F443284

General Info

Members Datasets Scaffolds Average Seq Length
435 259 435 112

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_101247601|Ga0070693_1012476011
Length 133
Sequence MRYVCLIYDEEKKLGTMSKEEANGFMGAYFQFTEEIKKNGNYVAGEALQPIQSATSLRHRAGKLSTTDGPFMETKEQLGGFYLIEARDLNEALQIASRIPSVKTGTIEVRPVVDFSTQQQPPRAGREAAGATT

Samples

Sample ID Description Type Environment
1 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.38
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26141J51220_1001229 3300003503 Bacteria 1540
2 Ga0065704_10324303 3300005289 Unclassified 848
3 Ga0065712_10205465 3300005290 Bacteria 1092
4 Ga0065712_10387188 3300005290 Bacteria 745
5 Ga0065715_10232074 3300005293 Bacteria 1230
6 Ga0065707_10250772 3300005295 Bacteria 1126
7 Ga0065707_10657255 3300005295 Bacteria 660
8 Ga0070676_10452182 3300005328 Unclassified 903
9 Ga0070690_100016014 3300005330 Bacteria 4483
10 Ga0070690_100677683 3300005330 Unclassified 790
11 Ga0070670_100013091 3300005331 Bacteria 7106
12 Ga0070670_100015373 3300005331 Bacteria 6572
13 Ga0070677_10266798 3300005333 Bacteria 857
14 Ga0068869_100244432 3300005334 Bacteria 1431
15 Ga0068869_100777916 3300005334 Bacteria 821
16 Ga0068869_100892643 3300005334 Bacteria 769
17 Ga0070666_10425990 3300005335 Unclassified 956
18 Ga0070680_100209287 3300005336 Bacteria 1645
19 Ga0070682_100363616 3300005337 Bacteria 1083
20 Ga0070682_100756537 3300005337 Bacteria 785
21 Ga0070660_100774295 3300005339 Bacteria 806
22 Ga0070689_100113732 3300005340 Bacteria 2155
23 Ga0070689_100194082 3300005340 Bacteria 1654
24 Ga0070689_101497197 3300005340 Bacteria 611
25 Ga0070687_100004414 3300005343 Bacteria 5606
26 Ga0070661_100641110 3300005344 Bacteria 862
27 Ga0070692_10702699 3300005345 Bacteria 680
28 Ga0070692_10727021 3300005345 Bacteria 671
29 Ga0070692_11207675 3300005345 Bacteria 539
30 Ga0070668_100025542 3300005347 Bacteria 4480
31 Ga0070668_100766828 3300005347 Bacteria 855
32 Ga0070669_100010329 3300005353 Bacteria 6630
33 Ga0070675_100002435 3300005354 Bacteria 13896
34 Ga0070675_100010658 3300005354 Bacteria 7186
35 Ga0070675_101094585 3300005354 Bacteria 733
36 Ga0070671_100017253 3300005355 Bacteria 5845
37 Ga0070674_100820895 3300005356 Bacteria 804
38 Ga0070674_101079068 3300005356 Bacteria 708
39 Ga0070673_100050876 3300005364 Bacteria 3241
40 Ga0070673_100058364 3300005364 Bacteria 3051
41 Ga0070673_100342506 3300005364 Bacteria 1325
42 Ga0070688_100044157 3300005365 Bacteria 2749
43 Ga0070688_100478677 3300005365 Unclassified 935
44 Ga0070659_100369018 3300005366 Bacteria 1207
45 Ga0070667_100399902 3300005367 Bacteria 1250
46 Ga0070667_101425472 3300005367 Bacteria 650
47 Ga0070703_10116851 3300005406 Unclassified 962
48 Ga0070703_10235473 3300005406 Unclassified 736
49 Ga0070709_11344836 3300005434 Bacteria 577
50 Ga0070701_10016930 3300005438 Bacteria 3400
51 Ga0070705_100143366 3300005440 Bacteria 1575
52 Ga0070705_100429460 3300005440 Bacteria 986
53 Ga0070705_101760051 3300005440 Unclassified 525
54 Ga0070700_100217120 3300005441 Bacteria 1353
55 Ga0070700_100762063 3300005441 Bacteria 776
56 Ga0070694_100004094 3300005444 Bacteria 8750
57 Ga0070694_101243749 3300005444 Bacteria 625
58 Ga0070694_101260626 3300005444 Bacteria 621
59 Ga0070663_100756993 3300005455 Unclassified 830
60 Ga0070678_100922690 3300005456 Bacteria 799
61 Ga0070678_101075115 3300005456 Unclassified 742
62 Ga0070662_100055294 3300005457 Bacteria 2879
63 Ga0070662_100159750 3300005457 Bacteria 1762
64 Ga0070662_100539847 3300005457 Bacteria 976
65 Ga0070662_101533656 3300005457 Bacteria 575
66 Ga0070681_10256797 3300005458 Bacteria 1659
67 Ga0070681_11969820 3300005458 Unclassified 512
68 Ga0068867_100023342 3300005459 Bacteria 4428
69 Ga0068867_100426211 3300005459 Bacteria 1125
70 Ga0068867_100632133 3300005459 Unclassified 937
71 Ga0070707_100549532 3300005468 Unclassified 1117
72 Ga0070707_100712223 3300005468 Bacteria 967
73 Ga0070707_101505008 3300005468 Bacteria 640
74 Ga0070698_100140309 3300005471 Bacteria 2368
75 Ga0070698_100141983 3300005471 Unclassified 2352
76 Ga0070698_100579544 3300005471 Bacteria 1062
77 Ga0070699_100097653 3300005518 Unclassified 2573
78 Ga0070679_100316515 3300005530 Bacteria 1510
79 Ga0070684_100243537 3300005535 Bacteria 1643
80 Ga0070684_101427542 3300005535 Bacteria 652
81 Ga0070672_100073446 3300005543 Bacteria 2726
82 Ga0070672_100197383 3300005543 Bacteria 1682
83 Ga0070672_100230719 3300005543 Bacteria 1555
84 Ga0070672_100393485 3300005543 Bacteria 1187
85 Ga0070672_101428224 3300005543 Bacteria 619
86 Ga0070686_100290600 3300005544 Bacteria 1209
87 Ga0070695_100000877 3300005545 Bacteria 16205
88 Ga0070696_100120846 3300005546 Bacteria 1896
89 Ga0070696_101073215 3300005546 Bacteria 676
90 Ga0070696_101191609 3300005546 Bacteria 643
91 Ga0070693_101247601 3300005547 Bacteria 573
92 Ga0070665_100007329 3300005548 Bacteria 11222
93 Ga0070704_100008575 3300005549 Bacteria 6139
94 Ga0070704_100032275 3300005549 Bacteria 3530
95 Ga0070664_100028796 3300005564 Bacteria 4625
96 Ga0070664_100548032 3300005564 Bacteria 1069
97 Ga0070664_100726862 3300005564 Bacteria 926
98 Ga0068857_100025046 3300005577 Bacteria 5256
99 Ga0068857_100142932 3300005577 Bacteria 2164
100 Ga0068852_101713628 3300005616 Bacteria 651
101 Ga0068859_100033204 3300005617 Bacteria 5183
102 Ga0068859_100091298 3300005617 Bacteria 3096
103 Ga0068864_100197866 3300005618 Bacteria 1845
104 Ga0068864_102619793 3300005618 Bacteria 510
105 Ga0068861_100002036 3300005719 Bacteria 13092
106 Ga0068870_10010236 3300005840 Bacteria 4298
107 Ga0068870_10042991 3300005840 Bacteria 2355
108 Ga0068870_10231996 3300005840 Bacteria 1135
109 Ga0068863_100303592 3300005841 Bacteria 1549
110 Ga0068863_100475809 3300005841 Bacteria 1228
111 Ga0068858_100016232 3300005842 Bacteria 6995
112 Ga0068858_100059437 3300005842 Bacteria 3533
113 Ga0068858_100122295 3300005842 Bacteria 2435
114 Ga0068858_101407561 3300005842 Bacteria 687
115 Ga0068860_100014399 3300005843 Bacteria 7749
116 Ga0068860_100133881 3300005843 Bacteria 2380
117 Ga0068860_100779594 3300005843 Unclassified 969
