005121981 206
65 3300005548 Ga0070665_100226228 Ga0070665_1002262284 206
66 3300006048 Ga0075363_100033846 Ga0075363_1000338462 206
67 3300006881 Ga0068865_100469181 Ga0068865_1004691812 206
68 3300006914 Ga0075436_100237839 Ga0075436_1002378393 206
69 3300010375 Ga0105239_10227694 Ga0105239_102276942 206
70 3300011119 Ga0105246_10199613 Ga0105246_101996133 206
71 3300013296 Ga0157374_10974909 Ga0157374_109749092 206
72 3300013308 Ga0157375_10092289 Ga0157375_100922892 206
73 3300025919 Ga0207657_10324040 Ga0207657_103240402 206
74 3300025924 Ga0207694_10236965 Ga0207694_102369653 206
75 3300025931 Ga0207644_10568835 Ga0207644_105688351 206
76 3300026075 Ga0207708_10594796 Ga0207708_105947962 206
77 3300036534 Ga0310109_010178 Ga0310109_010178_58_678 206
78 3300046460 Ga0495638_0056845 Ga0495638_0056845_1646_2269 206
79 3300046515 Ga0495620_0180269 Ga0495620_0180269_57_680 206
80 3300048904 Ga0496101_0490559 Ga0496101_0490559_324_947 206
81 3300048905 Ga0496102_0000014 Ga0496102_0000014_76661_77284 206
82 3300048906 Ga0496103_0000004 Ga0496103_0000004_77167_77790 206
83 3300048910 Ga0496107_0019547 Ga0496107_0019547_1364_1987 206
84 3300048912 Ga0496109_0053072 Ga0496109_0053072_2400_3074 206
85 3300048912 Ga0496109_0169771 Ga0496109_0169771_734_1357 206
86 3300048913 Ga0496110_0164153 Ga0496110_0164153_628_1302 206
87 3300048915 Ga0496112_0032348 Ga0496112_0032348_1558_2232 206
88 3300048915 Ga0496112_1039865 Ga0496112_1039865_43_666 206
89 3300048917 Ga0496114_0512349 Ga0496114_0512349_95_718 206
90 3300048919 Ga0496116_0000069 Ga0496116_0000069_78118_78741 206
91 3300048920 Ga0496117_0000003 Ga0496117_0000003_1275570_1276193 206
92 3300048921 Ga0496118_0000001 Ga0496118_0000001_1275573_1276196 206
93 3300048929 Ga0496126_0000067 Ga0496126_0000067_235222_235845 206
94 3300048929 Ga0496126_0111425 Ga0496126_0111425_1198_1821 206
95 3300050490 nmdc:mga03n38_215061_c1 nmdc:mga03n38_215061_c1_280_954 206
96 3300050492 nmdc:mga0yw44_692795_c1 nmdc:mga0yw44_692795_c1_34_657 206
97 3300050495 nmdc:mga04h51_214757_c1 nmdc:mga04h51_214757_c1_79_702 206
98 3300053087 Ga0500643_004136 Ga0500643_004136_1832_2455 206
99 3300053087 Ga0500643_068085 Ga0500643_068085_58_681 206
100 3300053131 Ga0500652_000336 Ga0500652_000336_2046_2669 206
101 3300053158 Ga0500627_0030192 Ga0500627_0030192_105_728 206
102 3300053730 Ga0500645_000017 Ga0500645_000017_49037_49660 206
103 3300001979 JGI24740J21852_10026212 JGI24740J21852_100262123 207
104 3300001989 JGI24739J22299_10002752 JGI24739J22299_100027523 207
105 3300001990 JGI24737J22298_10027289 JGI24737J22298_100272892 207
106 3300002075 JGI24738J21930_10028156 JGI24738J21930_100281562 207
107 3300003659 JGI25404J52841_10008005 JGI25404J52841_100080053 207
108 3300005339 Ga0070660_100185554 Ga0070660_1001855543 207
109 3300005347 Ga0070668_100043101 Ga0070668_1000431014 207
110 3300005347 Ga0070668_100848581 Ga0070668_1008485811 207
111 3300005434 Ga0070709_10073514 Ga0070709_100735144 207
112 3300005434 Ga0070709_10236973 Ga0070709_102369731 207
113 3300005435 Ga0070714_100019981 Ga0070714_1000199817 207
