F443367

General Info

Members Datasets Scaffolds Average Seq Length
435 346 870 189

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0043198|Ga0373925_0043198_256_915
Length 219
Sequence MDRRIRRVSRIIRAGGDAAMRSWFVPILQFWFGDVDELGRSDVQHSRRWFMKDEALDREIADRFGQTYADVRGGLREAWLDDPRGRVAYVIVLDQFARNMFRGSARMFEGDRQALAAAVEGVAQHDDAELTVNERSFLYMPYQHSEEIGMQERSVALFKELAESAPSELRGSLAAAVQYAEKHREIIARFGRFPHRNTLLGRQSTPAELAFLAEPGSGF

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
104 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
163 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
184 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
187 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
192 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
269 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
270 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
276 2506520008 Serratia plymuthica AS12 Isolate Unclassified
277 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
278 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
279 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
280 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
281 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
282 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
283 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
284 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
285 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
286 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
287 2643221557 Ensifer sp. Root558 Isolate Unclassified
288 2643221610 Ensifer sp. Root74 Isolate Unclassified
289 2643221618 Ensifer sp. Root231 Isolate Unclassified
290 2643221626 Ensifer sp. Root31 Isolate Unclassified
291 2643221655 Ensifer sp. Root1252 Isolate Unclassified
292 2643221659 Ensifer sp. Root127 Isolate Unclassified
293 2643221668 Ensifer sp. Root423 Isolate Unclassified
294 2643221675 Ensifer sp. Root1298 Isolate Unclassified
295 2643221680 Ensifer sp. Root1312 Isolate Unclassified
296 2643221688 Rhizobium sp. Root482 Isolate Unclassified
297 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
298 2643221698 Ensifer sp. Root142 Isolate Unclassified
299 2643221712 Ensifer sp. Root258 Isolate Unclassified
300 2643221723 Ensifer sp. Root278 Isolate Unclassified
301 2643221726 Ensifer sp. Root954 Isolate Unclassified
302 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
303 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
304 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
305 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
306 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
307 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
308 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
309 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
310 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
311 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
312 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
313 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
314 2844163670 Ensifer sp. 1H6 Isolate Unclassified
315 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
316 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
317 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
318 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
319 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
320 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
321 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
322 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
323 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
324 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
