F443293

General Info

Members Datasets Scaffolds Average Seq Length
435 301 868 310

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10000126|Ga0075364_1000012616
Length 370
Sequence VGAVVEIGVHRIRESHNRKSHGNRCIRSLEKHFAHHKAFARLALNRSRQTKTVEEKHVKKHLIMAAFASFLATSASAQTIGVSMALFDDNFLTVLRNGMVDYSKGLDGVTLQIEDAQNDVGKQLSQVQNFVASGVDAIIVNPVDTDATTALSQAAAAAGIPLVYVNRQPVNVDALPEKQAFVASDEKQSGTLQTQEVCRILKEAGKKEANAVVMMGELSNQAARMRTQDIKDVIATPDCSFMKIVEEQTANWSRTQGADLMTNWLSAGVKFDAVISNNDEMAIGAIQALKSSGRAMDDVIVAGIDATQDALASMASGDLDVSVFQNAAGQGKGAVDAAIRIAKGETIEKKVYVPFELVTPANLKTYQAKN

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
97 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
135 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
144 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
145 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
146 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
154 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
158 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
161 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
162 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
163 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
164 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
165 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
166 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
167 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
168 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
169 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
170 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
171 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
172 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
173 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
174 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
175 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
176 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
177 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
178 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
179 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
180 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
181 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
182 2643221582 Rhizobium sp. Root651 Isolate Unclassified
183 2643221607 Rhizobium sp. Root73 Isolate Unclassified
184 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
185 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
186 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
187 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
188 2643221693 Rhizobium sp. Root491 Isolate Unclassified
189 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
190 2718217927 Rhizobium sp. N324 Isolate Nodule
191 2718218423 Rhizobium sp. N941 Isolate Nodule
192 2721755809 Rhizobium sp. N541 Isolate Nodule
193 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
194 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
195 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
196 2791355261 Rhizobium sp. J15 Isolate Nodule
197 2791355263 Rhizobium chutanense C5 Isolate Nodule
198 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
199 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
200 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
201 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
202 2838061910 Rhizobium phaseoli L15 Isolate Nodule
203 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
204 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
205 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
206 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
207 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
208 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
209 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
210 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
211 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
212 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
213 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
214 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
215 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
216 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
217 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
218 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
219 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
220 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
221 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
222 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
223 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
224 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
225 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
226 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
227 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
228 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