114 3300005435 Ga0070714_100063694 Ga0070714_1000636943 207
115 3300005435 Ga0070714_100232678 Ga0070714_1002326782 207
116 3300005436 Ga0070713_100693880 Ga0070713_1006938802 207
117 3300005437 Ga0070710_10009462 Ga0070710_100094621 207
118 3300005437 Ga0070710_10034932 Ga0070710_100349323 207
119 3300005437 Ga0070710_10059811 Ga0070710_100598113 207
120 3300005437 Ga0070710_10138545 Ga0070710_101385451 207
121 3300005437 Ga0070710_10298695 Ga0070710_102986951 207
122 3300005439 Ga0070711_100577077 Ga0070711_1005770771 207
123 3300005439 Ga0070711_100702499 Ga0070711_1007024991 207
124 3300005458 Ga0070681_10025424 Ga0070681_100254246 207
125 3300005467 Ga0070706_100058870 Ga0070706_1000588704 207
126 3300005518 Ga0070699_100278951 Ga0070699_1002789512 207
127 3300005539 Ga0068853_100606702 Ga0068853_1006067021 207
128 3300005548 Ga0070665_100179527 Ga0070665_1001795272 207
129 3300005577 Ga0068857_100235834 Ga0068857_1002358342 207
130 3300005842 Ga0068858_100134485 Ga0068858_1001344852 207
131 3300005937 Ga0081455_10031970 Ga0081455_100319702 207
132 3300005983 Ga0081540_1000074 Ga0081540_1000074102 207
133 3300006028 Ga0070717_10079420 Ga0070717_100794204 207
134 3300006028 Ga0070717_10263741 Ga0070717_102637413 207
135 3300006173 Ga0070716_100117234 Ga0070716_1001172342 207
136 3300009094 Ga0111539_10304847 Ga0111539_103048472 207
137 3300009098 Ga0105245_10281137 Ga0105245_102811372 207
138 3300009148 Ga0105243_10630627 Ga0105243_106306272 207
139 3300009551 Ga0105238_10004346 Ga0105238_100043463 207
140 3300013297 Ga0157378_10100667 Ga0157378_101006672 207
141 3300013306 Ga0163162_10202597 Ga0163162_102025972 207
142 3300013307 Ga0157372_10120963 Ga0157372_101209632 207
143 3300020082 Ga0206353_10371780 Ga0206353_103717802 207
144 3300021388 Ga0213875_10002715 Ga0213875_100027157 207
145 3300021388 Ga0213875_10090839 Ga0213875_100908392 207
146 3300025898 Ga0207692_10062363 Ga0207692_100623632 207
147 3300025898 Ga0207692_10212726 Ga0207692_102127261 207
148 3300025904 Ga0207647_10033454 Ga0207647_100334543 207
149 3300025906 Ga0207699_10036172 Ga0207699_100361722 207
150 3300025912 Ga0207707_10123483 Ga0207707_101234832 207
151 3300025915 Ga0207693_10703070 Ga0207693_107030701 207
152 3300025916 Ga0207663_10081704 Ga0207663_100817043 207
153 3300025924 Ga0207694_10010698 Ga0207694_100106986 207
154 3300025928 Ga0207700_10413912 Ga0207700_104139121 207
155 3300025929 Ga0207664_10002394 Ga0207664_100023948 207
156 3300025929 Ga0207664_10117531 Ga0207664_101175312 207
157 3300025929 Ga0207664_10354965 Ga0207664_103549652 207
158 3300025929 Ga0207664_10361061 Ga0207664_103610612 207
159 3300025939 Ga0207665_10218684 Ga0207665_102186842 207
160 3300025940 Ga0207691_10080042 Ga0207691_100800423 207
161 3300025944 Ga0207661_10056757 Ga0207661_100567574 207
162 3300025949 Ga0207667_10264275 Ga0207667_102642753 207
163 3300025972 Ga0207668_10236138 Ga0207668_102361381 207
164 3300025986 Ga0207658_10206300 Ga0207658_102063002 207
165 3300025986 Ga0207658_10306574 Ga0207658_103065741 207
166 3300026035 Ga0207703_10364283 Ga0207703_103642832 207