118 Ga0068862_100015307 3300005844 Bacteria 6370
119 Ga0068862_102501058 3300005844 Bacteria 528
120 Ga0068862_102589213 3300005844 Bacteria 519
121 Ga0081539_10113949 3300005985 Bacteria 1355
122 Ga0081539_10194395 3300005985 Bacteria 942
123 Ga0075432_10505796 3300006058 Unclassified 539
124 Ga0097621_100350005 3300006237 Bacteria 1314
125 Ga0068871_100223958 3300006358 Bacteria 1630
126 Ga0068871_100829945 3300006358 Bacteria 853
127 Ga0075428_100013009 3300006844 Bacteria 9251
128 Ga0075428_100055112 3300006844 Bacteria 4357
129 Ga0075428_100517678 3300006844 Bacteria 1276
130 Ga0075430_100077570 3300006846 Bacteria 2785
131 Ga0075430_100294755 3300006846 Bacteria 1342
132 Ga0075431_100008077 3300006847 Bacteria 10505
133 Ga0075433_10412973 3300006852 Bacteria 1190
134 Ga0075433_10450125 3300006852 Bacteria 1135
135 Ga0075434_100122627 3300006871 Bacteria 2615
136 Ga0075434_100915626 3300006871 Bacteria 891
137 Ga0075429_100047436 3300006880 Bacteria 3737
138 Ga0075429_100176581 3300006880 Unclassified 1871
139 Ga0075429_100958908 3300006880 Unclassified 748
140 Ga0068865_100342270 3300006881 Unclassified 1209
141 Ga0068865_100516032 3300006881 Bacteria 999
142 Ga0075436_100023429 3300006914 Bacteria 4241
143 Ga0075436_100089914 3300006914 Bacteria 2134
144 Ga0097620_100033203 3300006931 Bacteria 5183
145 Ga0097620_100091301 3300006931 Bacteria 3096
146 Ga0105240_10526671 3300009093 Bacteria 1311
147 Ga0111539_10004603 3300009094 Bacteria 18020
148 Ga0111539_10219600 3300009094 Bacteria 2214
149 Ga0111539_10944338 3300009094 Bacteria 1003
150 Ga0111539_11628942 3300009094 Bacteria 748
151 Ga0111539_11717986 3300009094 Unclassified 728
152 Ga0111539_12017738 3300009094 Bacteria 669
153 Ga0111539_13019964 3300009094 Bacteria 544
154 Ga0105247_10005669 3300009101 Bacteria 7826
155 Ga0114129_10005499 3300009147 Bacteria 17911
156 Ga0114129_10017513 3300009147 Bacteria 10201
157 Ga0114129_10138609 3300009147 Bacteria 3337
158 Ga0114129_10184570 3300009147 Bacteria 2836
159 Ga0114129_10851729 3300009147 Bacteria 1159
160 Ga0114129_11064119 3300009147 Bacteria 1015
161 Ga0105243_10074573 3300009148 Bacteria 2752
162 Ga0105241_10808186 3300009174 Bacteria 864
163 Ga0105242_12117518 3300009176 Bacteria 607
164 Ga0105242_12992658 3300009176 Bacteria 523
165 Ga0105248_10100286 3300009177 Unclassified 3263
166 Ga0105238_10937102 3300009551 Bacteria 885
167 Ga0105249_10002720 3300009553 Bacteria 15285
168 Ga0105246_10955309 3300011119 Bacteria 773
169 Ga0157371_10045930 3300013102 Bacteria 3107
170 Ga0157374_10293058 3300013296 Unclassified 1609
171 Ga0157374_11114373 3300013296 Bacteria 810
172 Ga0157378_10712128 3300013297 Unclassified 1024
173 Ga0163162_10235679 3300013306 Unclassified 1961
174 Ga0163162_12579233 3300013306 Bacteria 585
175 Ga0157372_10061735 3300013307 Bacteria 4197
176 Ga0157375_10125116 3300013308 Bacteria 2685
177 Ga0157375_10254312 3300013308 Bacteria 1918
178 Ga0157375_10553245 3300013308 Bacteria 1312
179 Ga0157375_12069111 3300013308 Bacteria 677
180 Ga0157380_10172009 3300014326 Bacteria 1894
181 Ga0157380_11054641 3300014326 Bacteria 849
182 Ga0157377_10073892 3300014745 Bacteria 1977
183 Ga0157377_10624274 3300014745 Unclassified 772
184 Ga0157379_10017793 3300014968 Bacteria 6260
185 Ga0157379_10037620 3300014968 Bacteria 4316
186 Ga0157376_10167647 3300014969 Bacteria 1997
187 Ga0157376_10510839 3300014969 Bacteria 1183
188 Ga0213874_10226051 3300021377 Unclassified 682
189 Ga0207666_1054225 3300025271 Unclassified 638
190 Ga0207697_10184569 3300025315 Bacteria 915
191 Ga0207697_10308031 3300025315 Bacteria 703
192 Ga0207653_10192273 3300025885 Unclassified 767
193 Ga0207682_10159007 3300025893 Bacteria 1023
194 Ga0207710_10195656 3300025900 Bacteria 997
195 Ga0207688_10045351 3300025901 Bacteria 2452
196 Ga0207688_10344382 3300025901 Bacteria 917
197 Ga0207645_11138778 3300025907 Bacteria 525
198 Ga0207643_10002617 3300025908 Bacteria 9743
199 Ga0207643_10048192 3300025908 Bacteria 2413
200 Ga0207660_10280139 3300025917 Bacteria 1323
201 Ga0207662_10004260 3300025918 Bacteria 7505
202 Ga0207657_10081086 3300025919 Bacteria 2726
203 Ga0207657_11247724 3300025919 Bacteria 563
204 Ga0207646_10130987 3300025922 Bacteria 2257
205 Ga0207646_10392320 3300025922 Bacteria 1254
206 Ga0207681_10023676 3300025923 Bacteria 3931
207 Ga0207650_10105281 3300025925 Bacteria 2177
208 Ga0207659_10002232 3300025926 Bacteria 11537
209 Ga0207659_10051204 3300025926 Bacteria 2936
210 Ga0207706_10022095 3300025933 Bacteria 5709
211 Ga0207706_10173366 3300025933 Bacteria 1895
212 Ga0207706_10808615 3300025933 Bacteria 796
213 Ga0207709_10041662 3300025935 Bacteria 2757
214 Ga0207670_10029889 3300025936 Bacteria 3475
215 Ga0207670_10054870 3300025936 Bacteria 2690
216 Ga0207669_11425675 3300025937 Unclassified 590
217 Ga0207704_10308293 3300025938 Unclassified 1216
218 Ga0207704_10984964 3300025938 Bacteria 712
219 Ga0207691_10133391 3300025940 Bacteria 2192
220 Ga0207691_10202165 3300025940 Bacteria 1729
221 Ga0207691_10227251 3300025940 Bacteria 1617
222 Ga0207711_10041043 3300025941 Bacteria 3939
223 Ga0207711_10136774 3300025941 Bacteria 2201
224 Ga0207711_10906379 3300025941 Unclassified 819
225 Ga0207689_10180034 3300025942 Bacteria 1743
226 Ga0207689_10198425 3300025942 Bacteria 1656
227 Ga0207689_10272812 3300025942 Bacteria 1400
228 Ga0207689_10372201 3300025942 Bacteria 1189
229 Ga0207679_10014980 3300025945 Bacteria 5110
230 Ga0207679_11220905 3300025945 Bacteria 690
231 Ga0207651_10037135 3300025960 Bacteria 3189
232 Ga0207651_10096640 3300025960 Bacteria 2179
233 Ga0207712_10004553 3300025961 Bacteria 8747
234 Ga0207668_10031801 3300025972 Bacteria 3481
235 Ga0207668_10667744 3300025972 Bacteria 911
236 Ga0207640_10483135 3300025981 Unclassified 1028
237 Ga0207658_10113049 3300025986 Bacteria 2151
238 Ga0207703_10044054 3300026035 Bacteria 3584
239 Ga0207703_10050779 3300026035 Bacteria 3358
240 Ga0207703_12244438 3300026035 Unclassified 522
241 Ga0207708_10050120 3300026075 Bacteria 3179
242 Ga0207708_10215322 3300026075 Bacteria 1537
243 Ga0207708_10366046 3300026075 Bacteria 1186