229 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
230 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
231 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
232 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
233 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
234 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
235 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
236 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
237 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
238 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
239 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
240 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
241 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
242 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
243 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
244 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
245 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
246 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
247 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
248 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
249 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
250 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
251 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
252 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
253 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
254 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
255 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
256 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
257 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
258 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
259 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
260 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
261 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
262 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
263 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
264 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
265 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
266 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
267 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
268 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
269 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
270 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
271 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
272 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
273 2936381700 Rhizobium chutanense C16 Isolate Unclassified
274 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
275 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
276 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
277 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
278 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
279 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
280 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
281 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
282 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
283 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
284 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
285 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
286 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
287 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
288 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
289 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
290 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
291 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
292 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
293 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
294 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
295 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
296 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
297 8005275841 Rhizobium sp. N4311 Isolate Nodule
298 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
299 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
300 8018176218 Rhizobium sp. N122 Isolate Nodule
301 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 57.93
Metatranscriptomes 0.69
Isolates 41.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.92
Bulb 0
Endosphere 16.09
Nodule 22.53
Rhizoplane 2.99
Rhizosphere 34.48
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10000126 3300006051 Bacteria 31821
2 JGI24737J22298_10025172 3300001990 Bacteria 1882
3 JGI25162J39368_1000207 3300002737 Bacteria 62123
4 JGI25151J46595_10010471 3300003187 Bacteria 4307
5 JGI25151J46595_10014546 3300003187 Bacteria 3502
6 JGI25165J46597_1000708 3300003214 Bacteria 26335
7 JGI25165J46597_1002799 3300003214 Bacteria 5052
8 rootH1_10022539 3300003316 Bacteria 1485
9 Ga0006562J51391_1020161 3300003578 Bacteria 2401
10 Ga0055524_1004341 3300003775 Bacteria 6560
11 Ga0055528_1000433 3300003790 Bacteria 33610