167 3300026088 Ga0207641_10285903 Ga0207641_102859032 207
168 3300026088 Ga0207641_10726528 Ga0207641_107265281 207
169 3300026116 Ga0207674_10544867 Ga0207674_105448672 207
170 3300027907 Ga0207428_10581877 Ga0207428_105818771 207
171 3300028381 Ga0268264_10122807 Ga0268264_101228072 207
172 3300028563 Ga0265319_1017014 Ga0265319_10170145 207
173 3300028666 Ga0265336_10005155 Ga0265336_100051551 207
174 3300028786 Ga0307517_10113193 Ga0307517_101131932 207
175 3300028794 Ga0307515_10049581 Ga0307515_100495816 207
176 3300028800 Ga0265338_10017188 Ga0265338_100171887 207
177 3300028800 Ga0265338_10060601 Ga0265338_100606012 207
178 3300028800 Ga0265338_10107746 Ga0265338_101077463 207
179 3300030521 Ga0307511_10003090 Ga0307511_1000309011 207
180 3300030522 Ga0307512_10040242 Ga0307512_100402424 207
181 3300031241 Ga0265325_10207353 Ga0265325_102073531 207
182 3300031249 Ga0265339_10095117 Ga0265339_100951171 207
183 3300031456 Ga0307513_10069471 Ga0307513_100694713 207
184 3300031456 Ga0307513_10180301 Ga0307513_101803012 207
185 3300031507 Ga0307509_10013229 Ga0307509_100132292 207
186 3300031507 Ga0307509_10093453 Ga0307509_100934533 207
187 3300031616 Ga0307508_10001782 Ga0307508_100017823 207
188 3300031616 Ga0307508_10009013 Ga0307508_100090139 207
189 3300031649 Ga0307514_10023311 Ga0307514_100233115 207
190 3300031649 Ga0307514_10208761 Ga0307514_102087611 207
191 3300031649 Ga0307514_10280492 Ga0307514_102804921 207
192 3300031712 Ga0265342_10039802 Ga0265342_100398023 207
193 3300031730 Ga0307516_10053318 Ga0307516_100533184 207
194 3300031730 Ga0307516_10310089 Ga0307516_103100893 207
195 3300031730 Ga0307516_10332431 Ga0307516_103324312 207
196 3300031838 Ga0307518_10011034 Ga0307518_100110342 207
197 3300033179 Ga0307507_10001954 Ga0307507_1000195422 207
198 3300033179 Ga0307507_10036156 Ga0307507_100361561 207
199 3300033180 Ga0307510_10232482 Ga0307510_102324822 207
200 3300035083 Ga0373926_0033563 Ga0373926_0033563_332_955 207
201 3300035089 Ga0373944_0190739 Ga0373944_0190739_72_695 207
202 3300035112 Ga0373932_0084960 Ga0373932_0084960_62_685 207
203 3300035113 Ga0373936_0005116 Ga0373936_0005116_3183_3806 207
204 3300035116 Ga0373945_0118465 Ga0373945_0118465_142_852 207
205 3300035117 Ga0373953_0057503 Ga0373953_0057503_478_1101 207
206 3300035118 Ga0373954_0017921 Ga0373954_0017921_1016_1639 207
207 3300035120 Ga0373957_0099825 Ga0373957_0099825_521_1144 207
208 3300035170 Ga0373943_0014493 Ga0373943_0014493_43_753 207
209 3300035410 Ga0373924_0043622 Ga0373924_0043622_353_976 207
210 3300035410 Ga0373924_0159887 Ga0373924_0159887_281_904 207
211 3300035692 Ga0373935_0032121 Ga0373935_0032121_861_1571 207
212 3300035695 Ga0373927_0077352 Ga0373927_0077352_1136_1759 207
213 3300035724 Ga0373933_0042918 Ga0373933_0042918_1246_1869 207
214 3300035724 Ga0373933_0101478 Ga0373933_0101478_865_1488 207
215 3300035725 Ga0373947_0276515 Ga0373947_0276515_295_918 207
216 3300036401 Ga0373937_0080216 Ga0373937_0080216_147_770 207
217 3300036401 Ga0373937_0091066 Ga0373937_0091066_10_633 207
218 3300037068 Ga0373925_0000101 Ga0373925_0000101_3324_3950 207