244 Ga0207641_11712770 3300026088 Bacteria 630
245 Ga0207648_10001634 3300026089 Bacteria 24557
246 Ga0207648_10208667 3300026089 Bacteria 1733
247 Ga0207648_10568578 3300026089 Bacteria 1043
248 Ga0207676_10117089 3300026095 Unclassified 2240
249 Ga0207676_10262797 3300026095 Unclassified 1559
250 Ga0207676_11979601 3300026095 Bacteria 581
251 Ga0207674_10122456 3300026116 Bacteria 2567
252 Ga0207674_10160616 3300026116 Bacteria 2202
253 Ga0207674_10233445 3300026116 Bacteria 1787
254 Ga0207674_11957473 3300026116 Bacteria 552
255 Ga0207675_100008997 3300026118 Bacteria 9370
256 Ga0207675_100150712 3300026118 Bacteria 2213
257 Ga0207683_10961055 3300026121 Bacteria 793
258 Ga0207698_11050214 3300026142 Bacteria 826
259 Ga0207698_11690036 3300026142 Unclassified 648
260 Ga0209973_1077416 3300027252 Bacteria 526
261 Ga0209969_1008293 3300027360 Bacteria 1472
262 Ga0209967_1002019 3300027364 Bacteria 2618
263 Ga0209996_1005171 3300027395 Bacteria 1671
264 Ga0210000_1002183 3300027462 Bacteria 2776
265 Ga0209995_1003068 3300027471 Bacteria 2652
266 Ga0209968_1003380 3300027526 Bacteria 2397
267 Ga0209999_1024122 3300027543 Bacteria 1122
268 Ga0209982_1037926 3300027552 Bacteria 766
269 Ga0210002_1019160 3300027617 Bacteria 1097
270 Ga0210002_1020541 3300027617 Bacteria 1064
271 Ga0209971_1000004 3300027682 Bacteria 110041
272 Ga0209966_1000230 3300027695 Bacteria 21304
273 Ga0209998_10000022 3300027717 Bacteria 70281
274 Ga0209974_10006713 3300027876 Bacteria 3996
275 Ga0209974_10420137 3300027876 Bacteria 527
276 Ga0207428_10010852 3300027907 Bacteria 8118
277 Ga0207428_10301741 3300027907 Bacteria 1185
278 Ga0268266_10011453 3300028379 Bacteria 7711
279 Ga0268266_10660299 3300028379 Bacteria 1007
280 Ga0268265_10000545 3300028380 Bacteria 38390
281 Ga0268265_10733871 3300028380 Bacteria 957
282 Ga0268264_10012043 3300028381 Bacteria 7120
283 Ga0268264_10709437 3300028381 Unclassified 1000
284 Ga0307408_100872235 3300031548 Bacteria 822
285 Ga0307405_10487055 3300031731 Bacteria 986
286 Ga0307405_11426836 3300031731 Bacteria 606
287 Ga0307405_11904095 3300031731 Bacteria 530
288 Ga0307413_10532783 3300031824 Bacteria 949
289 Ga0307413_11562183 3300031824 Bacteria 585
290 Ga0307410_10226286 3300031852 Bacteria 1442
291 Ga0326468_10002484 3300031889 Bacteria 1539
292 Ga0307407_10860757 3300031903 Bacteria 693
293 Ga0307409_101016222 3300031995 Bacteria 848
294 Ga0307409_102107274 3300031995 Bacteria 594
295 Ga0307416_100588587 3300032002 Bacteria 1191
296 Ga0307416_101771919 3300032002 Bacteria 722
297 Ga0307416_102950523 3300032002 Bacteria 569
298 Ga0307414_10765005 3300032004 Bacteria 879
299 Ga0307414_11144024 3300032004 Bacteria 720
300 Ga0307411_10263796 3300032005 Bacteria 1362
301 Ga0373949_0010153 3300035090 Bacteria 2062
302 Ga0373952_0190289 3300035092 Bacteria 596
303 Ga0373953_0197645 3300035117 Bacteria 869
304 Ga0373957_0035123 3300035120 Bacteria 1861
305 Ga0373943_0118256 3300035170 Bacteria 1406
306 Ga0373955_0169404 3300035172 Bacteria 1292
307 Ga0373955_0661483 3300035172 Bacteria 641
308 Ga0373961_0027135 3300035241 Bacteria 1570
309 Ga0373962_0033291 3300035242 Bacteria 1422
310 Ga0373931_0171691 3300035691 Bacteria 1278
311 Ga0373935_0451216 3300035692 Bacteria 929
312 Ga0373933_0263342 3300035724 Bacteria 1112
313 Ga0373947_0272497 3300035725 Unclassified 1124
314 Ga0373947_0466497 3300035725 Bacteria 856
315 Ga0373937_0169221 3300036401 Bacteria 2050
316 Ga0436363_1333010 3300039450 Unclassified 729
317 Ga0439453_0055093 3300041408 Bacteria 812
318 Ga0450902_040374 3300042137 Bacteria 794
319 Ga0439435_0015658 3300042436 Bacteria 1890
320 Ga0439435_0106192 3300042436 Bacteria 867
321 Ga0439444_0040274 3300042437 Bacteria 915
322 Ga0439460_0074798 3300042461 Bacteria 1055
323 Ga0453683_0201744 3300044673 Bacteria 1263
324 Ga0466965_0007025 3300044683 Bacteria 5153
325 Ga0466960_0013639 3300044901 Bacteria 3458
326 Ga0451576_0067982 3300045051 Bacteria 3708
327 Ga0451576_1027168 3300045051 Bacteria 864
328 Ga0466967_0524384 3300045976 Bacteria 1164
329 Ga0495629_0471290 3300046459 Bacteria 849
330 Ga0495651_0568552 3300046462 Bacteria 718
331 Ga0495639_0749295 3300046475 Bacteria 505
332 Ga0495662_0133729 3300046476 Bacteria 1220
333 Ga0495585_0144692 3300046492 Bacteria 1243
334 Ga0495630_0203779 3300046517 Bacteria 1510
335 Ga0495642_0104281 3300046528 Bacteria 1209
336 Ga0495640_0071568 3300046533 Bacteria 2327
337 Ga0495586_0097918 3300046535 Bacteria 1625
338 Ga0495587_0156408 3300046536 Bacteria 1298
339 Ga0495587_0714197 3300046536 Bacteria 549
340 Ga0495621_0025113 3300046539 Bacteria 1999
341 Ga0495645_0001662 3300046543 Bacteria 15098
342 Ga0495633_0274771 3300046558 Bacteria 767
343 Ga0495667_0166682 3300046559 Bacteria 1416
344 Ga0495635_0902131 3300046663 Bacteria 566
345 Ga0495659_0014806 3300046664 Bacteria 2558
346 Ga0495659_0016072 3300046664 Bacteria 2466
347 Ga0495659_0089961 3300046664 Bacteria 1177
348 Ga0495659_0196356 3300046664 Bacteria 826
349 Ga0495657_0475359 3300046675 Bacteria 730
350 Ga0495658_0041255 3300046683 Bacteria 2570
351 Ga0495658_0399871 3300046683 Unclassified 876
352 Ga0495658_0490769 3300046683 Bacteria 785
353 Ga0495613_0120066 3300046689 Bacteria 1888
354 Ga0495670_0027259 3300046691 Bacteria 2830
355 Ga0495670_0200031 3300046691 Bacteria 1058
356 Ga0495600_0124133 3300046809 Bacteria 1679
357 Ga0495600_0659948 3300046809 Bacteria 632
358 Ga0495636_0263002 3300047318 Bacteria 800
359 Ga0495680_0061812 3300047322 Bacteria 2880
360 Ga0495677_0186417 3300047445 Bacteria 805
361 Ga0495684_0094039 3300047471 Bacteria 2270
362 Ga0495602_0856605 3300048088 Bacteria 607
363 Ga0496100_0978049 3300048903 Bacteria 666
364 Ga0496104_0275940 3300048907 Bacteria 1594
365 Ga0496106_0194792 3300048909 Bacteria 1612
366 Ga0496107_0731254 3300048910 Bacteria 727
367 Ga0496112_0224919 3300048915 Bacteria 1832
368 Ga0496114_1018421 3300048917 Bacteria 712
369 Ga0501031_0186159 3300049568 Bacteria 1356
370 Ga0501033_0467079 3300049570 Bacteria 875
371 Ga0501034_0146441 3300049571 Bacteria 2339
372 Ga0501036_0866385 3300049572 Bacteria 742
373 Ga0501038_0161081 3300049574 Bacteria 1823
