F443335

General Info

Members Datasets Scaffolds Average Seq Length
435 203 404 321

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10099705|Ga0182008_100997052
Length 346
Sequence MQASGAGQDFLLFYLLVHRVDRKQSSMTAPKVLVTGAGGFVGEALVFRLLVDKQFAPIAAARSPTRLQGLCPVVPFDLNDPEALPELKDVSAVVHAAARVHVMNEVASDALAEFRKVNVEGTLRLARRAAESGVKRFIFISSIKVNGENTLPGKPFKADDAPAPVDPYGVSKHEAEQGLRQLARETGMEVVIIRPPLIYGAGVKANFLSMLRWLNKGIPLPLGAVRNQRSLVSIGNLVDLVITCIDHPAAANQTFLVSDGQDLSTTEMLRRLGKALGKKAWLLPLPEWLLVGVASALGKQSVAQRICGSLQVDISKNRELLGWTPPINMDEAMRQTAGHYLDAQTK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231014 Pseudomonas sp. GM48 Isolate Nodule
5 2511231015 Pseudomonas sp. GM49 Isolate Nodule
6 2511231016 Pseudomonas sp. GM50 Isolate Nodule
7 2511231022 Pseudomonas sp. GM79 Isolate Nodule
8 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
9 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
10 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
11 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
12 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
13 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
14 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
15 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
16 2765235841 Pseudomonas putida AA7 Isolate Unclassified
17 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
18 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
19 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
20 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
21 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
22 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
23 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
24 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
25 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
26 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
27 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
28 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
29 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
87 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
90 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
93 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
94 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
95 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
96 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
97 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
98 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
99 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
201 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
202 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
203 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.87
Metatranscriptomes 0
Isolates 7.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 1.84
Rhizoplane 1.61
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1671 2124908027 Bacteria 3412
2 MRS2a_Contig_57 2124908027 Bacteria 9216
3 SwRhRL2b_contig_839902 2162886007 Bacteria 8498
4 JGI24735J21928_10002131 3300002067 Bacteria 6966
5 JGI24735J21928_10002701 3300002067 Bacteria 6126
6 Ga0055536_1000300 3300003781 Bacteria 37111
7 Ga0055530_10000434 3300003791 Bacteria 37091
8 Ga0055540_1001268 3300003792 Bacteria 15391
9 Ga0065714_10001429 3300005288 Bacteria 4350
10 Ga0065714_10002369 3300005288 Bacteria 21310
11 Ga0065714_10007797 3300005288 Bacteria 2745
12 Ga0065714_10009129 3300005288 Bacteria 2384
13 Ga0065714_10064948 3300005288 Bacteria 15009
14 Ga0065714_10066241 3300005288 Bacteria 7296
15 Ga0065714_10078135 3300005288 Bacteria 2625
16 Ga0065714_10094560 3300005288 Bacteria 1794
17 Ga0065714_10116700 3300005288 Bacteria 1400
18 Ga0065714_10140201 3300005288 Unclassified 1178
19 Ga0065704_10070365 3300005289 Bacteria 29509
20 Ga0065712_10121393 3300005290 Bacteria 1665
21 Ga0065715_10006120 3300005293 Unclassified 2969
22 Ga0070658_10193409 3300005327 Bacteria 1715
23 Ga0070683_100141243 3300005329 Bacteria 2282
24 Ga0070690_100003691 3300005330 Bacteria 8431
25 Ga0070670_100029748 3300005331 Bacteria 4704
26 Ga0070673_100005836 3300005364 Bacteria 7934
27 Ga0070688_100020635 3300005365 Unclassified 3834
28 Ga0070707_100093297 3300005468 Unclassified 2914
29 Ga0070672_100158488 3300005543 Unclassified 1876
30 Ga0068856_100005136 3300005614 Bacteria 12923
31 Ga0068859_100032076 3300005617 Bacteria 5276
32 Ga0068858_100177163 3300005842 Unclassified 2012
33 Ga0075362_10015465 3300006177 Bacteria 3104
34 Ga0075362_10040514 3300006177 Bacteria 2051
35 Ga0075366_10000811 3300006195 Bacteria 14996
36 Ga0097620_100032076 3300006931 Bacteria 5276
37 Ga0079104_1000955 3300006946 Bacteria 22753
38 Ga0105251_10000242 3300009011 Bacteria 54918
39 Ga0105251_10000844 3300009011 Bacteria 27457
40 Ga0105251_10001035 3300009011 Bacteria 24427
41 Ga0105251_10001051 3300009011 Bacteria 24156
42 Ga0105251_10001638 3300009011 Bacteria 18967
43 Ga0105251_10011534 3300009011 Bacteria 5043
44 Ga0105251_10054316 3300009011 Bacteria 1903
45 Ga0105251_10054322 3300009011 Bacteria 1903
46 Ga0105244_10000638 3300009036 Bacteria 30900
47 Ga0105244_10002706 3300009036 Bacteria 13254
48 Ga0105244_10007477 3300009036 Bacteria 6939
49 Ga0105244_10015723 3300009036 Bacteria 4332
50 Ga0105244_10036943 3300009036 Bacteria 2555
51 Ga0105250_10000358 3300009092 Bacteria 34694
52 Ga0105250_10004315 3300009092 Bacteria 6564
53 Ga0105250_10007613 3300009092 Bacteria 4642
54 Ga0111539_10206803 3300009094 Bacteria 2288
55 Ga0105243_10000971 3300009148 Bacteria 26695
56 Ga0157373_10000216 3300013100 Bacteria 47143
57 Ga0157373_10000380 3300013100 Bacteria 35597
58 Ga0157373_10000684 3300013100 Bacteria 26574
59 Ga0157373_10003694 3300013100 Bacteria 11580
60 Ga0157371_10005883 3300013102 Bacteria 10244
61 Ga0157371_10019996 3300013102 Bacteria 4929
62 Ga0157371_10033740 3300013102 Bacteria 3675
63 Ga0157370_10090031 3300013104 Bacteria 2881
64 Ga0157370_10178417 3300013104 Bacteria 1974
65 Ga0157369_10016134 3300013105 Bacteria 8407
66 Ga0163162_10001789 3300013306 Bacteria 20169
67 Ga0163162_10003212 3300013306 Bacteria 15638
68 Ga0163162_10025481 3300013306 Bacteria 5844
69 Ga0157375_10000664 3300013308 Bacteria 30435
70 Ga0157375_10007922 3300013308 Bacteria 9300
71 Ga0182008_10000895 3300014497 Bacteria 20715
72 Ga0182008_10001910 3300014497 Bacteria 13487