219 3300037068 Ga0373925_0495939 Ga0373925_0495939_301_924 207
220 3300037466 Ga0395898_0454555 Ga0395898_0454555_222_845 207
221 3300037853 Ga0436364_0105595 Ga0436364_0105595_869_1492 207
222 3300037853 Ga0436364_0291434 Ga0436364_0291434_157_801 207
223 3300037853 Ga0436364_1078990 Ga0436364_1078990_190_813 207
224 3300037853 Ga0436364_1562947 Ga0436364_1562947_26668_27294 207
225 3300038443 Ga0395901_0228565 Ga0395901_0228565_776_1399 207
226 3300039450 Ga0436363_1520515 Ga0436363_1520515_89_712 207
227 3300039453 Ga0436362_0960067 Ga0436362_0960067_35_679 207
228 3300046454 Ga0495592_0009428 Ga0495592_0009428_3950_4573 207
229 3300046454 Ga0495592_0013657 Ga0495592_0013657_5516_6139 207
230 3300046457 Ga0495590_0047031 Ga0495590_0047031_128_751 207
231 3300046459 Ga0495629_0011173 Ga0495629_0011173_3146_3769 207
232 3300046459 Ga0495629_0018578 Ga0495629_0018578_1140_1763 207
233 3300046459 Ga0495629_0038965 Ga0495629_0038965_237_860 207
234 3300046460 Ga0495638_0122447 Ga0495638_0122447_801_1424 207
235 3300046460 Ga0495638_0153456 Ga0495638_0153456_368_991 207
236 3300046462 Ga0495651_0001042 Ga0495651_0001042_15758_16381 207
237 3300046462 Ga0495651_0032955 Ga0495651_0032955_2029_2652 207
238 3300046462 Ga0495651_0161204 Ga0495651_0161204_829_1452 207
239 3300046462 Ga0495651_0261828 Ga0495651_0261828_459_1103 207
240 3300046463 Ga0495653_0018390 Ga0495653_0018390_4707_5330 207
241 3300046463 Ga0495653_0130267 Ga0495653_0130267_1092_1715 207
242 3300046471 Ga0495650_0025040 Ga0495650_0025040_2100_2723 207
243 3300046472 Ga0495580_0079072 Ga0495580_0079072_1559_2182 207
244 3300046473 Ga0495582_0038905 Ga0495582_0038905_1023_1646 207
245 3300046476 Ga0495662_0002474 Ga0495662_0002474_8285_8908 207
246 3300046477 Ga0495664_0000287 Ga0495664_0000287_15814_16437 207
247 3300046477 Ga0495664_0011602 Ga0495664_0011602_3164_3787 207
248 3300046477 Ga0495664_0015673 Ga0495664_0015673_2337_2960 207
249 3300046492 Ga0495585_0085531 Ga0495585_0085531_395_1018 207
250 3300046492 Ga0495585_0157404 Ga0495585_0157404_13_636 207
251 3300046499 Ga0495594_0066730 Ga0495594_0066730_521_1144 207
252 3300046506 Ga0495583_0024147 Ga0495583_0024147_997_1620 207
253 3300046506 Ga0495583_0044957 Ga0495583_0044957_394_1029 207
254 3300046507 Ga0495606_0013133 Ga0495606_0013133_4685_5311 207
255 3300046511 Ga0495608_0006827 Ga0495608_0006827_587_1210 207
256 3300046511 Ga0495608_0205873 Ga0495608_0205873_244_867 207
257 3300046511 Ga0495608_0226776 Ga0495608_0226776_344_967 207
258 3300046512 Ga0495610_0100705 Ga0495610_0100705_246_869 207
259 3300046514 Ga0495618_0039187 Ga0495618_0039187_2154_2777 207
260 3300046514 Ga0495618_0040374 Ga0495618_0040374_1192_1815 207
261 3300046515 Ga0495620_0024378 Ga0495620_0024378_747_1370 207
262 3300046516 Ga0495628_0078892 Ga0495628_0078892_1524_2159 207
263 3300046516 Ga0495628_0099134 Ga0495628_0099134_1003_1626 207
264 3300046516 Ga0495628_0118907 Ga0495628_0118907_499_1122 207
265 3300046517 Ga0495630_0108027 Ga0495630_0108027_1138_1761 207
266 3300046519 Ga0495632_0212537 Ga0495632_0212537_208_831 207