325 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
326 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
327 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
328 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
329 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
330 2937967321 Serratia sp. YC16 Isolate Unclassified
331 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
332 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
333 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
334 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
335 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
336 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
337 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
338 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
339 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
340 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
341 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
342 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
343 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
344 640753048 Serratia proteamaculans 568 Isolate Endosphere
345 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
346 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.99
Metatranscriptomes 0.23
Isolates 16.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 10.8
Rhizoplane 4.6
Rhizosphere 64.37
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0043198 3300037068 Bacteria 3345
2 JGI25158J39367_1004629 3300002739 Bacteria 2058
3 JGI25152J39213_1015367 3300002773 Bacteria 1512
4 JGI25159J45721_1000020 3300002987 Bacteria 124791
5 JGI25151J46595_10001264 3300003187 Bacteria 17885
6 JGI25151J46595_10060881 3300003187 Bacteria 1205
7 rootH1_10003899 3300003316 Bacteria 2408
8 rootH1_10079257 3300003323 Bacteria 4594
9 JGI25160J50197_1000055 3300003354 Bacteria 124791
10 JGI25161J50226_1001297 3300003374 Bacteria 7909
11 Ga0055526_1022667 3300003771 Bacteria 2127
12 Ga0055524_1004529 3300003775 Bacteria 6401
13 Ga0055524_1012340 3300003775 Bacteria 3282
14 Ga0055524_1019752 3300003775 Bacteria 2293
15 Ga0055524_1028136 3300003775 Bacteria 1690
16 Ga0055536_1019227 3300003781 Bacteria 2157
17 Ga0055528_1002212 3300003790 Bacteria 10626
18 Ga0055530_10010082 3300003791 Bacteria 3542
19 Ga0055531_10003924 3300003794 Bacteria 9256
20 Ga0055543_1000508 3300004625 Bacteria 22389
21 Ga0065165_1000265 3300005262 Bacteria 90352
22 Ga0065703_1019585 3300005272 Bacteria 2710
23 Ga0065704_10103111 3300005289 Bacteria 2182
24 Ga0065704_10218479 3300005289 Bacteria 1083
25 Ga0065715_10208784 3300005293 Bacteria 1324
26 Ga0065707_10224827 3300005295 Bacteria 1185
27 Ga0070690_100001757 3300005330 Bacteria 11463
28 Ga0070690_100018534 3300005330 Bacteria 4207
29 Ga0070690_100045287 3300005330 Bacteria 2794
30 Ga0068869_100139917 3300005334 Bacteria 1868
31 Ga0068869_100527673 3300005334 Bacteria 989
32 Ga0070666_10007497 3300005335 Bacteria 6723
33 Ga0070666_10556379 3300005335 Bacteria 834
34 Ga0070666_10618846 3300005335 Bacteria 791
35 Ga0070682_100229141 3300005337 Bacteria 1327
36 Ga0068868_100124935 3300005338 Bacteria 2101
37 Ga0068868_100126314 3300005338 Bacteria 2090
38 Ga0070689_100010709 3300005340 Bacteria 6545
39 Ga0070689_100020745 3300005340 Bacteria 4880
40 Ga0070689_100253493 3300005340 Bacteria 1453
41 Ga0070691_10007475 3300005341 Bacteria 5011
42 Ga0070692_10233993 3300005345 Bacteria 1092
43 Ga0070669_100065477 3300005353 Bacteria 2677
44 Ga0070675_100112522 3300005354 Bacteria 2305
45 Ga0070675_100196494 3300005354 Bacteria 1750
46 Ga0070671_100018049 3300005355 Bacteria 5725
47 Ga0070674_100011742 3300005356 Bacteria 5345