73 Ga0182008_10010159 3300014497 Bacteria 5045
74 Ga0182008_10024591 3300014497 Bacteria 3065
75 Ga0182008_10099705 3300014497 Bacteria 1435
76 Ga0182006_1001142 3300015261 Bacteria 16891
77 Ga0182007_10000296 3300015262 Bacteria 32264
78 Ga0182007_10006652 3300015262 Bacteria 4944
79 Ga0182007_10040255 3300015262 Bacteria 1561
80 Ga0163161_10139162 3300017792 Bacteria 1837
81 Ga0213872_10000377 3300021361 Bacteria 37517
82 Ga0209676_1000006 3300025292 Bacteria 1039588
83 Ga0209050_1000260 3300025298 Bacteria 113066
84 Ga0209051_1000163 3300025303 Bacteria 124249
85 Ga0207696_1007488 3300025711 Bacteria 4265
86 Ga0207655_1000857 3300025728 Bacteria 32446
87 Ga0207655_1002467 3300025728 Bacteria 14986
88 Ga0207655_1005471 3300025728 Bacteria 8626
89 Ga0207655_1023385 3300025728 Bacteria 3067
90 Ga0207713_1000444 3300025735 Bacteria 43513
91 Ga0207713_1000874 3300025735 Bacteria 27547
92 Ga0207713_1000922 3300025735 Bacteria 26366
93 Ga0207713_1000968 3300025735 Bacteria 25358
94 Ga0207713_1001664 3300025735 Bacteria 17228
95 Ga0207713_1002700 3300025735 Bacteria 12671
96 Ga0207713_1002702 3300025735 Bacteria 12665
97 Ga0207713_1004123 3300025735 Bacteria 9570
98 Ga0207705_10078515 3300025909 Bacteria 2403
99 Ga0207650_10038822 3300025925 Unclassified 3479
100 Ga0207670_10080192 3300025936 Unclassified 2281
101 Ga0207661_10217516 3300025944 Bacteria 1687
102 Ga0207651_10009708 3300025960 Bacteria 5290
103 Ga0207702_10014311 3300026078 Bacteria 6587
104 Ga0209281_1000902 3300027111 Bacteria 24860
105 Ga0207428_10067919 3300027907 Bacteria 2806
106 Ga0265327_10001921 3300031251 Bacteria 23986
107 Ga0307412_10019510 3300031911 Bacteria 4108
108 Ga0436361_0328269 3300039447 Bacteria 34583
109 Ga0439438_000275 3300041405 Bacteria 23167
110 Ga0439438_000596 3300041405 Bacteria 16345
111 Ga0439438_001039 3300041405 Bacteria 12369
112 Ga0439438_003934 3300041405 Bacteria 5846
113 Ga0439447_000245 3300041407 Bacteria 19071
114 Ga0439447_000384 3300041407 Bacteria 16142
115 Ga0439447_011308 3300041407 Bacteria 2611
116 Ga0439447_024333 3300041407 Bacteria 1569
117 Ga0439466_0000299 3300041411 Bacteria 19156
118 Ga0439466_0000791 3300041411 Bacteria 12022
119 Ga0439466_0001066 3300041411 Bacteria 10594
120 Ga0439466_0001163 3300041411 Bacteria 10252
121 Ga0439466_0001858 3300041411 Bacteria 8275
122 Ga0439466_0002388 3300041411 Bacteria 7363
123 Ga0439466_0004559 3300041411 Bacteria 5323
124 Ga0439466_0006811 3300041411 Bacteria 4334
125 Ga0439466_0025631 3300041411 Bacteria 2057
126 Ga0439466_0039701 3300041411 Bacteria 1576
127 Ga0439432_000110 3300042006 Bacteria 26479
128 Ga0439432_000124 3300042006 Bacteria 25479
129 Ga0439432_000253 3300042006 Bacteria 19122
130 Ga0439432_003903 3300042006 Bacteria 5488
131 Ga0439432_016413 3300042006 Bacteria 2492
132 Ga0439451_000014 3300042009 Bacteria 42560
133 Ga0439451_000034 3300042009 Bacteria 27633
134 Ga0439451_004151 3300042009 Bacteria 2939
135 Ga0439451_007854 3300042009 Bacteria 2166
136 Ga0439451_013885 3300042009 Bacteria 1626
137 Ga0439452_000404 3300042010 Bacteria 25488
138 Ga0439452_000609 3300042010 Bacteria 18220
139 Ga0439452_003589 3300042010 Bacteria 5406
140 Ga0439452_011111 3300042010 Bacteria 2596
141 Ga0439456_000119 3300042013 Bacteria 24617
142 Ga0439456_000412 3300042013 Bacteria 9574
143 Ga0439456_009742 3300042013 Bacteria 1983
144 Ga0439463_003707 3300042016 Bacteria 3851
145 Ga0450911_001202 3300042115 Bacteria 6318
146 Ga0450890_000319 3300042127 Bacteria 6935
147 Ga0450906_000022 3300042145 Bacteria 27788
148 Ga0450907_008665 3300042146 Bacteria 1686
149 Ga0439460_0003078 3300042461 Bacteria 4031
150 Ga0439460_0010507 3300042461 Bacteria 2371
151 Ga0439440_0000005 3300042993 Bacteria 31981
152 Ga0453684_0150602 3300044712 Unclassified 2765
153 Ga0495617_000200 3300046452 Bacteria 37820
154 Ga0495617_000794 3300046452 Bacteria 15243
155 Ga0495617_002589 3300046452 Bacteria 7096
156 Ga0495617_002914 3300046452 Bacteria 6576
157 Ga0495617_018216 3300046452 Bacteria 2375
158 Ga0495627_000586 3300046453 Bacteria 29130
159 Ga0495592_0000531 3300046454 Bacteria 27424
160 Ga0495590_0000248 3300046457 Bacteria 29287
161 Ga0495590_0000508 3300046457 Bacteria 19111
162 Ga0495590_0002700 3300046457 Bacteria 7331
163 Ga0495590_0003717 3300046457 Bacteria 6214
164 Ga0495591_001574 3300046458 Bacteria 13877
165 Ga0495638_0000726 3300046460 Bacteria 35496
166 Ga0495638_0004298 3300046460 Bacteria 10811
167 Ga0495638_0008559 3300046460 Bacteria 7243
168 Ga0495638_0010747 3300046460 Bacteria 6335
169 Ga0495638_0011407 3300046460 Bacteria 6124
170 Ga0495653_0000688 3300046463 Bacteria 25835
171 Ga0495653_0050710 3300046463 Bacteria 3190
172 Ga0495653_0056066 3300046463 Bacteria 3005
173 Ga0495653_0069361 3300046463 Bacteria 2641
174 Ga0495653_0080324 3300046463 Bacteria 2413
175 Ga0495653_0093976 3300046463 Bacteria 2186
176 Ga0495650_0001217 3300046471 Bacteria 26985
177 Ga0495650_0001799 3300046471 Bacteria 19344
178 Ga0495605_0000672 3300046474 Bacteria 25764
179 Ga0495605_0000747 3300046474 Bacteria 23843
180 Ga0495605_0000753 3300046474 Bacteria 23741
181 Ga0495639_0000020 3300046475 Bacteria 73983
182 Ga0495639_0047080 3300046475 Bacteria 1953
183 Ga0495584_0000285 3300046491 Bacteria 35720
184 Ga0495584_0000486 3300046491 Bacteria 27340
185 Ga0495584_0005176 3300046491 Bacteria 6922
186 Ga0495584_0014319 3300046491 Bacteria 4041
187 Ga0495585_0000121 3300046492 Bacteria 84876
188 Ga0495585_0000754 3300046492 Bacteria 28684
189 Ga0495585_0000810 3300046492 Bacteria 27246
190 Ga0495585_0010050 3300046492 Bacteria 5653
191 Ga0495585_0042207 3300046492 Bacteria 2556
192 Ga0495594_0001261 3300046499 Bacteria 13267
193 Ga0495594_0085285 3300046499 Bacteria 1767
194 Ga0495607_0000639 3300046501 Bacteria 34018
195 Ga0495607_0001640 3300046501 Bacteria 19395
196 Ga0495607_0009839 3300046501 Bacteria 6453
197 Ga0495607_0022922 3300046501 Bacteria 3914
198 Ga0495583_0003148 3300046506 Bacteria 13017
199 Ga0495583_0021085 3300046506 Bacteria 3357
200 Ga0495610_0000774 3300046512 Bacteria 30147
201 Ga0495616_0000484 3300046513 Bacteria 30294
202 Ga0495616_0000598 3300046513 Bacteria 27217
203 Ga0495616_0000750 3300046513 Bacteria 23713
204 Ga0495616_0001079 3300046513 Bacteria 19379
205 Ga0495616_0003336 3300046513 Bacteria 10311
206 Ga0495620_0000076 3300046515 Bacteria 80714