267 3300046522 Ga0495643_0006342 Ga0495643_0006342_929_1552 207
268 3300046524 Ga0495648_0021550 Ga0495648_0021550_2870_3493 207
269 3300046526 Ga0495666_0007678 Ga0495666_0007678_3302_3925 207
270 3300046526 Ga0495666_0011577 Ga0495666_0011577_654_1277 207
271 3300046528 Ga0495642_0130610 Ga0495642_0130610_26_649 207
272 3300046529 Ga0495652_0008645 Ga0495652_0008645_2397_3020 207
273 3300046529 Ga0495652_0104349 Ga0495652_0104349_1138_1761 207
274 3300046529 Ga0495652_0200263 Ga0495652_0200263_535_1179 207
275 3300046529 Ga0495652_0339209 Ga0495652_0339209_295_918 207
276 3300046529 Ga0495652_0425595 Ga0495652_0425595_101_736 207
277 3300046531 Ga0495665_0007483 Ga0495665_0007483_4437_5060 207
278 3300046533 Ga0495640_0039687 Ga0495640_0039687_1185_1808 207
279 3300046535 Ga0495586_0108428 Ga0495586_0108428_910_1533 207
280 3300046536 Ga0495587_0061967 Ga0495587_0061967_961_1584 207
281 3300046543 Ga0495645_0017306 Ga0495645_0017306_2068_2691 207
282 3300046543 Ga0495645_0127865 Ga0495645_0127865_860_1483 207
283 3300046559 Ga0495667_0082116 Ga0495667_0082116_1063_1686 207
284 3300046559 Ga0495667_0102979 Ga0495667_0102979_248_871 207
285 3300046559 Ga0495667_0123332 Ga0495667_0123332_244_867 207
286 3300046642 Ga0495634_0001198 Ga0495634_0001198_441_1064 207
287 3300046642 Ga0495634_0002799 Ga0495634_0002799_2734_3357 207
288 3300046642 Ga0495634_0015769 Ga0495634_0015769_2532_3155 207
289 3300046642 Ga0495634_0144291 Ga0495634_0144291_35_658 207
290 3300046660 Ga0495625_0159822 Ga0495625_0159822_203_826 207
291 3300046663 Ga0495635_0018136 Ga0495635_0018136_1266_1889 207
292 3300046663 Ga0495635_0028962 Ga0495635_0028962_3209_3832 207
293 3300046663 Ga0495635_0043084 Ga0495635_0043084_1141_1764 207
294 3300046674 Ga0495588_0079174 Ga0495588_0079174_149_772 207
295 3300046675 Ga0495657_0003480 Ga0495657_0003480_9036_9659 207
296 3300046675 Ga0495657_0024349 Ga0495657_0024349_634_1257 207
297 3300046675 Ga0495657_0441560 Ga0495657_0441560_14_649 207
298 3300046678 Ga0495599_0047225 Ga0495599_0047225_914_1537 207
299 3300046678 Ga0495599_0052346 Ga0495599_0052346_1652_2275 207
300 3300046679 Ga0495623_0087437 Ga0495623_0087437_857_1480 207
301 3300046679 Ga0495623_0097877 Ga0495623_0097877_637_1260 207
302 3300046680 Ga0495646_0189527 Ga0495646_0189527_347_970 207
303 3300046683 Ga0495658_0164149 Ga0495658_0164149_362_985 207
304 3300046689 Ga0495613_0004110 Ga0495613_0004110_5681_6304 207
305 3300046689 Ga0495613_0021396 Ga0495613_0021396_1087_1710 207
306 3300046689 Ga0495613_0479149 Ga0495613_0479149_187_810 207
307 3300046690 Ga0495624_0010785 Ga0495624_0010785_5164_5799 207
308 3300046690 Ga0495624_0131644 Ga0495624_0131644_581_1204 207
309 3300046692 Ga0495671_0079334 Ga0495671_0079334_13_636 207
310 3300046694 Ga0495649_0070671 Ga0495649_0070671_1216_1851 207
311 3300046794 Ga0495589_0015740 Ga0495589_0015740_935_1558 207
312 3300046794 Ga0495589_0059236 Ga0495589_0059236_477_1100 207
313 3300046809 Ga0495600_0010883 Ga0495600_0010883_3805_4428 207
314 3300046809 Ga0495600_0273643 Ga0495600_0273643_365_988 207