12 Ga0055528_1001141 3300003790 Bacteria 17268
13 Ga0055528_1002932 3300003790 Bacteria 8846
14 Ga0058692_1000771 3300003856 Bacteria 12866
15 Ga0058692_1007808 3300003856 Bacteria 2806
16 Ga0065704_10163536 3300005289 Bacteria 1338
17 Ga0070658_10022529 3300005327 Bacteria 5055
18 Ga0070676_10026238 3300005328 Bacteria 3298
19 Ga0070660_100007424 3300005339 Bacteria 7639
20 Ga0070668_100164544 3300005347 Bacteria 1802
21 Ga0070669_100192424 3300005353 Bacteria 1601
22 Ga0070674_100024976 3300005356 Bacteria 3882
23 Ga0070673_100146666 3300005364 Bacteria 1995
24 Ga0070662_100314493 3300005457 Bacteria 1275
25 Ga0068853_100184807 3300005539 Bacteria 1891
26 Ga0070672_100203077 3300005543 Bacteria 1658
27 Ga0070686_100052493 3300005544 Bacteria 2600
28 Ga0070665_100009919 3300005548 Bacteria 9633
29 Ga0070665_100010410 3300005548 Bacteria 9411
30 Ga0070665_100172678 3300005548 Bacteria 2162
31 Ga0068855_100052175 3300005563 Bacteria 4815
32 Ga0068854_100148515 3300005578 Bacteria 1805
33 Ga0068856_100027277 3300005614 Bacteria 5572
34 Ga0081540_1004077 3300005983 Bacteria 11309
35 Ga0081540_1055519 3300005983 Bacteria 1929
36 Ga0075365_10130325 3300006038 Bacteria 1740
37 Ga0075368_10026840 3300006042 Bacteria 2217
38 Ga0075368_10037305 3300006042 Bacteria 1900
39 Ga0075368_10047507 3300006042 Bacteria 1699
40 Ga0075363_100024117 3300006048 Bacteria 3090
41 Ga0075363_100026368 3300006048 Bacteria 2973
42 Ga0075363_100040160 3300006048 Bacteria 2466
43 Ga0075364_10017950 3300006051 Bacteria 4425
44 Ga0075362_10008228 3300006177 Bacteria 3982
45 Ga0075367_10097285 3300006178 Bacteria 1795
46 Ga0075367_10098097 3300006178 Bacteria 1788
47 Ga0068871_100213028 3300006358 Bacteria 1671
48 Ga0099826_10000328 3300006948 Bacteria 21645
49 Ga0099826_10004678 3300006948 Bacteria 9640
50 Ga0099826_10058078 3300006948 Bacteria 2540
51 Ga0105240_10000013 3300009093 Bacteria 483458
52 Ga0105240_10040055 3300009093 Bacteria 5997
53 Ga0111539_10000167 3300009094 Bacteria 75742
54 Ga0105243_10006468 3300009148 Bacteria 9061
55 Ga0105243_10125179 3300009148 Bacteria 2173
56 Ga0105237_10004144 3300009545 Bacteria 16891
57 Ga0105239_10006528 3300010375 Bacteria 13515
58 Ga0105246_10027492 3300011119 Bacteria 3728
59 Ga0105246_10047710 3300011119 Bacteria 2926
60 Ga0157373_10003911 3300013100 Bacteria 11245
61 Ga0157373_10010979 3300013100 Bacteria 6668
62 Ga0157371_10000002 3300013102 Bacteria 665040
63 Ga0157371_10000005 3300013102 Bacteria 416456
64 Ga0157370_10000036 3300013104 Bacteria 136933
65 Ga0157370_10000269 3300013104 Bacteria 65839
66 Ga0157370_10000836 3300013104 Bacteria 39048
67 Ga0157370_10253927 3300013104 Bacteria 1626
68 Ga0157378_10115160 3300013297 Bacteria 2470
69 Ga0182008_10108424 3300014497 Bacteria 1375
70 Ga0157379_10194262 3300014968 Bacteria 1834
71 Ga0182007_10001753 3300015262 Bacteria 11410
72 Ga0182005_1003219 3300015265 Bacteria 5585
73 Ga0209672_100019 3300025228 Bacteria 432215
74 Ga0209437_100204 3300025233 Bacteria 115781
75 Ga0209646_1003871 3300025246 Bacteria 2850
76 Ga0209677_100682 3300025253 Bacteria 17454
77 Ga0209233_1000280 3300025261 Bacteria 70793
78 Ga0209233_1000388 3300025261 Bacteria 37536
79 Ga0209673_1000033 3300025273 Bacteria 335369
80 Ga0209676_1012671 3300025292 Bacteria 3290
81 Ga0209025_1000545 3300025294 Bacteria 70608
82 Ga0209025_1001212 3300025294 Bacteria 36123
83 Ga0209025_1011660 3300025294 Bacteria 5756
84 Ga0209025_1022155 3300025294 Bacteria 3384
85 Ga0209758_1024432 3300025297 Bacteria 2693
86 Ga0209256_1000563 3300025299 Bacteria 53065
87 Ga0207645_10026019 3300025907 Bacteria 3784
88 Ga0207705_10019453 3300025909 Bacteria 4856
89 Ga0207695_10000044 3300025913 Bacteria 440819
90 Ga0207695_10035204 3300025913 Bacteria 5434
91 Ga0207671_10000043 3300025914 Bacteria 206915
92 Ga0207649_10045922 3300025920 Bacteria 2680
93 Ga0207681_10080274 3300025923 Bacteria 2301
94 Ga0207690_10038375 3300025932 Bacteria 3117
95 Ga0207709_10072705 3300025935 Bacteria 2188
96 Ga0207709_10105212 3300025935 Bacteria 1875
97 Ga0207669_10101359 3300025937 Bacteria 1904
98 Ga0207667_10173831 3300025949 Bacteria 2213
99 Ga0207667_10618573 3300025949 Bacteria 1091
100 Ga0207651_10233282 3300025960 Bacteria 1495
101 Ga0207640_10009959 3300025981 Bacteria 5339
102 Ga0207640_10340892 3300025981 Bacteria 1200
103 Ga0207677_10128969 3300026023 Bacteria 1916
104 Ga0207639_10179170 3300026041 Bacteria 1801
105 Ga0207648_10058818 3300026089 Bacteria 3351
106 Ga0207674_10031245 3300026116 Bacteria 5594
107 Ga0207698_10198271 3300026142 Bacteria 1795
108 Ga0209371_1000012 3300027312 Bacteria 748304
109 Ga0209371_1004131 3300027312 Bacteria 6512
110 Ga0209282_1000131 3300027666 Bacteria 45265
111 Ga0209813_10006402 3300027866 Bacteria 2907
112 Ga0209813_10032851 3300027866 Bacteria 1540
113 Ga0207428_10000055 3300027907 Bacteria 166460
114 Ga0268266_10008439 3300028379 Bacteria 9159
115 Ga0268266_10009389 3300028379 Bacteria 8618