207 Ga0495620_0000266 3300046515 Bacteria 38388
208 Ga0495620_0001795 3300046515 Bacteria 12622
209 Ga0495628_0053262 3300046516 Bacteria 3194
210 Ga0495628_0079819 3300046516 Bacteria 2544
211 Ga0495630_0161781 3300046517 Bacteria 1704
212 Ga0495631_0045680 3300046518 Bacteria 1928
213 Ga0495632_0000164 3300046519 Bacteria 68590
214 Ga0495632_0000481 3300046519 Bacteria 37903
215 Ga0495632_0000527 3300046519 Bacteria 36131
216 Ga0495632_0001044 3300046519 Bacteria 23873
217 Ga0495632_0003678 3300046519 Bacteria 10761
218 Ga0495632_0083194 3300046519 Bacteria 1524
219 Ga0495637_0000538 3300046520 Bacteria 27221
220 Ga0495637_0000598 3300046520 Bacteria 25829
221 Ga0495637_0000675 3300046520 Bacteria 23730
222 Ga0495637_0001629 3300046520 Bacteria 13023
223 Ga0495637_0001828 3300046520 Bacteria 12175
224 Ga0495637_0003584 3300046520 Bacteria 8230
225 Ga0495637_0014928 3300046520 Bacteria 3656
226 Ga0495643_0000102 3300046522 Bacteria 141544
227 Ga0495643_0000801 3300046522 Bacteria 34761
228 Ga0495643_0001100 3300046522 Bacteria 26910
229 Ga0495643_0001350 3300046522 Bacteria 23094
230 Ga0495643_0007756 3300046522 Bacteria 6870
231 Ga0495644_0010671 3300046523 Bacteria 3538
232 Ga0495648_0000447 3300046524 Bacteria 44636
233 Ga0495648_0001380 3300046524 Bacteria 23914
234 Ga0495648_0001419 3300046524 Bacteria 23424
235 Ga0495648_0001939 3300046524 Bacteria 19708
236 Ga0495648_0002091 3300046524 Bacteria 18851
237 Ga0495666_0001366 3300046526 Bacteria 11831
238 Ga0495666_0056397 3300046526 Bacteria 1882
239 Ga0495666_0056823 3300046526 Bacteria 1873
240 Ga0495666_0081892 3300046526 Bacteria 1526
241 Ga0495642_0000096 3300046528 Bacteria 50386
242 Ga0495642_0000173 3300046528 Bacteria 37882
243 Ga0495654_0000499 3300046530 Bacteria 32120
244 Ga0495654_0000642 3300046530 Bacteria 27541
245 Ga0495654_0001445 3300046530 Bacteria 16308
246 Ga0495654_0002977 3300046530 Bacteria 10599
247 Ga0495654_0008310 3300046530 Bacteria 5740
248 Ga0495586_0028037 3300046535 Bacteria 3013
249 Ga0495587_0034341 3300046536 Bacteria 3059
250 Ga0495587_0038636 3300046536 Bacteria 2860
251 Ga0495587_0124596 3300046536 Bacteria 1474
252 Ga0495609_0000396 3300046538 Bacteria 36617
253 Ga0495609_0000661 3300046538 Bacteria 26766
254 Ga0495609_0000689 3300046538 Bacteria 26028
255 Ga0495609_0032942 3300046538 Bacteria 2352
256 Ga0495597_0078156 3300046542 Bacteria 1417
257 Ga0495645_0013415 3300046543 Bacteria 5791
258 Ga0495622_0001378 3300046557 Bacteria 12392
259 Ga0495656_0041343 3300046615 Bacteria 1926
260 Ga0495668_0015580 3300046616 Bacteria 4436
261 Ga0495668_0070046 3300046616 Bacteria 1928
262 Ga0495634_0000578 3300046642 Bacteria 35603
263 Ga0495634_0008816 3300046642 Bacteria 7480
264 Ga0495611_0008381 3300046648 Bacteria 4379
265 Ga0495611_0012517 3300046648 Bacteria 3607
266 Ga0495625_0001808 3300046660 Bacteria 24531
267 Ga0495625_0001948 3300046660 Bacteria 23351
268 Ga0495625_0002521 3300046660 Bacteria 19710
269 Ga0495625_0002691 3300046660 Bacteria 18886
270 Ga0495625_0023052 3300046660 Bacteria 4760
271 Ga0495625_0075407 3300046660 Bacteria 2360
272 Ga0495635_0011862 3300046663 Bacteria 6109
273 Ga0495635_0220863 3300046663 Bacteria 1281
274 Ga0495659_0000827 3300046664 Bacteria 10997
275 Ga0495659_0000914 3300046664 Bacteria 10488
276 Ga0495659_0002964 3300046664 Bacteria 5446
277 Ga0495661_0007415 3300046665 Bacteria 7647
278 Ga0495661_0038352 3300046665 Bacteria 2985
279 Ga0495588_0000332 3300046674 Bacteria 31035
280 Ga0495588_0071692 3300046674 Bacteria 1802
281 Ga0495623_0003974 3300046679 Bacteria 9730
282 Ga0495646_0000141 3300046680 Bacteria 36806
283 Ga0495646_0002439 3300046680 Bacteria 11412
284 Ga0495646_0003293 3300046680 Bacteria 10055
285 Ga0495646_0039256 3300046680 Bacteria 2920
286 Ga0495669_0010329 3300046684 Bacteria 3945
287 Ga0495613_0000653 3300046689 Bacteria 27454
288 Ga0495613_0042100 3300046689 Bacteria 3381
289 Ga0495624_0000531 3300046690 Bacteria 29852
290 Ga0495670_0000170 3300046691 Bacteria 28828
291 Ga0495670_0002412 3300046691 Bacteria 9221
292 Ga0495670_0041092 3300046691 Bacteria 2307
293 Ga0495671_0000500 3300046692 Bacteria 30197
294 Ga0495671_0000501 3300046692 Bacteria 30161
295 Ga0495671_0001061 3300046692 Bacteria 19046
296 Ga0495671_0003934 3300046692 Bacteria 9008
297 Ga0495671_0026188 3300046692 Bacteria 3025
298 Ga0495671_0107076 3300046692 Bacteria 1365
299 Ga0495649_0000432 3300046694 Bacteria 36223
300 Ga0495649_0002018 3300046694 Bacteria 14695
301 Ga0495649_0002136 3300046694 Bacteria 14139
302 Ga0495649_0012874 3300046694 Bacteria 4847
303 Ga0495649_0013172 3300046694 Bacteria 4777
304 Ga0495589_0000578 3300046794 Bacteria 25244
305 Ga0495589_0001569 3300046794 Bacteria 13144
306 Ga0495589_0002103 3300046794 Bacteria 11245
307 Ga0495589_0005779 3300046794 Bacteria 6527
308 Ga0495589_0017798 3300046794 Bacteria 3645
309 Ga0495589_0045093 3300046794 Bacteria 2190
310 Ga0495600_0000799 3300046809 Bacteria 16669
311 Ga0495600_0019131 3300046809 Bacteria 4368
312 Ga0495660_0000547 3300046810 Bacteria 30853
313 Ga0495660_0110011 3300046810 Bacteria 1407
314 Ga0495581_0035148 3300047315 Bacteria 2899
315 Ga0495604_0046768 3300047317 Bacteria 3373
316 Ga0495636_0000132 3300047318 Bacteria 29973
317 Ga0495636_0000191 3300047318 Bacteria 24040
318 Ga0495674_0012454 3300047319 Bacteria 8013
319 Ga0495672_0000378 3300047320 Bacteria 55187
320 Ga0495672_0000795 3300047320 Bacteria 34131
321 Ga0495672_0000938 3300047320 Bacteria 30432
322 Ga0495672_0001019 3300047320 Bacteria 28816
323 Ga0495672_0001359 3300047320 Bacteria 24241
324 Ga0495672_0001962 3300047320 Bacteria 19444
325 Ga0495672_0019821 3300047320 Bacteria 4425
326 Ga0495676_0000567 3300047321 Bacteria 30353
327 Ga0495676_0000691 3300047321 Bacteria 28103
328 Ga0495680_0000664 3300047322 Bacteria 38534
329 Ga0495680_0002689 3300047322 Bacteria 17947
330 Ga0495680_0004075 3300047322 Bacteria 14067
331 Ga0495680_0037989 3300047322 Bacteria 3852
332 Ga0495683_0001413 3300047323 Bacteria 15848
333 Ga0495683_0003760 3300047323 Bacteria 8773
334 Ga0495683_0005807 3300047323 Bacteria 6792
335 Ga0495683_0013255 3300047323 Bacteria 4315
336 Ga0495687_003617 3300047443 Bacteria 11044
337 Ga0495687_004145 3300047443 Bacteria 9986
338 Ga0495687_024700 3300047443 Bacteria 2852
339 Ga0495675_0007945 3300047444 Bacteria 6558