374 Ga0501039_0064457 3300049575 Bacteria 2840
375 Ga0501040_0033517 3300049576 Bacteria 3479
376 Ga0501040_1412297 3300049576 Bacteria 505
377 Ga0501040_1429059 3300049576 Bacteria 502
378 Ga0501041_0381309 3300049577 Bacteria 892
379 Ga0501042_0053284 3300049578 Bacteria 2886
380 Ga0501043_0029652 3300049579 Bacteria 4300
381 Ga0501046_0002578 3300049580 Bacteria 16953
382 Ga0501047_0281736 3300049581 Bacteria 1507
383 Ga0501048_1045647 3300049582 Bacteria 587
384 Ga0501067_0117770 3300049583 Bacteria 1477
385 Ga0501068_0081547 3300049584 Bacteria 1986
386 Ga0501071_0048492 3300049587 Bacteria 3055
387 Ga0501072_0164281 3300049588 Bacteria 1771
388 Ga0501072_0915626 3300049588 Bacteria 685
389 Ga0501073_0153496 3300049589 Bacteria 1596
390 Ga0501074_0013238 3300049590 Bacteria 5998
391 Ga0501074_0285519 3300049590 Bacteria 1173
392 Ga0501076_0126246 3300049592 Bacteria 2073
393 Ga0501077_0052880 3300049593 Bacteria 2578
394 Ga0501224_057540 3300049664 Bacteria 603
395 Ga0501079_0005134 3300049741 Bacteria 9733
396 Ga0501079_0503870 3300049741 Bacteria 952
397 Ga0501080_0136373 3300049742 Bacteria 2271
398 Ga0501080_1117650 3300049742 Bacteria 680
399 Ga0501081_0166459 3300049743 Bacteria 1590
400 Ga0501081_0216890 3300049743 Bacteria 1391
401 Ga0501083_0079790 3300049744 Bacteria 2170
402 Ga0501045_0003036 3300049824 Bacteria 11479
403 nmdc:mga05p37_112984_c1 3300050507 Bacteria 3340
404 nmdc:mga05p37_179107_c1 3300050507 Bacteria 2580
405 nmdc:mga05p37_2275580_c1 3300050507 Bacteria 500
406 nmdc:mga05p37_43533_c1 3300050507 Bacteria 5523
407 nmdc:mga05p37_898405_c1 3300050507 Unclassified 955
408 nmdc:mga05p37_955_c1 3300050507 Bacteria 32691
409 nmdc:mga09592_132677_c1 3300050508 Bacteria 2144
410 nmdc:mga09592_132834_c1 3300050508 Bacteria 2143
411 nmdc:mga09592_263408_c1 3300050508 Bacteria 1495
412 nmdc:mga0qj67_28001_c1 3300050509 Bacteria 2875
413 nmdc:mga0qj67_57566_c1 3300050509 Bacteria 3081
414 nmdc:mga06r32_44562_c1 3300050510 Bacteria 4225
415 nmdc:mga08y16_1027944_c1 3300050511 Bacteria 803
416 nmdc:mga08y16_1945103_c1 3300050511 Bacteria 538
417 nmdc:mga08y16_258692_c1 3300050511 Bacteria 1798
418 nmdc:mga08y16_83271_c1 3300050511 Bacteria 3334
419 nmdc:mga0n895_100808_c1 3300050512 Bacteria 2897
420 nmdc:mga0n895_1089290_c1 3300050512 Bacteria 777
421 nmdc:mga0n895_1864016_c1 3300050512 Bacteria 561
422 nmdc:mga08x19_14097_c1 3300050514 Bacteria 4844
423 nmdc:mga08x19_249637_c1 3300050514 Bacteria 1225
424 nmdc:mga08x19_319640_c1 3300050514 Bacteria 1080
425 nmdc:mga0a205_59063_c1 3300050515 Bacteria 3705
426 Ga0495595_0036792 3300053084 Bacteria 2223
427 Ga0495619_0173773 3300053085 Bacteria 1490
428 Ga0495619_0265741 3300053085 Bacteria 1189
429 Ga0495619_0561912 3300053085 Bacteria 782
430 Ga0500637_0017328 3300053178 Bacteria 3854
431 Ga0501084_0001571 3300054114 Bacteria 18087
432 Ga0501082_0002951 3300060353 Bacteria 14839
433 Ga0501082_0490101 3300060353 Bacteria 1074
434 Ga0530510_0947770 3300061734 Bacteria 658
435 Ga0530510_1105788 3300061734 Bacteria 607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0263342 Ga0373933_0263342_783_1097 103
2 3300005289 Ga0065704_10324303 Ga0065704_103243032 109
3 3300005290 Ga0065712_10387188 Ga0065712_103871882 109
4 3300005293 Ga0065715_10232074 Ga0065715_102320741 109
5 3300005295 Ga0065707_10250772 Ga0065707_102507721 109
6 3300005328 Ga0070676_10452182 Ga0070676_104521822 109
7 3300005330 Ga0070690_100016014 Ga0070690_1000160144 109
8 3300005330 Ga0070690_100677683 Ga0070690_1006776832 109
9 3300005331 Ga0070670_100013091 Ga0070670_1000130915 109
10 3300005331 Ga0070670_100015373 Ga0070670_1000153733 109
11 3300005333 Ga0070677_10266798 Ga0070677_102667981 109
12 3300005334 Ga0068869_100244432 Ga0068869_1002444322 109
13 3300005334 Ga0068869_100777916 Ga0068869_1007779162 109
14 3300005334 Ga0068869_100892643 Ga0068869_1008926431 109
15 3300005335 Ga0070666_10425990 Ga0070666_104259902 109
16 3300005336 Ga0070680_100209287 Ga0070680_1002092871 109
17 3300005337 Ga0070682_100363616 Ga0070682_1003636162 109
18 3300005337 Ga0070682_100756537 Ga0070682_1007565372 109
19 3300005339 Ga0070660_100774295 Ga0070660_1007742952 109
20 3300005340 Ga0070689_100113732 Ga0070689_1001137322 109
21 3300005340 Ga0070689_100194082 Ga0070689_1001940822 109
22 3300005340 Ga0070689_101497197 Ga0070689_1014971971 109
23 3300005343 Ga0070687_100004414 Ga0070687_1000044146 109
24 3300005344 Ga0070661_100641110 Ga0070661_1006411102 109
25 3300005345 Ga0070692_10702699 Ga0070692_107026991 109
26 3300005345 Ga0070692_11207675 Ga0070692_112076752 109
27 3300005347 Ga0070668_100025542 Ga0070668_1000255425 109
28 3300005347 Ga0070668_100766828 Ga0070668_1007668282 109
29 3300005353 Ga0070669_100010329 Ga0070669_1000103293 109
30 3300005354 Ga0070675_100002435 Ga0070675_10000243512 109
31 3300005354 Ga0070675_100010658 Ga0070675_1000106584 109
32 3300005355 Ga0070671_100017253 Ga0070671_1000172532 109
33 3300005356 Ga0070674_100820895 Ga0070674_1008208952 109
34 3300005356 Ga0070674_101079068 Ga0070674_1010790681 109
35 3300005364 Ga0070673_100050876 Ga0070673_1000508764 109
36 3300005364 Ga0070673_100058364 Ga0070673_1000583643 109
37 3300005364 Ga0070673_100342506 Ga0070673_1003425062 109
38 3300005365 Ga0070688_100044157 Ga0070688_1000441572 109
39 3300005365 Ga0070688_100478677 Ga0070688_1004786772 109
40 3300005366 Ga0070659_100369018 Ga0070659_1003690182 109
41 3300005367 Ga0070667_100399902 Ga0070667_1003999022 109
42 3300005367 Ga0070667_101425472 Ga0070667_1014254721 109
43 3300005406 Ga0070703_10116851 Ga0070703_101168512 109
44 3300005406 Ga0070703_10235473 Ga0070703_102354731 109
45 3300005434 Ga0070709_11344836 Ga0070709_113448361 109
46 3300005438 Ga0070701_10016930 Ga0070701_100169303 109
47 3300005440 Ga0070705_100143366 Ga0070705_1001433662 109
48 3300005440 Ga0070705_100429460 Ga0070705_1004294602 109
49 3300005440 Ga0070705_101760051 Ga0070705_1017600512 109
50 3300005441 Ga0070700_100217120 Ga0070700_1002171201 109
51 3300005441 Ga0070700_100762063 Ga0070700_1007620631 109
52 3300005444 Ga0070694_101243749 Ga0070694_1012437491 109