315 3300047315 Ga0495581_0007085 Ga0495581_0007085_353_976 207
316 3300047317 Ga0495604_0000545 Ga0495604_0000545_2144_2767 207
317 3300047317 Ga0495604_0005331 Ga0495604_0005331_2456_3079 207
318 3300047317 Ga0495604_0362085 Ga0495604_0362085_296_919 207
319 3300047318 Ga0495636_0001518 Ga0495636_0001518_121_756 207
320 3300047318 Ga0495636_0065503 Ga0495636_0065503_627_1250 207
321 3300047318 Ga0495636_0156638 Ga0495636_0156638_91_714 207
322 3300047319 Ga0495674_0079786 Ga0495674_0079786_113_736 207
323 3300047319 Ga0495674_0143441 Ga0495674_0143441_339_962 207
324 3300047321 Ga0495676_0000488 Ga0495676_0000488_9119_9742 207
325 3300047321 Ga0495676_0000537 Ga0495676_0000537_29171_29794 207
326 3300047321 Ga0495676_0115771 Ga0495676_0115771_280_915 207
327 3300047321 Ga0495676_0244669 Ga0495676_0244669_141_764 207
328 3300047321 Ga0495676_0298214 Ga0495676_0298214_210_833 207
329 3300047322 Ga0495680_0032710 Ga0495680_0032710_2479_3102 207
330 3300047322 Ga0495680_0042923 Ga0495680_0042923_2560_3183 207
331 3300047323 Ga0495683_0092272 Ga0495683_0092272_24_647 207
332 3300047443 Ga0495687_002019 Ga0495687_002019_810_1445 207
333 3300047443 Ga0495687_011328 Ga0495687_011328_4127_4750 207
334 3300047443 Ga0495687_015680 Ga0495687_015680_1294_1917 207
335 3300047443 Ga0495687_073595 Ga0495687_073595_587_1210 207
336 3300047446 Ga0495679_014492 Ga0495679_014492_1574_2197 207
337 3300047447 Ga0495685_002536 Ga0495685_002536_395_1018 207
338 3300047447 Ga0495685_054476 Ga0495685_054476_42_665 207
339 3300047470 Ga0495681_0016827 Ga0495681_0016827_2551_3174 207
340 3300047471 Ga0495684_0046297 Ga0495684_0046297_248_871 207
341 3300047471 Ga0495684_0063413 Ga0495684_0063413_1045_1668 207
342 3300047673 Ga0495593_0000258 Ga0495593_0000258_16028_16651 207
343 3300047673 Ga0495593_0024057 Ga0495593_0024057_2717_3352 207
344 3300048089 Ga0495614_0001653 Ga0495614_0001653_330_953 207
345 3300048089 Ga0495614_0002843 Ga0495614_0002843_2974_3609 207
346 3300048905 Ga0496102_0678617 Ga0496102_0678617_94_717 207
347 3300048908 Ga0496105_0525969 Ga0496105_0525969_31_654 207
348 3300048911 Ga0496108_0140686 Ga0496108_0140686_315_938 207
349 3300048912 Ga0496109_0376243 Ga0496109_0376243_659_1282 207
350 3300048912 Ga0496109_0626918 Ga0496109_0626918_39_662 207
351 3300048912 Ga0496109_0742715 Ga0496109_0742715_74_721 207
352 3300048913 Ga0496110_1065986 Ga0496110_1065986_49_672 207
353 3300048914 Ga0496111_0461815 Ga0496111_0461815_21_644 207
354 3300048915 Ga0496112_0112890 Ga0496112_0112890_1989_2615 207
355 3300048915 Ga0496112_0158609 Ga0496112_0158609_182_805 207
356 3300048915 Ga0496112_1177681 Ga0496112_1177681_49_672 207
357 3300048916 Ga0496113_0181722 Ga0496113_0181722_103_729 207
358 3300048916 Ga0496113_0639208 Ga0496113_0639208_176_799 207
359 3300048918 Ga0496115_0093526 Ga0496115_0093526_709_1332 207
360 3300048920 Ga0496117_0052280 Ga0496117_0052280_1267_1890 207
361 3300048921 Ga0496118_0108858 Ga0496118_0108858_304_927 207
362 3300048922 Ga0496119_0000267 Ga0496119_0000267_48825_49448 207
363 3300048922 Ga0496119_0038081 Ga0496119_0038081_1500_2123 207