340 Ga0495677_0000289 3300047445 Bacteria 21903
341 Ga0495679_007490 3300047446 Bacteria 4542
342 Ga0495679_007641 3300047446 Bacteria 4486
343 Ga0495685_005424 3300047447 Bacteria 4164
344 Ga0495673_0000626 3300047469 Bacteria 34754
345 Ga0495673_0005939 3300047469 Bacteria 7276
346 Ga0495673_0007263 3300047469 Bacteria 6396
347 Ga0495673_0012152 3300047469 Bacteria 4584
348 Ga0495673_0026462 3300047469 Bacteria 2773
349 Ga0495673_0105955 3300047469 Bacteria 1130
350 Ga0495681_0001243 3300047470 Bacteria 19346
351 Ga0495681_0052444 3300047470 Bacteria 1914
352 Ga0495684_0000839 3300047471 Bacteria 24902
353 Ga0495686_0002428 3300047472 Bacteria 17617
354 Ga0495593_0002585 3300047673 Bacteria 10879
355 Ga0495593_0062353 3300047673 Bacteria 1948
356 Ga0495593_0068483 3300047673 Bacteria 1846
357 Ga0495602_0000857 3300048088 Bacteria 29349
358 Ga0495626_0000699 3300048091 Bacteria 31942
359 Ga0495626_0000819 3300048091 Bacteria 27987
360 Ga0495626_0000843 3300048091 Bacteria 27491
361 Ga0495626_0002809 3300048091 Bacteria 11660
362 Ga0495626_0002836 3300048091 Bacteria 11585
363 Ga0496102_0000519 3300048905 Bacteria 42011
364 Ga0496103_0001796 3300048906 Bacteria 14004
365 Ga0496104_0124997 3300048907 Bacteria 2469
366 Ga0496105_0022293 3300048908 Bacteria 5129
367 Ga0496106_0067157 3300048909 Bacteria 2733
368 Ga0496111_0180700 3300048914 Bacteria 1568
369 Ga0496116_0000427 3300048919 Bacteria 59167
370 Ga0496116_0022457 3300048919 Bacteria 4728
371 Ga0496117_0000679 3300048920 Bacteria 54406
372 Ga0496117_0011811 3300048920 Bacteria 7775
373 Ga0496119_0001431 3300048922 Bacteria 28804
374 Ga0496119_0008611 3300048922 Bacteria 8931
375 Ga0496120_0001617 3300048923 Bacteria 26127
376 Ga0496120_0015014 3300048923 Bacteria 5127
377 Ga0496121_0001685 3300048924 Bacteria 36349
378 Ga0496121_0026838 3300048924 Bacteria 5409
379 Ga0496122_0007463 3300048925 Bacteria 12140
380 Ga0496124_0002357 3300048927 Bacteria 24921
381 Ga0496124_0003020 3300048927 Bacteria 21031
382 Ga0496124_0028385 3300048927 Bacteria 5007
383 Ga0496124_0298045 3300048927 Bacteria 1166
384 Ga0496125_0003005 3300048928 Bacteria 21097
385 Ga0496125_0010025 3300048928 Bacteria 9626
386 Ga0496126_0042249 3300048929 Bacteria 4211
387 Ga0495678_000569 3300049459 Bacteria 35204
388 Ga0495678_000891 3300049459 Bacteria 26572
389 Ga0495678_000928 3300049459 Bacteria 25623
390 Ga0495678_000960 3300049459 Bacteria 24945
391 Ga0495678_003060 3300049459 Bacteria 10617
392 Ga0495682_0000536 3300049460 Bacteria 26226
393 Ga0495682_0000651 3300049460 Bacteria 23215
394 Ga0495682_0000878 3300049460 Bacteria 18647
395 Ga0495682_0002981 3300049460 Bacteria 7727
396 Ga0495682_0007016 3300049460 Bacteria 4515
397 Ga0495682_0011151 3300049460 Bacteria 3463
398 Ga0501032_0050921 3300049569 Bacteria 2792
399 Ga0501034_0000665 3300049571 Bacteria 52406
400 nmdc:mga0k408_1165_c1 3300050493 Bacteria 14375
401 nmdc:mga08x19_136305_c1 3300050514 Bacteria 1655
402 Ga0500647_0114953 3300053091 Bacteria 1277
403 Ga0500641_0076060 3300053096 Bacteria 1420
404 Ga0530510_0094817 3300061734 Bacteria 2180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100005136 Ga0068856_10000513610 268
2 3300026078 Ga0207702_10014311 Ga0207702_100143114 268
3 3300046520 Ga0495637_0001629 Ga0495637_0001629_6343_7248 278
4 3300049571 Ga0501034_0000665 Ga0501034_0000665_45916_46761 280
5 3300046515 Ga0495620_0000076 Ga0495620_0000076_63635_64597 287
6 3300046519 Ga0495632_0000164 Ga0495632_0000164_16118_17080 287
7 3300046522 Ga0495643_0000801 Ga0495643_0000801_6242_7204 287
8 3300046524 Ga0495648_0000447 Ga0495648_0000447_15288_16250 287
9 3300048920 Ga0496117_0000679 Ga0496117_0000679_38035_38997 287
10 2162886007 SwRhRL2b_contig_839902 SwRhRL2b_0413.00001110 288
11 3300005289 Ga0065704_10070365 Ga0065704_1007036511 288
12 3300048919 Ga0496116_0022457 Ga0496116_0022457_53_1015 288
13 3300046463 Ga0495653_0080324 Ga0495653_0080324_1481_2362 293
14 3300049459 Ga0495678_000960 Ga0495678_000960_4671_5552 293
15 3300046694 Ga0495649_0002136 Ga0495649_0002136_11976_12950 297
16 3300042146 Ga0450907_008665 Ga0450907_008665_15_911 298
17 3300048907 Ga0496104_0124997 Ga0496104_0124997_1546_2442 298
18 3300048928 Ga0496125_0003005 Ga0496125_0003005_1359_2309 298
19 3300005327 Ga0070658_10193409 Ga0070658_101934092 299
20 3300025909 Ga0207705_10078515 Ga0207705_100785152 299
21 3300046452 Ga0495617_002589 Ga0495617_002589_1575_2486 300
22 3300046530 Ga0495654_0002977 Ga0495654_0002977_5041_5952 300
23 iso_pu_bacteria 2860339153 2860340871 302
24 3300047470 Ga0495681_0052444 Ga0495681_0052444_741_1685 303
25 3300005288 Ga0065714_10140201 Ga0065714_101402012 304
26 3300005293 Ga0065715_10006120 Ga0065715_100061202 304
27 3300005330 Ga0070690_100003691 Ga0070690_1000036914 304
28 3300005331 Ga0070670_100029748 Ga0070670_1000297483 304
29 3300005364 Ga0070673_100005836 Ga0070673_1000058362 304
30 3300005365 Ga0070688_100020635 Ga0070688_1000206353 304
31 3300005543 Ga0070672_100158488 Ga0070672_1001584882 304
32 3300005617 Ga0068859_100032076 Ga0068859_1000320762 304
33 3300005842 Ga0068858_100177163 Ga0068858_1001771632 304
34 3300006931 Ga0097620_100032076 Ga0097620_1000320762 304
35 3300025925 Ga0207650_10038822 Ga0207650_100388222 304
36 3300025936 Ga0207670_10080192 Ga0207670_100801922 304
37 3300025960 Ga0207651_10009708 Ga0207651_100097082 304
38 3300061734 Ga0530510_0094817 Ga0530510_0094817_1230_2159 304
39 3300048908 Ga0496105_0022293 Ga0496105_0022293_3495_4415 306
40 3300044712 Ga0453684_0150602 Ga0453684_0150602_274_1209 307
41 iso_pu_bacteria 3007866637 3007870299 307
42 iso_pu_bacteria 2839094727 2839099589 308
43 3300009094 Ga0111539_10206803 Ga0111539_102068032 310
44 3300046491 Ga0495584_0014319 Ga0495584_0014319_2115_3074 310
45 3300046520 Ga0495637_0000598 Ga0495637_0000598_20251_21210 310
46 3300046660 Ga0495625_0001808 Ga0495625_0001808_4446_5447 310
47 3300047469 Ga0495673_0026462 Ga0495673_0026462_1060_2061 310
48 3300048922 Ga0496119_0008611 Ga0496119_0008611_3309_4280 310
49 3300048923 Ga0496120_0015014 Ga0496120_0015014_876_1847 310
50 3300049459 Ga0495678_000891 Ga0495678_000891_4586_5587 310
51 3300049460 Ga0495682_0002981 Ga0495682_0002981_1680_2681 310
52 iso_pu_bacteria 2904518522 2904521298 310
53 3300005468 Ga0070707_100093297 Ga0070707_1000932973 311
54 3300006177 Ga0075362_10040514 Ga0075362_100405142 312