53 3300005444 Ga0070694_101260626 Ga0070694_1012606261 109
54 3300005455 Ga0070663_100756993 Ga0070663_1007569932 109
55 3300005456 Ga0070678_100922690 Ga0070678_1009226902 109
56 3300005456 Ga0070678_101075115 Ga0070678_1010751151 109
57 3300005457 Ga0070662_100055294 Ga0070662_1000552944 109
58 3300005457 Ga0070662_100159750 Ga0070662_1001597503 109
59 3300005457 Ga0070662_101533656 Ga0070662_1015336562 109
60 3300005458 Ga0070681_10256797 Ga0070681_102567972 109
61 3300005458 Ga0070681_11969820 Ga0070681_119698201 109
62 3300005459 Ga0068867_100023342 Ga0068867_1000233425 109
63 3300005459 Ga0068867_100426211 Ga0068867_1004262112 109
64 3300005459 Ga0068867_100632133 Ga0068867_1006321331 109
65 3300005468 Ga0070707_100549532 Ga0070707_1005495322 109
66 3300005468 Ga0070707_100712223 Ga0070707_1007122231 109
67 3300005468 Ga0070707_101505008 Ga0070707_1015050081 109
68 3300005471 Ga0070698_100141983 Ga0070698_1001419834 109
69 3300005471 Ga0070698_100579544 Ga0070698_1005795442 109
70 3300005518 Ga0070699_100097653 Ga0070699_1000976534 109
71 3300005530 Ga0070679_100316515 Ga0070679_1003165152 109
72 3300005535 Ga0070684_100243537 Ga0070684_1002435372 109
73 3300005535 Ga0070684_101427542 Ga0070684_1014275421 109
74 3300005543 Ga0070672_100073446 Ga0070672_1000734464 109
75 3300005543 Ga0070672_100197383 Ga0070672_1001973832 109
76 3300005543 Ga0070672_100230719 Ga0070672_1002307192 109
77 3300005543 Ga0070672_100393485 Ga0070672_1003934852 109
78 3300005543 Ga0070672_101428224 Ga0070672_1014282241 109
79 3300005544 Ga0070686_100290600 Ga0070686_1002906002 109
80 3300005546 Ga0070696_100120846 Ga0070696_1001208462 109
81 3300005546 Ga0070696_101073215 Ga0070696_1010732151 109
82 3300005546 Ga0070696_101191609 Ga0070696_1011916092 109
83 3300005548 Ga0070665_100007329 Ga0070665_1000073292 109
84 3300005549 Ga0070704_100008575 Ga0070704_1000085755 109
85 3300005549 Ga0070704_100032275 Ga0070704_1000322752 109
86 3300005564 Ga0070664_100028796 Ga0070664_1000287965 109
87 3300005564 Ga0070664_100548032 Ga0070664_1005480322 109
88 3300005564 Ga0070664_100726862 Ga0070664_1007268622 109
89 3300005577 Ga0068857_100025046 Ga0068857_1000250466 109
90 3300005577 Ga0068857_100142932 Ga0068857_1001429323 109
91 3300005616 Ga0068852_101713628 Ga0068852_1017136281 109
92 3300005617 Ga0068859_100033204 Ga0068859_1000332045 109
93 3300005617 Ga0068859_100091298 Ga0068859_1000912982 109
94 3300005618 Ga0068864_100197866 Ga0068864_1001978662 109
95 3300005618 Ga0068864_102619793 Ga0068864_1026197931 109
96 3300005719 Ga0068861_100002036 Ga0068861_10000203610 109
97 3300005840 Ga0068870_10010236 Ga0068870_100102364 109
98 3300005840 Ga0068870_10042991 Ga0068870_100429912 109
99 3300005840 Ga0068870_10231996 Ga0068870_102319962 109
100 3300005841 Ga0068863_100303592 Ga0068863_1003035921 109
101 3300005841 Ga0068863_100475809 Ga0068863_1004758092 109
102 3300005842 Ga0068858_100016232 Ga0068858_1000162322 109
103 3300005842 Ga0068858_100059437 Ga0068858_1000594375 109
104 3300005842 Ga0068858_100122295 Ga0068858_1001222953 109
105 3300005842 Ga0068858_101407561 Ga0068858_1014075611 109
106 3300005843 Ga0068860_100014399 Ga0068860_1000143998 109
107 3300005843 Ga0068860_100133881 Ga0068860_1001338812 109
108 3300005843 Ga0068860_100779594 Ga0068860_1007795942 109
109 3300005844 Ga0068862_100015307 Ga0068862_1000153072 109
110 3300005844 Ga0068862_102501058 Ga0068862_1025010581 109
111 3300005844 Ga0068862_102589213 Ga0068862_1025892131 109
112 3300005985 Ga0081539_10113949 Ga0081539_101139493 109
113 3300005985 Ga0081539_10194395 Ga0081539_101943951 109
114 3300006058 Ga0075432_10505796 Ga0075432_105057962 109
115 3300006237 Ga0097621_100350005 Ga0097621_1003500052 109
116 3300006358 Ga0068871_100223958 Ga0068871_1002239582 109
117 3300006358 Ga0068871_100829945 Ga0068871_1008299451 109
118 3300006844 Ga0075428_100013009 Ga0075428_1000130097 109
119 3300006844 Ga0075428_100055112 Ga0075428_1000551124 109
120 3300006846 Ga0075430_100077570 Ga0075430_1000775705 109
121 3300006846 Ga0075430_100294755 Ga0075430_1002947551 109
122 3300006847 Ga0075431_100008077 Ga0075431_1000080775 109
123 3300006852 Ga0075433_10412973 Ga0075433_104129731 109
124 3300006852 Ga0075433_10450125 Ga0075433_104501252 109
125 3300006871 Ga0075434_100122627 Ga0075434_1001226272 109
126 3300006871 Ga0075434_100915626 Ga0075434_1009156262 109
127 3300006880 Ga0075429_100047436 Ga0075429_1000474365 109
128 3300006880 Ga0075429_100176581 Ga0075429_1001765814 109
129 3300006880 Ga0075429_100958908 Ga0075429_1009589082 109
130 3300006881 Ga0068865_100342270 Ga0068865_1003422702 109
131 3300006881 Ga0068865_100516032 Ga0068865_1005160321 109
132 3300006914 Ga0075436_100023429 Ga0075436_1000234296 109
133 3300006914 Ga0075436_100089914 Ga0075436_1000899144 109
134 3300006931 Ga0097620_100033203 Ga0097620_1000332035 109
135 3300006931 Ga0097620_100091301 Ga0097620_1000913012 109
136 3300009093 Ga0105240_10526671 Ga0105240_105266712 109
137 3300009094 Ga0111539_10004603 Ga0111539_100046038 109
138 3300009094 Ga0111539_10219600 Ga0111539_102196002 109
139 3300009094 Ga0111539_11628942 Ga0111539_116289422 109
140 3300009094 Ga0111539_11717986 Ga0111539_117179862 109
141 3300009094 Ga0111539_12017738 Ga0111539_120177382 109
142 3300009101 Ga0105247_10005669 Ga0105247_100056693 109
143 3300009147 Ga0114129_10005499 Ga0114129_1000549918 109
144 3300009147 Ga0114129_10017513 Ga0114129_100175137 109
145 3300009147 Ga0114129_10138609 Ga0114129_101386092 109
146 3300009147 Ga0114129_10184570 Ga0114129_101845703 109
147 3300009147 Ga0114129_11064119 Ga0114129_110641192 109
148 3300009148 Ga0105243_10074573 Ga0105243_100745734 109
149 3300009176 Ga0105242_12117518 Ga0105242_121175182 109
150 3300009176 Ga0105242_12992658 Ga0105242_129926581 109
151 3300009177 Ga0105248_10100286 Ga0105248_101002862 109
152 3300009553 Ga0105249_10002720 Ga0105249_100027201 109
153 3300011119 Ga0105246_10955309 Ga0105246_109553091 109
154 3300013296 Ga0157374_10293058 Ga0157374_102930583 109
155 3300013296 Ga0157374_11114373 Ga0157374_111143731 109
156 3300013297 Ga0157378_10712128 Ga0157378_107121282 109