48 Ga0070673_100000104 3300005364 Bacteria 38120
49 Ga0070673_100043709 3300005364 Bacteria 3464
50 Ga0070673_100056087 3300005364 Bacteria 3107
51 Ga0070673_100148713 3300005364 Bacteria 1982
52 Ga0070688_100015030 3300005365 Bacteria 4395
53 Ga0070688_100016660 3300005365 Bacteria 4204
54 Ga0070659_101225906 3300005366 Bacteria 664
55 Ga0070667_100008074 3300005367 Bacteria 8729
56 Ga0070667_100249348 3300005367 Bacteria 1587
57 Ga0070701_10043997 3300005438 Bacteria 2286
58 Ga0070700_100020203 3300005441 Bacteria 3854
59 Ga0070694_100261523 3300005444 Bacteria 1313
60 Ga0070694_100781036 3300005444 Bacteria 782
61 Ga0070663_100423562 3300005455 Bacteria 1092
62 Ga0070678_100142808 3300005456 Bacteria 1918
63 Ga0068867_100031006 3300005459 Bacteria 3858
64 Ga0070685_10081198 3300005466 Bacteria 1944
65 Ga0070698_100306055 3300005471 Bacteria 1520
66 Ga0070684_100028474 3300005535 Bacteria 4726
67 Ga0070684_100636011 3300005535 Bacteria 993
68 Ga0068853_100545475 3300005539 Bacteria 1098
69 Ga0070672_100045471 3300005543 Bacteria 3396
70 Ga0070672_100102402 3300005543 Bacteria 2324
71 Ga0070686_100050144 3300005544 Bacteria 2651
72 Ga0070686_100218485 3300005544 Bacteria 1376
73 Ga0070686_100241712 3300005544 Bacteria 1315
74 Ga0070693_100351325 3300005547 Bacteria 1009
75 Ga0070665_100020765 3300005548 Bacteria 6600
76 Ga0070665_100077190 3300005548 Bacteria 3337
77 Ga0070704_100946763 3300005549 Bacteria 777
78 Ga0068854_100320534 3300005578 Bacteria 1259
79 Ga0070702_100457985 3300005615 Bacteria 927
80 Ga0068859_100046441 3300005617 Bacteria 4361
81 Ga0068864_100079658 3300005618 Bacteria 2869
82 Ga0068866_10080173 3300005718 Bacteria 1751
83 Ga0068861_100632775 3300005719 Bacteria 986
84 Ga0068861_101069041 3300005719 Bacteria 774
85 Ga0068863_100126913 3300005841 Bacteria 2434
86 Ga0068858_100048940 3300005842 Bacteria 3915
87 Ga0068858_100345103 3300005842 Bacteria 1425
88 Ga0068858_100414749 3300005842 Bacteria 1295
89 Ga0068860_100121506 3300005843 Bacteria 2501
90 Ga0068862_100591180 3300005844 Bacteria 1064
91 Ga0081539_10034205 3300005985 Bacteria 3078
92 Ga0070715_10065893 3300006163 Bacteria 1604
93 Ga0070712_100464240 3300006175 Bacteria 1056
94 Ga0075366_10077775 3300006195 Bacteria 1980
95 Ga0097621_100021811 3300006237 Bacteria 4963
96 Ga0075370_10103582 3300006353 Bacteria 1649
97 Ga0068871_100361318 3300006358 Bacteria 1286
98 Ga0075428_100688770 3300006844 Bacteria 1089
99 Ga0075430_100162791 3300006846 Bacteria 1857
100 Ga0075429_100217457 3300006880 Bacteria 1674
101 Ga0068865_100001875 3300006881 Bacteria 12360
102 Ga0068865_100063961 3300006881 Unclassified 2588
103 Ga0097620_100046441 3300006931 Bacteria 4361
104 Ga0079104_1001522 3300006946 Bacteria 15322
105 Ga0105251_10000119 3300009011 Bacteria 79040
106 Ga0105251_10002336 3300009011 Bacteria 15006
107 Ga0105244_10070706 3300009036 Bacteria 1741
108 Ga0105250_10001728 3300009092 Bacteria 11514
109 Ga0111539_10015342 3300009094 Bacteria 9538
110 Ga0111539_10548538 3300009094 Bacteria 1347
111 Ga0105245_10008954 3300009098 Bacteria 8729
112 Ga0105245_11069625 3300009098 Bacteria 852
113 Ga0105247_10000025 3300009101 Bacteria 208459
114 Ga0105247_10018427 3300009101 Bacteria 4187
115 Ga0114129_10162091 3300009147 Bacteria 3054
116 Ga0105243_10542828 3300009148 Unclassified 1109
117 Ga0105241_10000004 3300009174 Bacteria 803007
118 Ga0105242_10626687 3300009176 Unclassified 1043
119 Ga0105248_10039806 3300009177 Bacteria 5268
120 Ga0105249_10131991 3300009553 Bacteria 2385
121 Ga0157373_10000690 3300013100 Bacteria 26488
122 Ga0171463_1003 3300013249 Bacteria 695693
123 Ga0157374_10273404 3300013296 Bacteria 1666
124 Ga0157378_10046548 3300013297 Bacteria 3856