55 3300006195 Ga0075366_10000811 Ga0075366_1000081111 312
56 3300021361 Ga0213872_10000377 Ga0213872_1000037725 312
57 3300039447 Ga0436361_0328269 Ga0436361_0328269_9238_10191 312
58 3300050493 nmdc:mga0k408_1165_c1 nmdc:mga0k408_1165_c1_1177_2130 312
59 iso_pu_bacteria 2511231015 2511323025 312
60 iso_pu_bacteria 8019769354 8019773107 312
61 3300046520 Ga0495637_0014928 Ga0495637_0014928_2504_3457 313
62 iso_pu_bacteria 2808606379 2808941464 313
63 3300013100 Ga0157373_10000684 Ga0157373_1000068416 314
64 3300031251 Ga0265327_10001921 Ga0265327_1000192121 314
65 iso_pu_bacteria 2511231014 2511314699 314
66 iso_pu_bacteria 2765235841 2765585386 314
67 iso_pu_bacteria 8029995093 8029996850 314
68 iso_pu_bacteria 2738543020 2739288878 315
69 iso_pu_bacteria 2738543021 2739294190 315
70 iso_pu_bacteria 2969304461 2969308723 315
71 3300009011 Ga0105251_10001638 Ga0105251_1000163818 316
72 3300025735 Ga0207713_1004123 Ga0207713_10041232 316
73 3300027907 Ga0207428_10067919 Ga0207428_100679192 316
74 3300046517 Ga0495630_0161781 Ga0495630_0161781_172_1134 316
75 iso_pu_bacteria 2511231006 2511268371 316
76 iso_pu_bacteria 2511231016 2511324136 316
77 iso_pu_bacteria 2511231022 2511362931 316
78 iso_pu_bacteria 2512047018 2512324055 316
79 iso_pu_bacteria 2582580891 2583793727 316
80 iso_pu_bacteria 2623620446 2624490950 316
81 iso_pu_bacteria 2643221633 2644188637 316
82 iso_pu_bacteria 2667528176 2671125961 316
83 iso_pu_bacteria 2718217725 2718635210 316
84 iso_pu_bacteria 2852657418 2852663077 316
85 iso_pu_bacteria 2880230671 2880234571 316
86 iso_pu_bacteria 2919155634 2919157459 316
87 iso_pu_bacteria 2919385768 2919388046 316
88 iso_pu_bacteria 2931396565 2931396614 316
89 iso_pu_bacteria 3007619802 3007624865 316
90 iso_pu_bacteria 8056155041 8056155079 316
91 3300005288 Ga0065714_10066241 Ga0065714_100662413 317
92 3300005329 Ga0070683_100141243 Ga0070683_1001412432 317
93 3300006177 Ga0075362_10015465 Ga0075362_100154653 317
94 3300009036 Ga0105244_10007477 Ga0105244_100074774 317
95 3300025728 Ga0207655_1023385 Ga0207655_10233852 317
96 3300025944 Ga0207661_10217516 Ga0207661_102175162 317
97 3300041407 Ga0439447_024333 Ga0439447_024333_67_1023 317
98 3300041411 Ga0439466_0000791 Ga0439466_0000791_8905_9861 317
99 3300046452 Ga0495617_000794 Ga0495617_000794_6809_7771 317
100 3300046452 Ga0495617_018216 Ga0495617_018216_1246_2199 317
101 3300046453 Ga0495627_000586 Ga0495627_000586_5485_6438 317
102 3300046460 Ga0495638_0000726 Ga0495638_0000726_14195_15157 317
103 3300046460 Ga0495638_0011407 Ga0495638_0011407_2202_3164 317
104 3300046491 Ga0495584_0000486 Ga0495584_0000486_7736_8698 317
105 3300046492 Ga0495585_0000121 Ga0495585_0000121_16268_17230 317
106 3300046492 Ga0495585_0042207 Ga0495585_0042207_1425_2387 317
107 3300046501 Ga0495607_0009839 Ga0495607_0009839_4325_5278 317
108 3300046515 Ga0495620_0001795 Ga0495620_0001795_1609_2571 317
109 3300046519 Ga0495632_0083194 Ga0495632_0083194_498_1460 317
110 3300046524 Ga0495648_0001380 Ga0495648_0001380_19163_20125 317
111 3300046524 Ga0495648_0001419 Ga0495648_0001419_2882_3835 317
112 3300046538 Ga0495609_0032942 Ga0495609_0032942_608_1570 317
113 3300046660 Ga0495625_0001948 Ga0495625_0001948_4656_5609 317
114 3300046691 Ga0495670_0000170 Ga0495670_0000170_13332_14294 317
115 3300046692 Ga0495671_0000501 Ga0495671_0000501_19602_20564 317
116 3300046810 Ga0495660_0000547 Ga0495660_0000547_5140_6093 317
117 3300047320 Ga0495672_0000795 Ga0495672_0000795_19530_20492 317
118 3300047320 Ga0495672_0001019 Ga0495672_0001019_15096_16058 317
119 3300047323 Ga0495683_0001413 Ga0495683_0001413_3916_4869 317
120 3300047323 Ga0495683_0003760 Ga0495683_0003760_734_1696 317
121 3300047443 Ga0495687_024700 Ga0495687_024700_1754_2716 317
122 3300047469 Ga0495673_0000626 Ga0495673_0000626_5525_6478 317
123 3300047469 Ga0495673_0007263 Ga0495673_0007263_3719_4681 317
124 3300049460 Ga0495682_0011151 Ga0495682_0011151_484_1446 317
125 3300049569 Ga0501032_0050921 Ga0501032_0050921_726_1688 317
126 3300050514 nmdc:mga08x19_136305_c1 nmdc:mga08x19_136305_c1_113_1075 317
127 3300009011 Ga0105251_10000242 Ga0105251_1000024231 318
128 3300009148 Ga0105243_10000971 Ga0105243_1000097124 318
129 3300025735 Ga0207713_1000444 Ga0207713_10004443 318
130 3300025735 Ga0207713_1001664 Ga0207713_10016643 318
131 3300041411 Ga0439466_0001163 Ga0439466_0001163_5997_6953 318
132 3300041411 Ga0439466_0004559 Ga0439466_0004559_2271_3236 318
133 3300042013 Ga0439456_000119 Ga0439456_000119_3672_4628 318
134 3300046694 Ga0495649_0012874 Ga0495649_0012874_2609_3574 318
135 3300046794 Ga0495589_0045093 Ga0495589_0045093_198_1154 318
136 3300047321 Ga0495676_0000567 Ga0495676_0000567_25638_26606 318
137 3300048914 Ga0496111_0180700 Ga0496111_0180700_431_1396 318
138 3300048927 Ga0496124_0002357 Ga0496124_0002357_14414_15379 318
139 3300048927 Ga0496124_0298045 Ga0496124_0298045_55_1020 318
140 3300002067 JGI24735J21928_10002131 JGI24735J21928_100021312 319
141 3300002067 JGI24735J21928_10002701 JGI24735J21928_100027012 319
142 3300013100 Ga0157373_10000216 Ga0157373_1000021636 319
143 3300041405 Ga0439438_001039 Ga0439438_001039_986_1966 319
144 3300046513 Ga0495616_0000750 Ga0495616_0000750_4589_5548 319
145 3300046519 Ga0495632_0001044 Ga0495632_0001044_18489_19448 319
146 3300046520 Ga0495637_0000675 Ga0495637_0000675_4598_5557 319
147 3300046522 Ga0495643_0000102 Ga0495643_0000102_126053_127033 319
148 3300046524 Ga0495648_0002091 Ga0495648_0002091_4389_5348 319
149 3300046615 Ga0495656_0041343 Ga0495656_0041343_713_1672 319
150 3300046616 Ga0495668_0070046 Ga0495668_0070046_712_1671 319
151 3300046660 Ga0495625_0002691 Ga0495625_0002691_13504_14463 319
152 3300046692 Ga0495671_0000500 Ga0495671_0000500_4584_5543 319
153 3300046692 Ga0495671_0001061 Ga0495671_0001061_13662_14621 319
154 3300046694 Ga0495649_0002018 Ga0495649_0002018_886_1866 319
155 3300046794 Ga0495589_0002103 Ga0495589_0002103_4623_5582 319
156 3300047320 Ga0495672_0001962 Ga0495672_0001962_4597_5556 319
157 3300047472 Ga0495686_0002428 Ga0495686_0002428_1129_2088 319
158 3300048091 Ga0495626_0000843 Ga0495626_0000843_21939_22898 319
159 3300048924 Ga0496121_0001685 Ga0496121_0001685_29872_30831 319
160 2124908027 MRS2a_Contig_1671 MRS2a_00531250 320
161 2124908027 MRS2a_Contig_57 MRS2a_00442820 320