364 3300048923 Ga0496120_0004527 Ga0496120_0004527_3646_4269 207
365 3300048924 Ga0496121_0046983 Ga0496121_0046983_2476_3099 207
366 3300048924 Ga0496121_0131095 Ga0496121_0131095_765_1388 207
367 3300048925 Ga0496122_0000305 Ga0496122_0000305_6255_6881 207
368 3300048926 Ga0496123_0000284 Ga0496123_0000284_69130_69756 207
369 3300048929 Ga0496126_0000006 Ga0496126_0000006_719263_719886 207
370 3300048929 Ga0496126_0025895 Ga0496126_0025895_4338_4976 207
371 3300048929 Ga0496126_0143568 Ga0496126_0143568_1084_1707 207
372 3300048929 Ga0496126_0158763 Ga0496126_0158763_348_977 207
373 3300048929 Ga0496126_0319966 Ga0496126_0319966_219_842 207
374 3300049569 Ga0501032_0003786 Ga0501032_0003786_330_953 207
375 3300049569 Ga0501032_0326565 Ga0501032_0326565_214_840 207
376 3300049570 Ga0501033_0044526 Ga0501033_0044526_929_1552 207
377 3300049571 Ga0501034_0005213 Ga0501034_0005213_11415_12038 207
378 3300049571 Ga0501034_0386209 Ga0501034_0386209_680_1303 207
379 3300049571 Ga0501034_0566212 Ga0501034_0566212_411_1034 207
380 3300049572 Ga0501036_0011299 Ga0501036_0011299_4923_5546 207
381 3300049572 Ga0501036_0541790 Ga0501036_0541790_145_768 207
382 3300049573 Ga0501037_0056835 Ga0501037_0056835_958_1581 207
383 3300049573 Ga0501037_0192066 Ga0501037_0192066_618_1241 207
384 3300049574 Ga0501038_0024746 Ga0501038_0024746_753_1385 207
385 3300049574 Ga0501038_0051420 Ga0501038_0051420_598_1221 207
386 3300049574 Ga0501038_0103810 Ga0501038_0103810_876_1499 207
387 3300049574 Ga0501038_0178966 Ga0501038_0178966_309_932 207
388 3300049575 Ga0501039_0315799 Ga0501039_0315799_527_1150 207
389 3300049578 Ga0501042_0001445 Ga0501042_0001445_2418_3041 207
390 3300049579 Ga0501043_0067766 Ga0501043_0067766_1046_1669 207
391 3300049579 Ga0501043_0339698 Ga0501043_0339698_154_777 207
392 3300049580 Ga0501046_0058674 Ga0501046_0058674_371_994 207
393 3300049581 Ga0501047_0003526 Ga0501047_0003526_2721_3344 207
394 3300049581 Ga0501047_0004553 Ga0501047_0004553_10889_11512 207
395 3300049581 Ga0501047_0013474 Ga0501047_0013474_2120_2743 207
396 3300049582 Ga0501048_0008014 Ga0501048_0008014_6652_7275 207
397 3300049582 Ga0501048_0031140 Ga0501048_0031140_329_952 207
398 3300049585 Ga0501069_0057041 Ga0501069_0057041_1074_1700 207
399 3300049585 Ga0501069_0238091 Ga0501069_0238091_228_851 207
400 3300049586 Ga0501070_0061016 Ga0501070_0061016_1260_1883 207
401 3300049586 Ga0501070_0387267 Ga0501070_0387267_248_880 207
402 3300049589 Ga0501073_0029923 Ga0501073_0029923_897_1520 207
403 3300049590 Ga0501074_0033129 Ga0501074_0033129_2334_2957 207
404 3300049822 Ga0501035_0003898 Ga0501035_0003898_11388_12011 207
405 3300049823 Ga0501044_0004950 Ga0501044_0004950_2862_3485 207
406 3300049823 Ga0501044_0006686 Ga0501044_0006686_10744_11367 207
407 3300049823 Ga0501044_0477493 Ga0501044_0477493_274_897 207
408 3300049823 Ga0501044_0755236 Ga0501044_0755236_53_676 207
409 3300050511 nmdc:mga08y16_332288_c1 nmdc:mga08y16_332288_c1_897_1526 207
410 3300050512 nmdc:mga0n895_239858_c1 nmdc:mga0n895_239858_c1_176_799 207