116 Ga0268266_10020433 3300028379 Bacteria 5644
117 Ga0307515_10000136 3300028794 Bacteria 174265
118 Ga0307515_10023797 3300028794 Bacteria 10710
119 Ga0268256_1000013 3300030500 Bacteria 752103
120 Ga0268256_1014963 3300030500 Bacteria 2281
121 Ga0307513_10000302 3300031456 Bacteria 70793
122 Ga0307509_10120006 3300031507 Bacteria 2609
123 Ga0307408_100026586 3300031548 Bacteria 3978
124 Ga0307508_10217196 3300031616 Bacteria 1512
125 Ga0307409_100174632 3300031995 Bacteria 1895
126 Ga0307414_10252724 3300032004 Bacteria 1466
127 Ga0307411_10065501 3300032005 Bacteria 2437
128 Ga0373938_0012485 3300034957 Bacteria 1595
129 Ga0373931_0131671 3300035691 Bacteria 1440
130 Ga0395900_0189803 3300037418 Bacteria 2085
131 Ga0436360_1262863 3300039438 Bacteria 1463
132 Ga0439436_0012902 3300041404 Bacteria 2532
133 Ga0439465_0005122 3300041413 Bacteria 4206
134 Ga0439465_0043336 3300041413 Bacteria 1460
135 Ga0450906_010260 3300042145 Bacteria 1773
136 Ga0450918_006762 3300042531 Bacteria 2040
137 Ga0495638_0000634 3300046460 Bacteria 38683
138 Ga0495638_0000886 3300046460 Bacteria 30777
139 Ga0495605_0003448 3300046474 Bacteria 9405
140 Ga0495585_0075260 3300046492 Bacteria 1836
141 Ga0495583_0019978 3300046506 Bacteria 3483
142 Ga0495620_0034737 3300046515 Bacteria 2275
143 Ga0495631_0003747 3300046518 Bacteria 8278
144 Ga0495609_0040659 3300046538 Bacteria 2092
145 Ga0495633_0013803 3300046558 Bacteria 4243
146 Ga0495633_0087591 3300046558 Bacteria 1448
147 Ga0495611_0020774 3300046648 Bacteria 2830
148 Ga0495625_0001429 3300046660 Bacteria 29103
149 Ga0495625_0030748 3300046660 Bacteria 4002
150 Ga0495625_0123354 3300046660 Bacteria 1761
151 Ga0495588_0003384 3300046674 Bacteria 6929
152 Ga0495670_0068552 3300046691 Bacteria 1793
153 Ga0495660_0167644 3300046810 Bacteria 1072
154 Ga0495636_0089483 3300047318 Bacteria 1335
155 Ga0495672_0077069 3300047320 Bacteria 1870
156 Ga0495686_0040322 3300047472 Bacteria 2978
157 Ga0496104_0036453 3300048907 Bacteria 4599
158 Ga0496106_0068248 3300048909 Bacteria 2712
159 Ga0496107_0072786 3300048910 Bacteria 2499
160 Ga0496113_0027099 3300048916 Bacteria 4104
161 Ga0496113_0160820 3300048916 Bacteria 1775
162 Ga0496116_0016249 3300048919 Bacteria 5835
163 Ga0496116_0057712 3300048919 Bacteria 2536
164 Ga0496117_0000016 3300048920 Bacteria 523642
165 Ga0496117_0000030 3300048920 Bacteria 389141
166 Ga0496117_0000277 3300048920 Bacteria 95538
167 Ga0496117_0002721 3300048920 Bacteria 21729
168 Ga0496117_0003754 3300048920 Bacteria 17393
169 Ga0496117_0005071 3300048920 Bacteria 14102
170 Ga0496118_0001242 3300048921 Bacteria 39180
171 Ga0496118_0003364 3300048921 Bacteria 20214
172 Ga0496118_0003748 3300048921 Bacteria 18793
173 Ga0496118_0019920 3300048921 Bacteria 5972
174 Ga0496118_0050791 3300048921 Bacteria 3178
175 Ga0496119_0137538 3300048922 Bacteria 1323
176 Ga0496120_0000772 3300048923 Bacteria 46288
177 Ga0496120_0003367 3300048923 Bacteria 14658
178 Ga0496121_0000005 3300048924 Bacteria 1034486
179 Ga0496121_0003679 3300048924 Bacteria 21530
180 Ga0496121_0196855 3300048924 Bacteria 1440
181 Ga0496122_0000002 3300048925 Bacteria 905834
182 Ga0496122_0000050 3300048925 Bacteria 267874
183 Ga0496122_0000072 3300048925 Bacteria 222436
184 Ga0496122_0000193 3300048925 Bacteria 139724
185 Ga0496122_0000414 3300048925 Bacteria 90664
186 Ga0496122_0000809 3300048925 Bacteria 60004
187 Ga0496122_0113995 3300048925 Bacteria 1764
188 Ga0496123_0000002 3300048926 Bacteria 1811682
189 Ga0496123_0000023 3300048926 Bacteria 346894
190 Ga0496123_0000035 3300048926 Bacteria 267288
191 Ga0496123_0000154 3300048926 Bacteria 139724
192 Ga0496123_0000587 3300048926 Bacteria 62043
193 Ga0496123_0000839 3300048926 Bacteria 49128
194 Ga0496124_0000500 3300048927 Bacteria 67401
195 Ga0496124_0002797 3300048927 Bacteria 22104
196 Ga0496124_0004816 3300048927 Bacteria 15536
197 Ga0496124_0008171 3300048927 Bacteria 10979
198 Ga0496124_0019003 3300048927 Bacteria 6414
199 Ga0496124_0049158 3300048927 Bacteria 3599
200 Ga0496124_0090608 3300048927 Bacteria 2494
201 Ga0496125_0000417 3300048928 Bacteria 79282
202 Ga0496125_0002982 3300048928 Bacteria 21249
203 Ga0496125_0003920 3300048928 Bacteria 17561
204 Ga0496125_0022980 3300048928 Bacteria 5775
205 Ga0496125_0048013 3300048928 Bacteria 3564
206 Ga0496125_0246419 3300048928 Bacteria 1130
207 Ga0496126_0000188 3300048929 Bacteria 139625
208 Ga0496126_0000574 3300048929 Bacteria 70089
209 Ga0496126_0001037 3300048929 Bacteria 46997
210 Ga0496126_0118045 3300048929 Bacteria 2303
211 Ga0496126_0121049 3300048929 Bacteria 2269
212 Ga0495682_0051786 3300049460 Bacteria 1493
213 Ga0501034_0085484 3300049571 Bacteria 3156
214 Ga0501039_0071955 3300049575 Bacteria 2687
215 Ga0501039_0319029 3300049575 Bacteria 1222
216 Ga0501069_0175205 3300049585 Bacteria 1239
217 Ga0501044_0175122 3300049823 Bacteria 2115
218 nmdc:mga03683_12203_c1 3300050489 Bacteria 3133
219 nmdc:mga03683_129981_c1 3300050489 Bacteria 1126