157 3300013306 Ga0163162_10235679 Ga0163162_102356792 109
158 3300013306 Ga0163162_12579233 Ga0163162_125792332 109
159 3300013308 Ga0157375_10125116 Ga0157375_101251164 109
160 3300013308 Ga0157375_10254312 Ga0157375_102543122 109
161 3300013308 Ga0157375_10553245 Ga0157375_105532452 109
162 3300013308 Ga0157375_12069111 Ga0157375_120691111 109
163 3300014326 Ga0157380_10172009 Ga0157380_101720092 109
164 3300014326 Ga0157380_11054641 Ga0157380_110546412 109
165 3300014745 Ga0157377_10073892 Ga0157377_100738923 109
166 3300014745 Ga0157377_10624274 Ga0157377_106242742 109
167 3300014968 Ga0157379_10017793 Ga0157379_100177932 109
168 3300014968 Ga0157379_10037620 Ga0157379_100376202 109
169 3300014969 Ga0157376_10167647 Ga0157376_101676472 109
170 3300014969 Ga0157376_10510839 Ga0157376_105108392 109
171 3300025271 Ga0207666_1054225 Ga0207666_10542252 109
172 3300025315 Ga0207697_10184569 Ga0207697_101845692 109
173 3300025315 Ga0207697_10308031 Ga0207697_103080311 109
174 3300025885 Ga0207653_10192273 Ga0207653_101922732 109
175 3300025893 Ga0207682_10159007 Ga0207682_101590072 109
176 3300025900 Ga0207710_10195656 Ga0207710_101956561 109
177 3300025901 Ga0207688_10045351 Ga0207688_100453514 109
178 3300025901 Ga0207688_10344382 Ga0207688_103443822 109
179 3300025907 Ga0207645_11138778 Ga0207645_111387781 109
180 3300025908 Ga0207643_10002617 Ga0207643_100026174 109
181 3300025908 Ga0207643_10048192 Ga0207643_100481922 109
182 3300025917 Ga0207660_10280139 Ga0207660_102801392 109
183 3300025918 Ga0207662_10004260 Ga0207662_100042604 109
184 3300025919 Ga0207657_10081086 Ga0207657_100810862 109
185 3300025919 Ga0207657_11247724 Ga0207657_112477241 109
186 3300025922 Ga0207646_10130987 Ga0207646_101309872 109
187 3300025922 Ga0207646_10392320 Ga0207646_103923202 109
188 3300025923 Ga0207681_10023676 Ga0207681_100236765 109
189 3300025925 Ga0207650_10105281 Ga0207650_101052813 109
190 3300025926 Ga0207659_10002232 Ga0207659_100022328 109
191 3300025926 Ga0207659_10051204 Ga0207659_100512042 109
192 3300025933 Ga0207706_10022095 Ga0207706_100220955 109
193 3300025933 Ga0207706_10173366 Ga0207706_101733662 109
194 3300025933 Ga0207706_10808615 Ga0207706_108086152 109
195 3300025935 Ga0207709_10041662 Ga0207709_100416622 109
196 3300025936 Ga0207670_10029889 Ga0207670_100298894 109
197 3300025936 Ga0207670_10054870 Ga0207670_100548704 109
198 3300025937 Ga0207669_11425675 Ga0207669_114256751 109
199 3300025938 Ga0207704_10308293 Ga0207704_103082932 109
200 3300025938 Ga0207704_10984964 Ga0207704_109849641 109
201 3300025940 Ga0207691_10133391 Ga0207691_101333911 109
202 3300025940 Ga0207691_10202165 Ga0207691_102021651 109
203 3300025940 Ga0207691_10227251 Ga0207691_102272512 109
204 3300025941 Ga0207711_10041043 Ga0207711_100410432 109
205 3300025941 Ga0207711_10136774 Ga0207711_101367742 109
206 3300025941 Ga0207711_10906379 Ga0207711_109063792 109
207 3300025942 Ga0207689_10180034 Ga0207689_101800342 109
208 3300025942 Ga0207689_10198425 Ga0207689_101984252 109
209 3300025942 Ga0207689_10272812 Ga0207689_102728122 109
210 3300025942 Ga0207689_10372201 Ga0207689_103722012 109
211 3300025945 Ga0207679_10014980 Ga0207679_100149802 109
212 3300025945 Ga0207679_11220905 Ga0207679_112209052 109
213 3300025960 Ga0207651_10037135 Ga0207651_100371352 109
214 3300025960 Ga0207651_10096640 Ga0207651_100966402 109
215 3300025961 Ga0207712_10004553 Ga0207712_100045531 109
216 3300025972 Ga0207668_10031801 Ga0207668_100318013 109
217 3300025972 Ga0207668_10667744 Ga0207668_106677442 109
218 3300025981 Ga0207640_10483135 Ga0207640_104831352 109
219 3300025986 Ga0207658_10113049 Ga0207658_101130493 109
220 3300026035 Ga0207703_10044054 Ga0207703_100440545 109
221 3300026035 Ga0207703_10050779 Ga0207703_100507793 109
222 3300026035 Ga0207703_12244438 Ga0207703_122444381 109
223 3300026075 Ga0207708_10050120 Ga0207708_100501203 109
224 3300026075 Ga0207708_10215322 Ga0207708_102153221 109
225 3300026075 Ga0207708_10366046 Ga0207708_103660462 109
226 3300026088 Ga0207641_11712770 Ga0207641_117127702 109
227 3300026089 Ga0207648_10001634 Ga0207648_1000163410 109
228 3300026089 Ga0207648_10208667 Ga0207648_102086672 109
229 3300026089 Ga0207648_10568578 Ga0207648_105685781 109
230 3300026095 Ga0207676_10117089 Ga0207676_101170892 109
231 3300026095 Ga0207676_10262797 Ga0207676_102627973 109
232 3300026095 Ga0207676_11979601 Ga0207676_119796011 109
233 3300026116 Ga0207674_10122456 Ga0207674_101224564 109
234 3300026116 Ga0207674_10160616 Ga0207674_101606162 109
235 3300026116 Ga0207674_10233445 Ga0207674_102334452 109
236 3300026116 Ga0207674_11957473 Ga0207674_119574731 109
237 3300026118 Ga0207675_100008997 Ga0207675_1000089976 109
238 3300026118 Ga0207675_100150712 Ga0207675_1001507122 109
239 3300026121 Ga0207683_10961055 Ga0207683_109610551 109
240 3300026142 Ga0207698_11050214 Ga0207698_110502142 109
241 3300026142 Ga0207698_11690036 Ga0207698_116900362 109
242 3300027617 Ga0210002_1020541 Ga0210002_10205411 109
243 3300027876 Ga0209974_10420137 Ga0209974_104201371 109
244 3300027907 Ga0207428_10010852 Ga0207428_100108525 109
245 3300027907 Ga0207428_10301741 Ga0207428_103017412 109
246 3300028379 Ga0268266_10011453 Ga0268266_100114536 109
247 3300028379 Ga0268266_10660299 Ga0268266_106602992 109
248 3300028380 Ga0268265_10000545 Ga0268265_1000054510 109
249 3300028380 Ga0268265_10733871 Ga0268265_107338712 109
250 3300028381 Ga0268264_10012043 Ga0268264_100120433 109
251 3300028381 Ga0268264_10709437 Ga0268264_107094372 109
252 3300031548 Ga0307408_100872235 Ga0307408_1008722352 109
253 3300031731 Ga0307405_11426836 Ga0307405_114268361 109
254 3300031824 Ga0307413_10532783 Ga0307413_105327832 109
255 3300032002 Ga0307416_100588587 Ga0307416_1005885872 109
256 3300032002 Ga0307416_101771919 Ga0307416_1017719191 109
257 3300032002 Ga0307416_102950523 Ga0307416_1029505231 109
258 3300035090 Ga0373949_0010153 Ga0373949_0010153_653_985 109
259 3300035092 Ga0373952_0190289 Ga0373952_0190289_114_446 109
260 3300035117 Ga0373953_0197645 Ga0373953_0197645_183_527 109
261 3300035120 Ga0373957_0035123 Ga0373957_0035123_1254_1598 109