411 3300050513 nmdc:mga0rr50_610934_c1 nmdc:mga0rr50_610934_c1_232_855 207
412 3300053077 Ga0495601_0000519 Ga0495601_0000519_14916_15551 207
413 3300053077 Ga0495601_0026027 Ga0495601_0026027_2467_3090 207
414 3300053078 Ga0495612_0142142 Ga0495612_0142142_62_697 207
415 3300053078 Ga0495612_0155160 Ga0495612_0155160_176_799 207
416 3300053084 Ga0495595_0081765 Ga0495595_0081765_770_1393 207
417 3300053090 Ga0500646_0026907 Ga0500646_0026907_162_785 207
418 3300053095 Ga0500640_007318 Ga0500640_007318_3111_3734 207
419 3300053096 Ga0500641_0039505 Ga0500641_0039505_565_1188 207
420 3300053101 Ga0500553_030046 Ga0500553_030046_1607_2230 207
421 3300053109 Ga0500569_012505 Ga0500569_012505_1327_1950 207
422 3300053125 Ga0500618_036008 Ga0500618_036008_44_667 207
423 3300053129 Ga0500628_004523 Ga0500628_004523_101_724 207
424 3300053131 Ga0500652_017290 Ga0500652_017290_445_1068 207
425 3300053137 Ga0500561_0013747 Ga0500561_0013747_259_882 207
426 3300053140 Ga0500573_0186150 Ga0500573_0186150_465_1088 207
427 3300053143 Ga0500579_048915 Ga0500579_048915_1050_1673 207
428 3300053149 Ga0500600_0029597 Ga0500600_0029597_990_1613 207
429 3300053153 Ga0500616_0035701 Ga0500616_0035701_1079_1702 207
430 3300053160 Ga0500633_0020650 Ga0500633_0020650_1218_1841 207
431 3300053160 Ga0500633_0190278 Ga0500633_0190278_66_689 207
432 3300053161 Ga0500634_0024326 Ga0500634_0024326_2164_2787 207
433 3300053177 Ga0500636_0154015 Ga0500636_0154015_556_1179 207
434 3300053732 Ga0500656_000122 Ga0500656_000122_1226_1849 207
435 3300053739 Ga0500587_002769 Ga0500587_002769_1326_1949 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

31

121

0.93

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

19

139

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrn-assembly1.cif.gz_A crystal structure of pf1083 protein from pyrococcus furiosus, northeast structural genomics consortium target pfr223 0.9439 3 30
6fp1-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 0.9369 3 30
3awi-assembly2.cif.gz_B bifunctional trna modification enzyme mnmc from escherichia coli 0.9336 2 34
6fp1-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 0.9335 3 30
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9331 3 32
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9675 2 30 3.50.50.60
af_Q4CT13_9_352_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9451 4 34 3.50.50.60
3sglA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9398 4 33 3.50.50.60
af_I1LIA8_18_345_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9396 4 31 3.50.50.60
af_K7K8P2_5_195_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9332 4 34 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A1G8RT82-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9786 12 205
AF-A0A7K1FP19-F1-model_v4 NADP oxidoreductase 0.9768 1 204
AF-A0A4R6J5V7-F1-model_v4 NADP oxidoreductase 0.9748 73 205
AF-A0A1G8RT82-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9639 12 205
AF-A0A7K1FP19-F1-model_v4 NADP oxidoreductase 0.9627 1 204

Feature Viewer

pLDDT pTM Quality
95.09 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map