220 nmdc:mga03n38_141312_c1 3300050490 Bacteria 1203
221 nmdc:mga00v17_168_c1 3300050491 Bacteria 38334
222 nmdc:mga00v17_34_c1 3300050491 Bacteria 85919
223 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
224 nmdc:mga0yw44_19672_c1 3300050492 Bacteria 3729
225 nmdc:mga0yw44_23546_c1 3300050492 Bacteria 3472
226 nmdc:mga0k408_56128_c1 3300050493 Bacteria 2285
227 nmdc:mga06z11_48091_c1 3300050494 Bacteria 2170
228 nmdc:mga06z11_87551_c1 3300050494 Bacteria 1685
229 nmdc:mga04h51_17847_c1 3300050495 Bacteria 2082
230 nmdc:mga08y16_37_c1 3300050511 Bacteria 150340
231 nmdc:mga0sz30_213_c1 3300050516 Bacteria 21919
232 nmdc:mga0sz30_5540_c1 3300050516 Bacteria 4638
233 Ga0500610_0072706 3300053079 Bacteria 1793
234 Ga0500557_019811 3300053105 Bacteria 1902
235 Ga0500560_002637 3300053107 Bacteria 3474
236 Ga0500572_006065 3300053111 Bacteria 2757
237 Ga0500595_015258 3300053119 Bacteria 2888
238 Ga0500658_0094217 3300053134 Bacteria 1299
239 Ga0500559_0028934 3300053136 Bacteria 2369
240 Ga0500561_0000067 3300053137 Bacteria 20534
241 Ga0500561_0000086 3300053137 Bacteria 18553
242 Ga0500568_0000543 3300053139 Bacteria 27846
243 Ga0500568_0006569 3300053139 Bacteria 5819
244 Ga0500616_0003759 3300053153 Bacteria 11303
245 Ga0500624_000238 3300053157 Bacteria 19610
246 Ga0500624_000964 3300053157 Bacteria 5910
247 Ga0500627_0025352 3300053158 Bacteria 2436
248 Ga0500634_0091328 3300053161 Bacteria 1544
249 Ga0500634_0143397 3300053161 Bacteria 1127
250 Ga0500636_0000205 3300053177 Bacteria 31862
251 Ga0500636_0106029 3300053177 Bacteria 1593
252 Ga0500645_015272 3300053730 Unclassified 2435
253 Ga0587076_025058 3300059645 Bacteria 1017
254 Ga0587111_0007275 3300060346 Bacteria 1793
255 2511390262 2511231027 Bacteria 5013807
256 2513924916 2513237146 Bacteria 7166346
257 2513999029 2513237159 Bacteria 6810126
258 2537873120 2537561587 Bacteria 5425293
259 2537877428 2537561587 Bacteria 5425293
260 2554244466 2554235003 Bacteria 5877155
261 2554245524 2554235003 Bacteria 5877155
262 2559296646 2558860242 Bacteria 5568029
263 2559297688 2558860242 Bacteria 5568029
264 2561467503 2558860983 Bacteria 4133860
265 2585169906 2582581283 Bacteria 6030556
266 2585268754 2582581306 Bacteria 6450535
267 2585279719 2582581308 Bacteria 7413247
268 2585327555 2582581315 Bacteria 7318924
269 2585333903 2582581316 Bacteria 7774528
270 2585389399 2582581865 Bacteria 6644329
271 2585531878 2585427527 Bacteria 7273426
272 2585551175 2585427530 Bacteria 7383882
273 2597810393 2597489875 Bacteria 7010078
274 2599336447 2599185156 Bacteria 5403036
275 2599416477 2599185170 Bacteria 7295545
276 2599602865 2599185210 Bacteria 5624189
277 2599603753 2599185210 Bacteria 5624189
278 2601610472 2600255279 Bacteria 5605316
279 2601612482 2600255279 Bacteria 5605316
280 2601747198 2600255308 Bacteria 5611129
281 2601749023 2600255308 Bacteria 5611129
282 2616306508 2615840626 Bacteria 7921970
283 2643917384 2643221582 Bacteria 5804683
284 2643917483 2643221582 Bacteria 5804683
285 2644051377 2643221607 Bacteria 6314006
286 2644133147 2643221623 Bacteria 5239945
287 2644201048 2643221636 Bacteria 6583769
288 2644484281 2643221686 Bacteria 6310811
289 2644497614 2643221689 Bacteria 6042950
290 2644520774 2643221693 Bacteria 5513853
291 2644522657 2643221693 Bacteria 5513853
292 2692319306 2690316117 Bacteria 6800650
293 2719389267 2718217927 Bacteria 6972593
294 2721402032 2718218423 Bacteria 6438183
295 2724035865 2721755809 Bacteria 6438790
296 2753458976 2751185821 Bacteria 6189929
297 2776910355 2775507049 Bacteria 6284736
298 2778179118 2775507266 Bacteria 7392367
299 2793331575 2791355261 Bacteria 6661293
300 2793344650 2791355263 Bacteria 6872478
301 2808987099 2808606387 Bacteria 5697198
302 2808989199 2808606387 Bacteria 5697198
303 2819560599 2818991439 Bacteria 6907412
304 2819638606 2818991453 Bacteria 7181617
305 2838036593 2838035591 Bacteria 7166484
306 2838064575 2838061910 Bacteria 6794874
307 2838075733 2838074704 Bacteria 6785777
308 2838662409 2838661181 Bacteria 7385261
309 2838677908 2838675328 Bacteria 4909118
310 2838679878 2838675328 Bacteria 4909118
311 2838717186 2838714209 Bacteria 5525906
312 2838717675 2838714209 Bacteria 5525906
313 2838722203 2838719591 Bacteria 5523910
314 2838724449 2838719591 Bacteria 5523910
315 2838727935 2838724970 Bacteria 4908691
316 2838729609 2838724970 Bacteria 4908691
317 2838735659 2838729681 Bacteria 7400765
318 2838748561 2838742623 Bacteria 7396178
319 2841849593 2841846520 Bacteria 5345850
320 2841850048 2841846520 Bacteria 5345850
321 2841854319 2841851746 Bacteria 7532261
322 2841861167 2841859092 Bacteria 5436171
323 2841861367 2841859092 Bacteria 5436171
324 2841862948 2841859092 Bacteria 5436171
325 2842127659 2842124991 Bacteria 5346824
326 2842128520 2842124991 Bacteria 5346824
327 2842132801 2842130223 Bacteria 4909145
328 2842134560 2842130223 Bacteria 4909145
329 2842154794 2842152218 Bacteria 4908957