262 3300035170 Ga0373943_0118256 Ga0373943_0118256_670_1002 109
263 3300035172 Ga0373955_0169404 Ga0373955_0169404_439_783 109
264 3300035172 Ga0373955_0661483 Ga0373955_0661483_165_509 109
265 3300035241 Ga0373961_0027135 Ga0373961_0027135_1036_1368 109
266 3300035242 Ga0373962_0033291 Ga0373962_0033291_418_750 109
267 3300035691 Ga0373931_0171691 Ga0373931_0171691_908_1240 109
268 3300035692 Ga0373935_0451216 Ga0373935_0451216_206_550 109
269 3300035725 Ga0373947_0272497 Ga0373947_0272497_511_843 109
270 3300035725 Ga0373947_0466497 Ga0373947_0466497_151_483 109
271 3300036401 Ga0373937_0169221 Ga0373937_0169221_1403_1735 109
272 3300041408 Ga0439453_0055093 Ga0439453_0055093_221_553 109
273 3300042137 Ga0450902_040374 Ga0450902_040374_206_538 109
274 3300042436 Ga0439435_0015658 Ga0439435_0015658_1177_1509 109
275 3300042436 Ga0439435_0106192 Ga0439435_0106192_127_459 109
276 3300042437 Ga0439444_0040274 Ga0439444_0040274_253_588 109
277 3300042461 Ga0439460_0074798 Ga0439460_0074798_80_415 109
278 3300044673 Ga0453683_0201744 Ga0453683_0201744_65_397 109
279 3300045051 Ga0451576_1027168 Ga0451576_1027168_224_556 109
280 3300045976 Ga0466967_0524384 Ga0466967_0524384_653_988 109
281 3300046459 Ga0495629_0471290 Ga0495629_0471290_185_517 109
282 3300046462 Ga0495651_0568552 Ga0495651_0568552_185_529 109
283 3300046475 Ga0495639_0749295 Ga0495639_0749295_56_400 109
284 3300046476 Ga0495662_0133729 Ga0495662_0133729_186_530 109
285 3300046492 Ga0495585_0144692 Ga0495585_0144692_616_948 109
286 3300046517 Ga0495630_0203779 Ga0495630_0203779_1000_1344 109
287 3300046528 Ga0495642_0104281 Ga0495642_0104281_513_845 109
288 3300046533 Ga0495640_0071568 Ga0495640_0071568_623_967 109
289 3300046535 Ga0495586_0097918 Ga0495586_0097918_655_999 109
290 3300046536 Ga0495587_0156408 Ga0495587_0156408_745_1089 109
291 3300046536 Ga0495587_0714197 Ga0495587_0714197_199_531 109
292 3300046539 Ga0495621_0025113 Ga0495621_0025113_839_1171 109
293 3300046543 Ga0495645_0001662 Ga0495645_0001662_2119_2463 109
294 3300046558 Ga0495633_0274771 Ga0495633_0274771_62_394 109
295 3300046559 Ga0495667_0166682 Ga0495667_0166682_1011_1355 109
296 3300046663 Ga0495635_0902131 Ga0495635_0902131_86_430 109
297 3300046664 Ga0495659_0014806 Ga0495659_0014806_1353_1697 109
298 3300046664 Ga0495659_0016072 Ga0495659_0016072_1355_1687 109
299 3300046664 Ga0495659_0089961 Ga0495659_0089961_226_558 109
300 3300046664 Ga0495659_0196356 Ga0495659_0196356_238_570 109
301 3300046675 Ga0495657_0475359 Ga0495657_0475359_320_664 109
302 3300046683 Ga0495658_0041255 Ga0495658_0041255_950_1294 109
303 3300046683 Ga0495658_0399871 Ga0495658_0399871_97_429 109
304 3300046683 Ga0495658_0490769 Ga0495658_0490769_94_426 109
305 3300046689 Ga0495613_0120066 Ga0495613_0120066_181_525 109
306 3300046691 Ga0495670_0027259 Ga0495670_0027259_1513_1845 109
307 3300046691 Ga0495670_0200031 Ga0495670_0200031_274_618 109
308 3300046809 Ga0495600_0124133 Ga0495600_0124133_1021_1365 109
309 3300046809 Ga0495600_0659948 Ga0495600_0659948_65_409 109
310 3300047318 Ga0495636_0263002 Ga0495636_0263002_142_474 109
311 3300047322 Ga0495680_0061812 Ga0495680_0061812_1932_2276 109
312 3300047445 Ga0495677_0186417 Ga0495677_0186417_161_493 109
313 3300047471 Ga0495684_0094039 Ga0495684_0094039_1782_2126 109
314 3300048088 Ga0495602_0856605 Ga0495602_0856605_189_521 109
315 3300048903 Ga0496100_0978049 Ga0496100_0978049_310_642 109
316 3300048907 Ga0496104_0275940 Ga0496104_0275940_1149_1493 109
317 3300048909 Ga0496106_0194792 Ga0496106_0194792_428_760 109
318 3300048910 Ga0496107_0731254 Ga0496107_0731254_55_387 109
319 3300048915 Ga0496112_0224919 Ga0496112_0224919_378_710 109
320 3300048917 Ga0496114_1018421 Ga0496114_1018421_339_683 109
321 3300049571 Ga0501034_0146441 Ga0501034_0146441_439_771 109
322 3300049576 Ga0501040_1412297 Ga0501040_1412297_72_404 109
323 3300049581 Ga0501047_0281736 Ga0501047_0281736_778_1110 109
324 3300049582 Ga0501048_1045647 Ga0501048_1045647_149_517 109
325 3300049588 Ga0501072_0915626 Ga0501072_0915626_139_477 109
326 3300049664 Ga0501224_057540 Ga0501224_057540_237_569 109
327 3300049741 Ga0501079_0503870 Ga0501079_0503870_557_892 109
328 3300049742 Ga0501080_1117650 Ga0501080_1117650_41_373 109
329 3300050507 nmdc:mga05p37_112984_c1 nmdc:mga05p37_112984_c1_55_387 109
330 3300050507 nmdc:mga05p37_179107_c1 nmdc:mga05p37_179107_c1_1691_2023 109
331 3300050507 nmdc:mga05p37_43533_c1 nmdc:mga05p37_43533_c1_2705_3046 109
332 3300050507 nmdc:mga05p37_898405_c1 nmdc:mga05p37_898405_c1_320_652 109
333 3300050507 nmdc:mga05p37_955_c1 nmdc:mga05p37_955_c1_7380_7712 109
334 3300050508 nmdc:mga09592_132677_c1 nmdc:mga09592_132677_c1_1785_2117 109
335 3300050508 nmdc:mga09592_132834_c1 nmdc:mga09592_132834_c1_331_663 109
336 3300050508 nmdc:mga09592_263408_c1 nmdc:mga09592_263408_c1_602_934 109
337 3300050509 nmdc:mga0qj67_28001_c1 nmdc:mga0qj67_28001_c1_411_743 109
338 3300050509 nmdc:mga0qj67_57566_c1 nmdc:mga0qj67_57566_c1_1728_2060 109
339 3300050510 nmdc:mga06r32_44562_c1 nmdc:mga06r32_44562_c1_1949_2281 109
340 3300050511 nmdc:mga08y16_1027944_c1 nmdc:mga08y16_1027944_c1_223_555 109
341 3300050511 nmdc:mga08y16_1945103_c1 nmdc:mga08y16_1945103_c1_111_443 109
342 3300050511 nmdc:mga08y16_258692_c1 nmdc:mga08y16_258692_c1_585_917 109
343 3300050511 nmdc:mga08y16_83271_c1 nmdc:mga08y16_83271_c1_675_1007 109
344 3300050512 nmdc:mga0n895_100808_c1 nmdc:mga0n895_100808_c1_1381_1713 109
345 3300050512 nmdc:mga0n895_1089290_c1 nmdc:mga0n895_1089290_c1_203_544 109
346 3300050512 nmdc:mga0n895_1864016_c1 nmdc:mga0n895_1864016_c1_145_486 109
347 3300050514 nmdc:mga08x19_14097_c1 nmdc:mga08x19_14097_c1_654_986 109
348 3300050514 nmdc:mga08x19_249637_c1 nmdc:mga08x19_249637_c1_879_1211 109
349 3300050514 nmdc:mga08x19_319640_c1 nmdc:mga08x19_319640_c1_262_594 109
350 3300050515 nmdc:mga0a205_59063_c1 nmdc:mga0a205_59063_c1_822_1154 109
351 3300053084 Ga0495595_0036792 Ga0495595_0036792_1421_1765 109
352 3300053085 Ga0495619_0173773 Ga0495619_0173773_226_558 109
353 3300053085 Ga0495619_0265741 Ga0495619_0265741_174_506 109