162 3300003781 Ga0055536_1000300 Ga0055536_100030033 320
163 3300003791 Ga0055530_10000434 Ga0055530_1000043433 320
164 3300003792 Ga0055540_1001268 Ga0055540_100126812 320
165 3300005288 Ga0065714_10001429 Ga0065714_100014293 320
166 3300005288 Ga0065714_10002369 Ga0065714_1000236914 320
167 3300005288 Ga0065714_10007797 Ga0065714_100077972 320
168 3300005288 Ga0065714_10009129 Ga0065714_100091292 320
169 3300005288 Ga0065714_10064948 Ga0065714_1006494813 320
170 3300005288 Ga0065714_10078135 Ga0065714_100781351 320
171 3300005288 Ga0065714_10094560 Ga0065714_100945602 320
172 3300005288 Ga0065714_10116700 Ga0065714_101167002 320
173 3300005290 Ga0065712_10121393 Ga0065712_101213931 320
174 3300006946 Ga0079104_1000955 Ga0079104_10009556 320
175 3300009011 Ga0105251_10000844 Ga0105251_100008443 320
176 3300009011 Ga0105251_10001035 Ga0105251_100010357 320
177 3300009011 Ga0105251_10001051 Ga0105251_1000105118 320
178 3300009011 Ga0105251_10011534 Ga0105251_100115343 320
179 3300009011 Ga0105251_10054316 Ga0105251_100543162 320
180 3300009011 Ga0105251_10054322 Ga0105251_100543222 320
181 3300009036 Ga0105244_10000638 Ga0105244_100006385 320
182 3300009036 Ga0105244_10002706 Ga0105244_100027069 320
183 3300009036 Ga0105244_10015723 Ga0105244_100157234 320
184 3300009036 Ga0105244_10036943 Ga0105244_100369432 320
185 3300009092 Ga0105250_10000358 Ga0105250_1000035815 320
186 3300009092 Ga0105250_10004315 Ga0105250_100043154 320
187 3300009092 Ga0105250_10007613 Ga0105250_100076133 320
188 3300013100 Ga0157373_10000380 Ga0157373_1000038026 320
189 3300013100 Ga0157373_10003694 Ga0157373_100036948 320
190 3300013102 Ga0157371_10005883 Ga0157371_100058839 320
191 3300013102 Ga0157371_10019996 Ga0157371_100199965 320
192 3300013102 Ga0157371_10033740 Ga0157371_100337402 320
193 3300013104 Ga0157370_10090031 Ga0157370_100900312 320
194 3300013104 Ga0157370_10178417 Ga0157370_101784172 320
195 3300013105 Ga0157369_10016134 Ga0157369_100161345 320
196 3300013306 Ga0163162_10001789 Ga0163162_100017893 320
197 3300013306 Ga0163162_10003212 Ga0163162_1000321210 320
198 3300013306 Ga0163162_10025481 Ga0163162_100254814 320
199 3300013308 Ga0157375_10000664 Ga0157375_1000066420 320
200 3300013308 Ga0157375_10007922 Ga0157375_100079224 320
201 3300014497 Ga0182008_10000895 Ga0182008_1000089516 320
202 3300014497 Ga0182008_10001910 Ga0182008_100019103 320
203 3300014497 Ga0182008_10010159 Ga0182008_100101592 320
204 3300014497 Ga0182008_10024591 Ga0182008_100245913 320
205 3300014497 Ga0182008_10099705 Ga0182008_100997052 320
206 3300015261 Ga0182006_1001142 Ga0182006_10011429 320
207 3300015262 Ga0182007_10000296 Ga0182007_1000029623 320
208 3300015262 Ga0182007_10006652 Ga0182007_100066522 320
209 3300015262 Ga0182007_10040255 Ga0182007_100402551 320
210 3300017792 Ga0163161_10139162 Ga0163161_101391622 320
211 3300025292 Ga0209676_1000006 Ga0209676_1000006147 320
212 3300025298 Ga0209050_1000260 Ga0209050_100026074 320
213 3300025303 Ga0209051_1000163 Ga0209051_100016348 320
214 3300025711 Ga0207696_1007488 Ga0207696_10074883 320
215 3300025728 Ga0207655_1000857 Ga0207655_100085722 320
216 3300025728 Ga0207655_1002467 Ga0207655_10024674 320
217 3300025728 Ga0207655_1005471 Ga0207655_10054714 320
218 3300025735 Ga0207713_1000874 Ga0207713_100087420 320
219 3300025735 Ga0207713_1000922 Ga0207713_100092216 320
220 3300025735 Ga0207713_1000968 Ga0207713_100096818 320
221 3300025735 Ga0207713_1002700 Ga0207713_10027007 320
222 3300025735 Ga0207713_1002702 Ga0207713_10027027 320
223 3300027111 Ga0209281_1000902 Ga0209281_100090215 320
224 3300031911 Ga0307412_10019510 Ga0307412_100195102 320
225 3300041405 Ga0439438_000275 Ga0439438_000275_1183_2145 320
226 3300041405 Ga0439438_000596 Ga0439438_000596_13998_14960 320
227 3300041405 Ga0439438_003934 Ga0439438_003934_3364_4326 320
228 3300041407 Ga0439447_000245 Ga0439447_000245_16165_17127 320
229 3300041407 Ga0439447_000384 Ga0439447_000384_13439_14401 320
230 3300041407 Ga0439447_011308 Ga0439447_011308_350_1312 320
231 3300041411 Ga0439466_0000299 Ga0439466_0000299_17773_18735 320
232 3300041411 Ga0439466_0001066 Ga0439466_0001066_317_1279 320
233 3300041411 Ga0439466_0001858 Ga0439466_0001858_7134_8096 320
234 3300041411 Ga0439466_0002388 Ga0439466_0002388_5737_6699 320
235 3300041411 Ga0439466_0006811 Ga0439466_0006811_3360_4322 320
236 3300041411 Ga0439466_0025631 Ga0439466_0025631_431_1393 320
237 3300041411 Ga0439466_0039701 Ga0439466_0039701_27_989 320
238 3300042006 Ga0439432_000110 Ga0439432_000110_20907_21869 320
239 3300042006 Ga0439432_000124 Ga0439432_000124_5310_6272 320
240 3300042006 Ga0439432_000253 Ga0439432_000253_15024_15986 320
241 3300042006 Ga0439432_003903 Ga0439432_003903_3030_3992 320
242 3300042006 Ga0439432_016413 Ga0439432_016413_1243_2247 320
243 3300042009 Ga0439451_000014 Ga0439451_000014_37846_38808 320
244 3300042009 Ga0439451_000034 Ga0439451_000034_25091_26053 320
245 3300042009 Ga0439451_004151 Ga0439451_004151_1416_2378 320
246 3300042009 Ga0439451_007854 Ga0439451_007854_592_1557 320
247 3300042009 Ga0439451_013885 Ga0439451_013885_73_1035 320
248 3300042010 Ga0439452_000404 Ga0439452_000404_5344_6306 320
249 3300042010 Ga0439452_000609 Ga0439452_000609_16606_17568 320
250 3300042010 Ga0439452_003589 Ga0439452_003589_2641_3603 320
251 3300042010 Ga0439452_011111 Ga0439452_011111_300_1262 320
252 3300042013 Ga0439456_000412 Ga0439456_000412_7948_8910 320
253 3300042013 Ga0439456_009742 Ga0439456_009742_146_1111 320
254 3300042016 Ga0439463_003707 Ga0439463_003707_994_1956 320
255 3300042115 Ga0450911_001202 Ga0450911_001202_3340_4302 320
256 3300042127 Ga0450890_000319 Ga0450890_000319_605_1567 320
257 3300042145 Ga0450906_000022 Ga0450906_000022_21217_22179 320
258 3300042461 Ga0439460_0003078 Ga0439460_0003078_1216_2178 320
259 3300042461 Ga0439460_0010507 Ga0439460_0010507_260_1222 320
260 3300042993 Ga0439440_0000005 Ga0439440_0000005_25646_26608 320
261 3300046452 Ga0495617_000200 Ga0495617_000200_5519_6481 320
262 3300046452 Ga0495617_002914 Ga0495617_002914_4613_5584 320
263 3300046454 Ga0495592_0000531 Ga0495592_0000531_5216_6178 320
264 3300046457 Ga0495590_0000248 Ga0495590_0000248_5504_6466 320
265 3300046457 Ga0495590_0000508 Ga0495590_0000508_5443_6405 320
266 3300046457 Ga0495590_0002700 Ga0495590_0002700_2413_3384 320