330 2842156608 2842152218 Bacteria 4908957
331 2842173293 2842170452 Bacteria 5525737
332 2842173920 2842170452 Bacteria 5525737
333 2842178415 2842175837 Bacteria 4908771
334 2842180229 2842175837 Bacteria 4908771
335 2842190294 2842187318 Bacteria 5524014
336 2842192228 2842187318 Bacteria 5524014
337 2842214608 2842211629 Bacteria 5523832
338 2842216492 2842211629 Bacteria 5523832
339 2842227327 2842224351 Bacteria 5524473
340 2842229264 2842224351 Bacteria 5524473
341 2842232829 2842229732 Bacteria 7475766
342 2842246928 2842243621 Bacteria 7421798
343 2842259386 2842257432 Bacteria 7401195
344 2842270071 2842264693 Bacteria 6472963
345 2842433860 2842428310 Bacteria 6767288
346 2842440236 2842434925 Bacteria 6502746
347 2842446975 2842441272 Bacteria 6769273
348 2842474830 2842469257 Bacteria 6752936
349 2842511467 2842509118 Bacteria 6850950
350 2842518366 2842515876 Bacteria 5436280
351 2842518566 2842515876 Bacteria 5436280
352 2842519535 2842515876 Bacteria 5436280
353 2842524773 2842521101 Bacteria 6569494
354 2842872229 2842871566 Bacteria 4827117
355 2842927470 2842922631 Bacteria 5824079
356 2844460768 2844454524 Bacteria 7952546
357 2847422187 2847417321 Bacteria 6913799
358 2847673362 2847670302 Bacteria 6165597
359 2848998314 2848992105 Bacteria 6810864
360 2854898972 2854896431 Bacteria 5869725
361 2855875630 2855872281 Bacteria 6964271
362 2856319169 2856314179 Bacteria 6477897
363 2856342840 2856342000 Bacteria 7176905
364 2856354870 2856349417 Bacteria 6230045
365 2871502299 2871495908 Bacteria 6935695
366 2878039558 2878035449 Bacteria 6555736
367 2878766190 2878760144 Bacteria 6823465
368 2878773391 2878767105 Bacteria 6898628
369 2881159190 2881155292 Bacteria 6461656
370 2885344605 2885342637 Bacteria 7011821
371 2885355665 2885350715 Bacteria 6787678
372 2888344180 2888343758 Bacteria 6611049
373 2889792029 2889790730 Bacteria 5689708
374 2889918342 2889914905 Bacteria 5702301
375 2891373656 2891373044 Bacteria 5202277
376 2894817636 2894817345 Bacteria 4892941
377 2896388186 2896384573 Bacteria 7700774
378 2898796595 2898795034 Bacteria 4294459
379 2899793073 2899792073 Bacteria 4926588
380 2899796410 2899792073 Bacteria 4926588
381 2899849725 2899845264 Bacteria 5672268
382 2899849953 2899845264 Bacteria 5672268
383 2903547236 2903540706 Bacteria 7062119
384 2906419241 2906414383 Bacteria 6580790
385 2919117444 2919114240 Bacteria 5700270
386 2919117955 2919114240 Bacteria 5700270
387 2920764297 2920760137 Bacteria 7427611
388 2923560005 2923556063 Bacteria 6793593
389 2924756971 2924754689 Bacteria 6774424
390 2926757724 2926754445 Bacteria 5964435
391 2926758891 2926754445 Bacteria 5964435
392 2926763599 2926760298 Bacteria 5505990
393 2926764651 2926760298 Bacteria 5505990
394 2928524158 2928521798 Bacteria 4960112
395 2933009823 2933006813 Bacteria 4912075
396 2933010339 2933006813 Bacteria 4912075
397 2933011858 2933011516 Bacteria 5439334
398 2933013993 2933011516 Bacteria 5439334
399 2933014192 2933011516 Bacteria 5439334
400 2933021237 2933016740 Bacteria 6355406
401 2933595779 2933594066 Bacteria 5594265
402 2936388372 2936381700 Bacteria 7006523
403 2938001099 2937994558 Bacteria 7036190
404 2954013105 2954011201 Bacteria 4762601
405 2958171365 2958165035 Bacteria 6906348
406 2961131469 2961127735 Bacteria 7196641
407 2961169806 2961163497 Bacteria 6901077
408 2965024566 2965018300 Bacteria 6883036
409 2968178198 2968171901 Bacteria 6894245
410 2970525891 2970524798 Bacteria 6840927
411 2970544448 2970540015 Bacteria 6977556
412 2970561044 2970554993 Bacteria 6814252
413 2977870234 2977864932 Bacteria 7534097
414 2979090238 2979089926 Bacteria 5670289
415 2979091362 2979089926 Bacteria 5670289
416 2979095768 2979095461 Bacteria 5669583
417 2979096886 2979095461 Bacteria 5669583
418 2979101446 2979100975 Bacteria 5423623
419 2984510604 2984509177 Bacteria 5274802
420 2984518693 2984518228 Bacteria 5277463
421 2984538953 2984537506 Bacteria 5277481
422 2984605647 2984601300 Bacteria 5455244
423 2987666030 2987659509 Bacteria 6966464
424 3004195053 3004188549 Bacteria 6952365
425 3005421411 3005416602 Bacteria 7064308
426 650843068 650716007 Bacteria 5573770
427 650844133 650716007 Bacteria 5573770
428 8003573321 8003570095 Bacteria 5747666
429 8003574227 8003570095 Bacteria 5747666
430 8005277608 8005275841 Bacteria 6929066
431 8005435905 8005430974 Bacteria 6689030
432 8005629013 8005626139 Bacteria 6534237
433 8018182139 8018176218 Bacteria 6896178
434 8056877600 8056875544 Bacteria 4355797
435 Ga0075364_10000126
436 JGI24737J22298_10025172
437 JGI25162J39368_1000207
438 JGI25151J46595_10010471
439 JGI25151J46595_10014546
440 JGI25165J46597_1000708
441 JGI25165J46597_1002799
442 rootH1_10022539
443 Ga0006562J51391_1020161
444 Ga0055524_1004341
445 Ga0055528_1000433
446 Ga0055528_1001141
447 Ga0055528_1002932
448 Ga0058692_1000771
449 Ga0058692_1007808
450 Ga0065704_10163536
451 Ga0070658_10022529