354 3300053085 Ga0495619_0561912 Ga0495619_0561912_24_368 109
355 3300060353 Ga0501082_0490101 Ga0501082_0490101_197_529 109
356 3300061734 Ga0530510_0947770 Ga0530510_0947770_76_414 109
357 3300006844 Ga0075428_100517678 Ga0075428_1005176781 110
358 3300009094 Ga0111539_10944338 Ga0111539_109443381 110
359 3300044683 Ga0466965_0007025 Ga0466965_0007025_3984_4331 110
360 3300044901 Ga0466960_0013639 Ga0466960_0013639_1507_1854 110
361 3300049572 Ga0501036_0866385 Ga0501036_0866385_119_472 110
362 3300049576 Ga0501040_1429059 Ga0501040_1429059_110_463 110
363 3300049577 Ga0501041_0381309 Ga0501041_0381309_301_654 110
364 3300049590 Ga0501074_0285519 Ga0501074_0285519_509_862 110
365 3300049743 Ga0501081_0216890 Ga0501081_0216890_852_1205 110
366 3300061734 Ga0530510_1105788 Ga0530510_1105788_163_516 110
367 3300009094 Ga0111539_13019964 Ga0111539_130199641 111
368 3300009147 Ga0114129_10851729 Ga0114129_108517291 111
369 3300031731 Ga0307405_11904095 Ga0307405_119040951 111
370 3300031824 Ga0307413_11562183 Ga0307413_115621831 111
371 3300031889 Ga0326468_10002484 Ga0326468_100024842 111
372 3300032004 Ga0307414_11144024 Ga0307414_111440242 111
373 3300050507 nmdc:mga05p37_2275580_c1 nmdc:mga05p37_2275580_c1_129_473 111
374 3300005471 Ga0070698_100140309 Ga0070698_1001403092 113
375 3300021377 Ga0213874_10226051 Ga0213874_102260511 114
376 3300039450 Ga0436363_1333010 Ga0436363_1333010_131_481 114
377 3300053178 Ga0500637_0017328 Ga0500637_0017328_2599_2949 114
378 3300031995 Ga0307409_102107274 Ga0307409_1021072742 115
379 3300005290 Ga0065712_10205465 Ga0065712_102054653 116
380 3300005295 Ga0065707_10657255 Ga0065707_106572551 116
381 3300005345 Ga0070692_10727021 Ga0070692_107270212 116
382 3300005354 Ga0070675_101094585 Ga0070675_1010945852 116
383 3300005547 Ga0070693_101247601 Ga0070693_1012476011 116
384 3300009174 Ga0105241_10808186 Ga0105241_108081861 116
385 3300009551 Ga0105238_10937102 Ga0105238_109371022 116
386 3300031731 Ga0307405_10487055 Ga0307405_104870552 116
387 3300031852 Ga0307410_10226286 Ga0307410_102262862 116
388 3300031903 Ga0307407_10860757 Ga0307407_108607571 116
389 3300031995 Ga0307409_101016222 Ga0307409_1010162222 116
390 3300032004 Ga0307414_10765005 Ga0307414_107650052 116
391 3300032005 Ga0307411_10263796 Ga0307411_102637962 116
392 3300049583 Ga0501067_0117770 Ga0501067_0117770_997_1353 116
393 3300003503 JGI26141J51220_1001229 JGI26141J51220_10012293 117
394 3300005444 Ga0070694_100004094 Ga0070694_1000040943 117
395 3300005457 Ga0070662_100539847 Ga0070662_1005398472 117
396 3300005545 Ga0070695_100000877 Ga0070695_1000008773 117
397 3300013102 Ga0157371_10045930 Ga0157371_100459303 117
398 3300013307 Ga0157372_10061735 Ga0157372_100617352 117
399 3300027252 Ga0209973_1077416 Ga0209973_10774161 117
400 3300027360 Ga0209969_1008293 Ga0209969_10082933 117
401 3300027364 Ga0209967_1002019 Ga0209967_10020192 117
402 3300027395 Ga0209996_1005171 Ga0209996_10051713 117
403 3300027462 Ga0210000_1002183 Ga0210000_10021832 117
404 3300027471 Ga0209995_1003068 Ga0209995_10030683 117
405 3300027526 Ga0209968_1003380 Ga0209968_10033804 117
406 3300027543 Ga0209999_1024122 Ga0209999_10241222 117
407 3300027552 Ga0209982_1037926 Ga0209982_10379261 117
408 3300027617 Ga0210002_1019160 Ga0210002_10191602 117
409 3300027682 Ga0209971_1000004 Ga0209971_1000004108 117
410 3300027695 Ga0209966_1000230 Ga0209966_100023017 117
411 3300027717 Ga0209998_10000022 Ga0209998_1000002267 117
412 3300027876 Ga0209974_10006713 Ga0209974_100067132 117
413 3300045051 Ga0451576_0067982 Ga0451576_0067982_1091_1444 117
414 3300049568 Ga0501031_0186159 Ga0501031_0186159_363_716 117
415 3300049570 Ga0501033_0467079 Ga0501033_0467079_387_740 117
416 3300049574 Ga0501038_0161081 Ga0501038_0161081_1460_1813 117
417 3300049575 Ga0501039_0064457 Ga0501039_0064457_83_436 117
418 3300049576 Ga0501040_0033517 Ga0501040_0033517_1216_1569 117
419 3300049578 Ga0501042_0053284 Ga0501042_0053284_2463_2816 117
420 3300049579 Ga0501043_0029652 Ga0501043_0029652_2941_3294 117
421 3300049580 Ga0501046_0002578 Ga0501046_0002578_13878_14231 117
422 3300049584 Ga0501068_0081547 Ga0501068_0081547_1084_1437 117
423 3300049587 Ga0501071_0048492 Ga0501071_0048492_881_1234 117
424 3300049588 Ga0501072_0164281 Ga0501072_0164281_687_1040 117
425 3300049589 Ga0501073_0153496 Ga0501073_0153496_847_1200 117
426 3300049590 Ga0501074_0013238 Ga0501074_0013238_701_1054 117
427 3300049592 Ga0501076_0126246 Ga0501076_0126246_73_426 117
428 3300049593 Ga0501077_0052880 Ga0501077_0052880_1416_1769 117
429 3300049741 Ga0501079_0005134 Ga0501079_0005134_6008_6361 117
430 3300049742 Ga0501080_0136373 Ga0501080_0136373_1662_2015 117
431 3300049743 Ga0501081_0166459 Ga0501081_0166459_131_484 117
432 3300049744 Ga0501083_0079790 Ga0501083_0079790_403_756 117
433 3300049824 Ga0501045_0003036 Ga0501045_0003036_2266_2619 117
434 3300054114 Ga0501084_0001571 Ga0501084_0001571_8688_9041 117
435 3300060353 Ga0501082_0002951 Ga0501082_0002951_5451_5804 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

116

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9652 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9334 1 114
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.7679 1 115
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7582 1 115
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7369 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9652 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9334 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8137 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7606 1 115 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7497 1 115 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A839F0G6-F1-model_v4 YCII-related domain-containing protein 0.9945 1 115
AF-A0A1I4LL40-F1-model_v4 Uncharacterized conserved protein 0.9942 1 117
AF-A0A839EQ41-F1-model_v4 YCII-related domain-containing protein 0.9926 2 115
AF-A0A2K8YQV3-F1-model_v4 deleted 0.9925 1 117
AF-A0A7G6SSK5-F1-model_v4 YciI family protein 0.992 1 115

Feature Viewer

pLDDT pTM Quality
92.19 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map