267 3300046457 Ga0495590_0003717 Ga0495590_0003717_1564_2526 320
268 3300046458 Ga0495591_001574 Ga0495591_001574_4702_5742 320
269 3300046460 Ga0495638_0004298 Ga0495638_0004298_6491_7459 320
270 3300046460 Ga0495638_0008559 Ga0495638_0008559_3668_4648 320
271 3300046460 Ga0495638_0010747 Ga0495638_0010747_3715_4677 320
272 3300046463 Ga0495653_0000688 Ga0495653_0000688_5610_6572 320
273 3300046463 Ga0495653_0050710 Ga0495653_0050710_1292_2332 320
274 3300046463 Ga0495653_0056066 Ga0495653_0056066_1697_2659 320
275 3300046463 Ga0495653_0069361 Ga0495653_0069361_743_1783 320
276 3300046463 Ga0495653_0093976 Ga0495653_0093976_620_1582 320
277 3300046471 Ga0495650_0001217 Ga0495650_0001217_24315_25277 320
278 3300046471 Ga0495650_0001799 Ga0495650_0001799_12917_13879 320
279 3300046474 Ga0495605_0000672 Ga0495605_0000672_23080_24042 320
280 3300046474 Ga0495605_0000747 Ga0495605_0000747_21172_22134 320
281 3300046474 Ga0495605_0000753 Ga0495605_0000753_20950_21912 320
282 3300046475 Ga0495639_0000020 Ga0495639_0000020_67539_68579 320
283 3300046475 Ga0495639_0047080 Ga0495639_0047080_254_1216 320
284 3300046491 Ga0495584_0000285 Ga0495584_0000285_5625_6587 320
285 3300046491 Ga0495584_0005176 Ga0495584_0005176_4437_5399 320
286 3300046492 Ga0495585_0000754 Ga0495585_0000754_4668_5630 320
287 3300046492 Ga0495585_0000810 Ga0495585_0000810_5387_6349 320
288 3300046492 Ga0495585_0010050 Ga0495585_0010050_62_1024 320
289 3300046499 Ga0495594_0001261 Ga0495594_0001261_3491_4453 320
290 3300046499 Ga0495594_0085285 Ga0495594_0085285_262_1224 320
291 3300046501 Ga0495607_0000639 Ga0495607_0000639_5504_6466 320
292 3300046501 Ga0495607_0001640 Ga0495607_0001640_12959_13921 320
293 3300046501 Ga0495607_0022922 Ga0495607_0022922_432_1472 320
294 3300046506 Ga0495583_0003148 Ga0495583_0003148_6705_7667 320
295 3300046506 Ga0495583_0021085 Ga0495583_0021085_1483_2523 320
296 3300046512 Ga0495610_0000774 Ga0495610_0000774_1810_2808 320
297 3300046513 Ga0495616_0000484 Ga0495616_0000484_2525_3487 320
298 3300046513 Ga0495616_0000598 Ga0495616_0000598_21541_22545 320
299 3300046513 Ga0495616_0001079 Ga0495616_0001079_5452_6414 320
300 3300046513 Ga0495616_0003336 Ga0495616_0003336_4556_5596 320
301 3300046515 Ga0495620_0000266 Ga0495620_0000266_1650_2612 320
302 3300046516 Ga0495628_0053262 Ga0495628_0053262_1422_2462 320
303 3300046516 Ga0495628_0079819 Ga0495628_0079819_1151_2113 320
304 3300046518 Ga0495631_0045680 Ga0495631_0045680_149_1111 320
305 3300046519 Ga0495632_0000481 Ga0495632_0000481_32321_33283 320
306 3300046519 Ga0495632_0000527 Ga0495632_0000527_5607_6569 320
307 3300046519 Ga0495632_0003678 Ga0495632_0003678_5267_6271 320
308 3300046520 Ga0495637_0000538 Ga0495637_0000538_4593_5555 320
309 3300046520 Ga0495637_0001828 Ga0495637_0001828_6597_7559 320
310 3300046520 Ga0495637_0003584 Ga0495637_0003584_6219_7181 320
311 3300046522 Ga0495643_0001100 Ga0495643_0001100_2187_3149 320
312 3300046522 Ga0495643_0001350 Ga0495643_0001350_969_1931 320
313 3300046522 Ga0495643_0007756 Ga0495643_0007756_1638_2600 320
314 3300046523 Ga0495644_0010671 Ga0495644_0010671_1013_1975 320
315 3300046524 Ga0495648_0001939 Ga0495648_0001939_15142_16146 320
316 3300046526 Ga0495666_0001366 Ga0495666_0001366_4615_5577 320
317 3300046526 Ga0495666_0056397 Ga0495666_0056397_502_1464 320
318 3300046526 Ga0495666_0056823 Ga0495666_0056823_53_1015 320
319 3300046526 Ga0495666_0081892 Ga0495666_0081892_53_1015 320
320 3300046528 Ga0495642_0000096 Ga0495642_0000096_47831_48793 320
321 3300046528 Ga0495642_0000173 Ga0495642_0000173_4601_5641 320
322 3300046530 Ga0495654_0000499 Ga0495654_0000499_25640_26644 320
323 3300046530 Ga0495654_0000642 Ga0495654_0000642_4505_5467 320
324 3300046530 Ga0495654_0001445 Ga0495654_0001445_12161_13123 320
325 3300046530 Ga0495654_0008310 Ga0495654_0008310_2954_3916 320
326 3300046535 Ga0495586_0028037 Ga0495586_0028037_670_1710 320
327 3300046536 Ga0495587_0034341 Ga0495587_0034341_1492_2454 320
328 3300046536 Ga0495587_0038636 Ga0495587_0038636_729_1691 320
329 3300046536 Ga0495587_0124596 Ga0495587_0124596_370_1332 320
330 3300046538 Ga0495609_0000396 Ga0495609_0000396_5470_6432 320
331 3300046538 Ga0495609_0000661 Ga0495609_0000661_20456_21418 320
332 3300046538 Ga0495609_0000689 Ga0495609_0000689_1849_2811 320
333 3300046542 Ga0495597_0078156 Ga0495597_0078156_21_1061 320
334 3300046543 Ga0495645_0013415 Ga0495645_0013415_3332_4294 320
335 3300046557 Ga0495622_0001378 Ga0495622_0001378_5406_6446 320
336 3300046616 Ga0495668_0015580 Ga0495668_0015580_1672_2712 320
337 3300046642 Ga0495634_0000578 Ga0495634_0000578_32838_33800 320
338 3300046642 Ga0495634_0008816 Ga0495634_0008816_1451_2413 320
339 3300046648 Ga0495611_0008381 Ga0495611_0008381_1802_2764 320
340 3300046648 Ga0495611_0012517 Ga0495611_0012517_154_1116 320
341 3300046660 Ga0495625_0002521 Ga0495625_0002521_1365_2327 320
342 3300046660 Ga0495625_0023052 Ga0495625_0023052_2342_3382 320
343 3300046660 Ga0495625_0075407 Ga0495625_0075407_1216_2220 320
344 3300046663 Ga0495635_0011862 Ga0495635_0011862_3309_4271 320
345 3300046663 Ga0495635_0220863 Ga0495635_0220863_245_1207 320
346 3300046664 Ga0495659_0000827 Ga0495659_0000827_8283_9323 320
347 3300046664 Ga0495659_0000914 Ga0495659_0000914_5128_6168 320
348 3300046664 Ga0495659_0002964 Ga0495659_0002964_1533_2537 320
349 3300046665 Ga0495661_0007415 Ga0495661_0007415_4492_5454 320
350 3300046665 Ga0495661_0038352 Ga0495661_0038352_692_1732 320
351 3300046674 Ga0495588_0000332 Ga0495588_0000332_25700_26662 320
352 3300046674 Ga0495588_0071692 Ga0495588_0071692_371_1333 320
353 3300046679 Ga0495623_0003974 Ga0495623_0003974_7208_8170 320
354 3300046680 Ga0495646_0000141 Ga0495646_0000141_1671_2711 320
355 3300046680 Ga0495646_0002439 Ga0495646_0002439_5498_6460 320
356 3300046680 Ga0495646_0003293 Ga0495646_0003293_4515_5477 320
357 3300046680 Ga0495646_0039256 Ga0495646_0039256_1741_2781 320
358 3300046684 Ga0495669_0010329 Ga0495669_0010329_1379_2341 320
359 3300046689 Ga0495613_0000653 Ga0495613_0000653_21004_21966 320
360 3300046689 Ga0495613_0042100 Ga0495613_0042100_959_1999 320
361 3300046690 Ga0495624_0000531 Ga0495624_0000531_23258_24220 320
362 3300046691 Ga0495670_0002412 Ga0495670_0002412_2919_3923 320
363 3300046691 Ga0495670_0041092 Ga0495670_0041092_797_1759 320