452 Ga0070676_10026238
453 Ga0070660_100007424
454 Ga0070668_100164544
455 Ga0070669_100192424
456 Ga0070674_100024976
457 Ga0070673_100146666
458 Ga0070662_100314493
459 Ga0068853_100184807
460 Ga0070672_100203077
461 Ga0070686_100052493
462 Ga0070665_100009919
463 Ga0070665_100010410
464 Ga0070665_100172678
465 Ga0068855_100052175
466 Ga0068854_100148515
467 Ga0068856_100027277
468 Ga0081540_1004077
469 Ga0081540_1055519
470 Ga0075365_10130325
471 Ga0075368_10026840
472 Ga0075368_10037305
473 Ga0075368_10047507
474 Ga0075363_100024117
475 Ga0075363_100026368
476 Ga0075363_100040160
477 Ga0075364_10017950
478 Ga0075362_10008228
479 Ga0075367_10097285
480 Ga0075367_10098097
481 Ga0068871_100213028
482 Ga0099826_10000328
483 Ga0099826_10004678
484 Ga0099826_10058078
485 Ga0105240_10000013
486 Ga0105240_10040055
487 Ga0111539_10000167
488 Ga0105243_10006468
489 Ga0105243_10125179
490 Ga0105237_10004144
491 Ga0105239_10006528
492 Ga0105246_10027492
493 Ga0105246_10047710
494 Ga0157373_10003911
495 Ga0157373_10010979
496 Ga0157371_10000002
497 Ga0157371_10000005
498 Ga0157370_10000036
499 Ga0157370_10000269
500 Ga0157370_10000836
501 Ga0157370_10253927
502 Ga0157378_10115160
503 Ga0182008_10108424
504 Ga0157379_10194262
505 Ga0182007_10001753
506 Ga0182005_1003219
507 Ga0209672_100019
508 Ga0209437_100204
509 Ga0209646_1003871
510 Ga0209677_100682
511 Ga0209233_1000280
512 Ga0209233_1000388
513 Ga0209673_1000033
514 Ga0209676_1012671
515 Ga0209025_1000545
516 Ga0209025_1001212
517 Ga0209025_1011660
518 Ga0209025_1022155
519 Ga0209758_1024432
520 Ga0209256_1000563
521 Ga0207645_10026019
522 Ga0207705_10019453
523 Ga0207695_10000044
524 Ga0207695_10035204
525 Ga0207671_10000043
526 Ga0207649_10045922
527 Ga0207681_10080274
528 Ga0207690_10038375
529 Ga0207709_10072705
530 Ga0207709_10105212
531 Ga0207669_10101359
532 Ga0207667_10173831
533 Ga0207667_10618573
534 Ga0207651_10233282
535 Ga0207640_10009959
536 Ga0207640_10340892
537 Ga0207677_10128969
538 Ga0207639_10179170
539 Ga0207648_10058818
540 Ga0207674_10031245
541 Ga0207698_10198271
542 Ga0209371_1000012
543 Ga0209371_1004131
544 Ga0209282_1000131
545 Ga0209813_10006402
546 Ga0209813_10032851
547 Ga0207428_10000055
548 Ga0268266_10008439
549 Ga0268266_10009389
550 Ga0268266_10020433
551 Ga0307515_10000136
552 Ga0307515_10023797
553 Ga0268256_1000013
554 Ga0268256_1014963
555 Ga0307513_10000302
556 Ga0307509_10120006
557 Ga0307408_100026586
558 Ga0307508_10217196
559 Ga0307409_100174632
560 Ga0307414_10252724
561 Ga0307411_10065501
562 Ga0373938_0012485
563 Ga0373931_0131671
564 Ga0395900_0189803
565 Ga0436360_1262863
566 Ga0439436_0012902
567 Ga0439465_0005122
568 Ga0439465_0043336
569 Ga0450906_010260
570 Ga0450918_006762
571 Ga0495638_0000634
572 Ga0495638_0000886
573 Ga0495605_0003448
574 Ga0495585_0075260
575 Ga0495583_0019978
576 Ga0495620_0034737
577 Ga0495631_0003747
578 Ga0495609_0040659
579 Ga0495633_0013803
580 Ga0495633_0087591
581 Ga0495611_0020774
582 Ga0495625_0001429
583 Ga0495625_0030748
584 Ga0495625_0123354
585 Ga0495588_0003384
586 Ga0495670_0068552
587 Ga0495660_0167644
588 Ga0495636_0089483
589 Ga0495672_0077069
590 Ga0495686_0040322
591 Ga0496104_0036453
592 Ga0496106_0068248
593 Ga0496107_0072786
594 Ga0496113_0027099
595 Ga0496113_0160820
596 Ga0496116_0016249
597 Ga0496116_0057712
598 Ga0496117_0000016
599 Ga0496117_0000030
600 Ga0496117_0000277
601 Ga0496117_0002721
602 Ga0496117_0003754
603 Ga0496117_0005071
604 Ga0496118_0001242
605 Ga0496118_0003364
606 Ga0496118_0003748
607 Ga0496118_0019920
608 Ga0496118_0050791
609 Ga0496119_0137538
610 Ga0496120_0000772
611 Ga0496120_0003367
612 Ga0496121_0000005
613 Ga0496121_0003679
614 Ga0496121_0196855
615 Ga0496122_0000002
616 Ga0496122_0000050
617 Ga0496122_0000072
618 Ga0496122_0000193
619 Ga0496122_0000414
620 Ga0496122_0000809
621 Ga0496122_0113995
622 Ga0496123_0000002
623 Ga0496123_0000023
624 Ga0496123_0000035
625 Ga0496123_0000154
626 Ga0496123_0000587
627 Ga0496123_0000839
628 Ga0496124_0000500
629 Ga0496124_0002797
630 Ga0496124_0004816
631 Ga0496124_0008171
632 Ga0496124_0019003
633 Ga0496124_0049158
634 Ga0496124_0090608
635 Ga0496125_0000417
636 Ga0496125_0002982
637 Ga0496125_0003920
638 Ga0496125_0022980
639 Ga0496125_0048013
640 Ga0496125_0246419
641 Ga0496126_0000188
642 Ga0496126_0000574
643 Ga0496126_0001037
644 Ga0496126_0118045
645 Ga0496126_0121049
646 Ga0495682_0051786
647 Ga0501034_0085484
648 Ga0501039_0071955
649 Ga0501039_0319029
650 Ga0501069_0175205
651 Ga0501044_0175122
652 nmdc:mga03683_12203_c1
653 nmdc:mga03683_129981_c1
654 nmdc:mga03n38_141312_c1
655 nmdc:mga00v17_168_c1
656 nmdc:mga00v17_34_c1
657 nmdc:mga00v17_3_c1
658 nmdc:mga0yw44_19672_c1
659 nmdc:mga0yw44_23546_c1
660 nmdc:mga0k408_56128_c1
661 nmdc:mga06z11_48091_c1
662 nmdc:mga06z11_87551_c1
663 nmdc:mga04h51_17847_c1
664 nmdc:mga08y16_37_c1
665 nmdc:mga0sz30_213_c1
666 nmdc:mga0sz30_5540_c1
667 Ga0500610_0072706
668 Ga0500557_019811
669 Ga0500560_002637
670 Ga0500572_006065
671 Ga0500595_015258
672 Ga0500658_0094217
673 Ga0500559_0028934
674 Ga0500561_0000067
675 Ga0500561_0000086
676 Ga0500568_0000543
677 Ga0500568_0006569
678 Ga0500616_0003759
679 Ga0500624_000238
680 Ga0500624_000964
681 Ga0500627_0025352
682 Ga0500634_0091328
683 Ga0500634_0143397
684 Ga0500636_0000205
685 Ga0500636_0106029
686 Ga0500645_015272
687 Ga0587076_025058
688 Ga0587111_0007275
689 2511390262
690 2513924916
691 2513999029
692 2537873120
693 2537877428
694 2554244466
695 2554245524
696 2559296646
697 2559297688
698 2561467503
699 2585169906
700 2585268754
701 2585279719
702 2585327555
703 2585333903
704 2585389399
705 2585531878
706 2585551175
707 2597810393
708 2599336447
709 2599416477
710 2599602865
711 2599603753
712 2601610472
713 2601612482
714 2601747198
715 2601749023
716 2616306508
717 2643917384
718 2643917483
719 2644051377
720 2644133147
721 2644201048
722 2644484281
723 2644497614
724 2644520774
725 2644522657
726 2692319306
727 2719389267
728 2721402032
729 2724035865
730 2753458976
731 2776910355
732 2778179118
733 2793331575
734 2793344650
735 2808987099
736 2808989199
737 2819560599
738 2819638606
739 2838036593
740 2838064575
741 2838075733
742 2838662409
743 2838677908
744 2838679878
745 2838717186
746 2838717675
747 2838722203
748 2838724449
749 2838727935
750 2838729609
751 2838735659
752 2838748561
753 2841849593
754 2841850048
755 2841854319
756 2841861167
757 2841861367
758 2841862948
759 2842127659
760 2842128520
761 2842132801
762 2842134560
763 2842154794
764 2842156608
765 2842173293
766 2842173920
767 2842178415
768 2842180229
769 2842190294
770 2842192228
771 2842214608
772 2842216492
773 2842227327
774 2842229264
775 2842232829
776 2842246928
777 2842259386
778 2842270071
779 2842433860
780 2842440236
781 2842446975
782 2842474830
783 2842511467
784 2842518366
785 2842518566
786 2842519535
787 2842524773
788 2842872229
789 2842927470
790 2844460768
791 2847422187
792 2847673362
793 2848998314
794 2854898972
795 2855875630
796 2856319169
797 2856342840
798 2856354870
799 2871502299
800 2878039558
801 2878766190
802 2878773391
803 2881159190
804 2885344605
805 2885355665
806 2888344180
807 2889792029
808 2889918342
809 2891373656
810 2894817636
811 2896388186
812 2898796595
813 2899793073
814 2899796410
815 2899849725
816 2899849953
817 2903547236
818 2906419241
819 2919117444
820 2919117955
821 2920764297
822 2923560005
823 2924756971
824 2926757724
825 2926758891
826 2926763599
827 2926764651
828 2928524158
829 2933009823
830 2933010339
831 2933011858
832 2933013993
833 2933014192
834 2933021237
835 2933595779
836 2936388372
837 2938001099
838 2954013105
839 2958171365
840 2961131469
841 2961169806
842 2965024566
843 2968178198
844 2970525891
845 2970544448
846 2970561044
847 2977870234
848 2979090238
849 2979091362
850 2979095768
851 2979096886
852 2979101446
853 2984510604
854 2984518693
855 2984538953
856 2984605647
857 2987666030
858 3004195053
859 3005421411
860 650843068
861 650844133
862 8003573321
863 8003574227
864 8005277608
865 8005435905
866 8005629013
867 8018182139
868 8056877600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

80

346

0.95

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

77

360

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsq-assembly2.cif.gz_B permutated n-terminal lobe of the ribose binding protein from thermotoga maritima 0.9212 25 114
2fn9-assembly2.cif.gz_B thermotoga maritima ribose binding protein unliganded form 0.907 26 299
5dte-assembly3.cif.gz_C crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose 0.8903 25 305
8fxt-assembly1.cif.gz_A escherichia coli periplasmic glucose-binding protein glucose complex: acrylodan conjugate attached at w183c 0.8897 24 304
4yo7-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi-511484) with bound myo-inositol 0.8864 25 309
ID Description Score Start End Superfamily
af_P02925_28_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9564 27 116 3.40.50.2300
4irxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9424 26 115 3.40.50.2300
af_P39325_23_126_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9313 25 115 3.30.420.40
4rxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9223 27 113 3.40.50.2300
4yv7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9096 24 127 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3HBY6-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9302 24 112 GO:0030246
GO:0030313
AF-A0A382UZY7-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9279 23 108 GO:0030246
GO:0030288
AF-A0A358APE1-F1-model_v4 D-galactose/methyl-galactoside binding periplasmic protein MglB 0.9095 30 305 GO:0030246
GO:0030288
GO:0046872
AF-A0A7V2UJU1-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9064 21 309 GO:0030246
GO:0030313
AF-A0A2E3KDK1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8969 24 307 GO:0000155
GO:0003700
GO:0016020
GO:0043565

Map