364 3300046692 Ga0495671_0003934 Ga0495671_0003934_2700_3662 320
365 3300046692 Ga0495671_0026188 Ga0495671_0026188_36_998 320
366 3300046692 Ga0495671_0107076 Ga0495671_0107076_293_1297 320
367 3300046694 Ga0495649_0000432 Ga0495649_0000432_29649_30611 320
368 3300046694 Ga0495649_0013172 Ga0495649_0013172_3410_4372 320
369 3300046794 Ga0495589_0000578 Ga0495589_0000578_1203_2165 320
370 3300046794 Ga0495589_0001569 Ga0495589_0001569_10761_11723 320
371 3300046794 Ga0495589_0005779 Ga0495589_0005779_4887_5927 320
372 3300046794 Ga0495589_0017798 Ga0495589_0017798_1270_2232 320
373 3300046809 Ga0495600_0000799 Ga0495600_0000799_5498_6460 320
374 3300046809 Ga0495600_0019131 Ga0495600_0019131_1983_2945 320
375 3300046810 Ga0495660_0110011 Ga0495660_0110011_382_1344 320
376 3300047315 Ga0495581_0035148 Ga0495581_0035148_770_1810 320
377 3300047317 Ga0495604_0046768 Ga0495604_0046768_77_1039 320
378 3300047318 Ga0495636_0000132 Ga0495636_0000132_24248_25210 320
379 3300047318 Ga0495636_0000191 Ga0495636_0000191_1601_2563 320
380 3300047319 Ga0495674_0012454 Ga0495674_0012454_5206_6168 320
381 3300047320 Ga0495672_0000378 Ga0495672_0000378_48721_49683 320
382 3300047320 Ga0495672_0000938 Ga0495672_0000938_23943_24905 320
383 3300047320 Ga0495672_0001359 Ga0495672_0001359_1802_2764 320
384 3300047320 Ga0495672_0019821 Ga0495672_0019821_2135_3175 320
385 3300047321 Ga0495676_0000691 Ga0495676_0000691_22491_23453 320
386 3300047322 Ga0495680_0000664 Ga0495680_0000664_31839_32801 320
387 3300047322 Ga0495680_0002689 Ga0495680_0002689_12296_13258 320
388 3300047322 Ga0495680_0004075 Ga0495680_0004075_5512_6474 320
389 3300047322 Ga0495680_0037989 Ga0495680_0037989_1424_2386 320
390 3300047323 Ga0495683_0005807 Ga0495683_0005807_1203_2243 320
391 3300047323 Ga0495683_0013255 Ga0495683_0013255_2151_3191 320
392 3300047443 Ga0495687_003617 Ga0495687_003617_3660_4700 320
393 3300047443 Ga0495687_004145 Ga0495687_004145_3834_4796 320
394 3300047444 Ga0495675_0007945 Ga0495675_0007945_5481_6443 320
395 3300047445 Ga0495677_0000289 Ga0495677_0000289_2571_3611 320
396 3300047446 Ga0495679_007490 Ga0495679_007490_2422_3462 320
397 3300047446 Ga0495679_007641 Ga0495679_007641_248_1210 320
398 3300047447 Ga0495685_005424 Ga0495685_005424_1263_2303 320
399 3300047469 Ga0495673_0005939 Ga0495673_0005939_3114_4076 320
400 3300047469 Ga0495673_0012152 Ga0495673_0012152_1931_2893 320
401 3300047469 Ga0495673_0105955 Ga0495673_0105955_140_1102 320
402 3300047470 Ga0495681_0001243 Ga0495681_0001243_12928_13890 320
403 3300047471 Ga0495684_0000839 Ga0495684_0000839_4549_5511 320
404 3300047673 Ga0495593_0002585 Ga0495593_0002585_5514_6476 320
405 3300047673 Ga0495593_0062353 Ga0495593_0062353_935_1897 320
406 3300047673 Ga0495593_0068483 Ga0495593_0068483_52_1014 320
407 3300048088 Ga0495602_0000857 Ga0495602_0000857_5556_6518 320
408 3300048091 Ga0495626_0000699 Ga0495626_0000699_1727_2689 320
409 3300048091 Ga0495626_0000819 Ga0495626_0000819_5496_6500 320
410 3300048091 Ga0495626_0002809 Ga0495626_0002809_5262_6302 320
411 3300048091 Ga0495626_0002836 Ga0495626_0002836_5267_6229 320
412 3300048905 Ga0496102_0000519 Ga0496102_0000519_39206_40168 320
413 3300048906 Ga0496103_0001796 Ga0496103_0001796_1740_2780 320
414 3300048909 Ga0496106_0067157 Ga0496106_0067157_860_1900 320
415 3300048919 Ga0496116_0000427 Ga0496116_0000427_5388_6428 320
416 3300048920 Ga0496117_0011811 Ga0496117_0011811_1450_2490 320
417 3300048922 Ga0496119_0001431 Ga0496119_0001431_5324_6286 320
418 3300048923 Ga0496120_0001617 Ga0496120_0001617_3853_4815 320
419 3300048924 Ga0496121_0026838 Ga0496121_0026838_1955_2995 320
420 3300048925 Ga0496122_0007463 Ga0496122_0007463_1699_2739 320
421 3300048927 Ga0496124_0003020 Ga0496124_0003020_2007_2969 320
422 3300048927 Ga0496124_0028385 Ga0496124_0028385_2585_3625 320
423 3300048928 Ga0496125_0010025 Ga0496125_0010025_4564_5526 320
424 3300048929 Ga0496126_0042249 Ga0496126_0042249_3011_3973 320
425 3300049459 Ga0495678_000569 Ga0495678_000569_4685_5647 320
426 3300049459 Ga0495678_000928 Ga0495678_000928_20033_21037 320
427 3300049459 Ga0495678_003060 Ga0495678_003060_7181_8143 320
428 3300049460 Ga0495682_0000536 Ga0495682_0000536_20522_21484 320
429 3300049460 Ga0495682_0000651 Ga0495682_0000651_1221_2183 320
430 3300049460 Ga0495682_0000878 Ga0495682_0000878_12735_13697 320
431 3300049460 Ga0495682_0007016 Ga0495682_0007016_744_1706 320
432 3300053091 Ga0500647_0114953 Ga0500647_0114953_246_1208 320
433 3300053096 Ga0500641_0076060 Ga0500641_0076060_425_1387 320
434 iso_pu_bacteria 2919697872 2919701942 320
435 iso_pu_bacteria 8019775933 8019779323 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

32

258

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

33

285

0.83

PF04321

RmlD_sub_bind

RmlD substrate binding domain

30

272

0.83

PF13460

NAD_binding_10

NAD(P)H-binding

36

205

0.83

PF07993

NAD_binding_4

Male sterility protein

75

244

0.81

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

58

282

0.8

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

33

336

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8657 5 317
3m2p-assembly1.cif.gz_A the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8631 3 315
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8605 3 315
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8583 5 317
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8528 5 317
ID Description Score Start End Superfamily
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.86 6 232 3.40.50.720
af_I1JK06_1_360_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8561 1 316 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8521 5 234 3.40.50.720
af_P9WQP7_5_351_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8484 1 316 3.40.50.720
3eheB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8458 6 232 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q3QFD4-F1-model_v4 deleted 0.9876 61 314
AF-A0A0B8NZT0-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9765 68 320 GO:0003978
AF-W2TXR6-F1-model_v4 Putative epimerase/dehydratase WbiG 0.973 77 316
AF-A0A7Y2KF59-F1-model_v4 deleted 0.969 6 310
AF-A0A0B8NZT0-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9689 68 320 GO:0003978

Feature Viewer

pLDDT pTM Quality
90.99 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map