125 Ga0157378_10127492 3300013297 Bacteria 2352
126 Ga0163162_11048280 3300013306 Bacteria 923
127 Ga0157375_10034660 3300013308 Bacteria 4810
128 Ga0157375_10519443 3300013308 Bacteria 1354
129 Ga0163163_10105959 3300014325 Bacteria 2837
130 Ga0157380_10002596 3300014326 Bacteria 12212
131 Ga0157380_10028584 3300014326 Bacteria 4253
132 Ga0157380_11953719 3300014326 Bacteria 648
133 Ga0182008_10003944 3300014497 Bacteria 8783
134 Ga0157379_10012952 3300014968 Bacteria 7295
135 Ga0157376_10133468 3300014969 Bacteria 2218
136 Ga0183363_1044 3300015690 Bacteria 40716
137 Ga0163161_10000001 3300017792 Bacteria 2041488
138 Ga0214542_1000604 3300021321 Bacteria 66321
139 Ga0214543_1000028 3300021327 Bacteria 214029
140 Ga0228711_1000016 3300022739 Bacteria 126351
141 Ga0228710_1000013 3300022740 Bacteria 145976
142 Ga0209436_103733 3300025208 Bacteria 3944
143 Ga0209129_1000161 3300025258 Bacteria 102017
144 Ga0209565_1041003 3300025263 Bacteria 862
145 Ga0209673_1000010 3300025273 Bacteria 596656
146 Ga0209130_1000026 3300025284 Bacteria 334058
147 Ga0209130_1008856 3300025284 Bacteria 2926
148 Ga0209676_1005276 3300025292 Bacteria 6826
149 Ga0209676_1012667 3300025292 Bacteria 3291
150 Ga0209025_1000162 3300025294 Bacteria 166313
151 Ga0209025_1001199 3300025294 Bacteria 36533
152 Ga0209564_1000208 3300025295 Bacteria 134794
153 Ga0209050_1016223 3300025298 Bacteria 3063
154 Ga0209256_1000042 3300025299 Bacteria 341821
155 Ga0209256_1007074 3300025299 Bacteria 5671
156 Ga0207426_1000006 3300025302 Bacteria 1025969
157 Ga0209051_1016452 3300025303 Bacteria 3346
158 Ga0209257_1002448 3300025304 Bacteria 18439
159 Ga0207696_1000001 3300025711 Bacteria 2579611
160 Ga0207713_1000024 3300025735 Bacteria 339156
161 Ga0207713_1000026 3300025735 Bacteria 319032
162 Ga0207710_10000140 3300025900 Bacteria 83223
163 Ga0207680_10111078 3300025903 Bacteria 1778
164 Ga0207680_10163315 3300025903 Bacteria 1495
165 Ga0207647_10374258 3300025904 Bacteria 805
166 Ga0207685_10057258 3300025905 Bacteria 1528
167 Ga0207645_10059555 3300025907 Bacteria 2439
168 Ga0207654_10000006 3300025911 Bacteria 815027
169 Ga0207662_10089213 3300025918 Bacteria 1894
170 Ga0207662_10567259 3300025918 Bacteria 787
171 Ga0207681_10156606 3300025923 Bacteria 1712
172 Ga0207659_10262314 3300025926 Bacteria 1406
173 Ga0207659_10351977 3300025926 Bacteria 1222
174 Ga0207659_10755160 3300025926 Bacteria 834
175 Ga0207644_10118488 3300025931 Bacteria 2012
176 Ga0207706_10843971 3300025933 Bacteria 776
177 Ga0207670_10014580 3300025936 Bacteria 4672
178 Ga0207670_10064170 3300025936 Bacteria 2516
179 Ga0207670_10217286 3300025936 Bacteria 1461
180 Ga0207669_10091771 3300025937 Bacteria 1979
181 Ga0207704_10013306 3300025938 Bacteria 4114
182 Ga0207704_10090680 3300025938 Bacteria 2007
183 Ga0207691_10033322 3300025940 Bacteria 4796
184 Ga0207691_10080669 3300025940 Bacteria 2926
185 Ga0207711_10008514 3300025941 Bacteria 8582
186 Ga0207689_10421182 3300025942 Bacteria 1114
187 Ga0207661_10006901 3300025944 Bacteria 8050
188 Ga0207651_10002617 3300025960 Bacteria 8602
189 Ga0207651_10431272 3300025960 Bacteria 1127
190 Ga0207658_10069244 3300025986 Bacteria 2665
191 Ga0207658_10293877 3300025986 Bacteria 1397
192 Ga0207658_10420537 3300025986 Bacteria 1178
193 Ga0207677_10289027 3300026023 Unclassified 1349
194 Ga0207703_10012028 3300026035 Bacteria 6740
195 Ga0207703_10172533 3300026035 Bacteria 1903
196 Ga0207708_10300749 3300026075 Bacteria 1305
197 Ga0207641_10045370 3300026088 Bacteria 3701
198 Ga0207648_10108753 3300026089 Unclassified 2434
199 Ga0207676_10022585 3300026095 Bacteria 4628
200 Ga0207675_100000361 3300026118 Bacteria 43555
201 Ga0207675_100579674 3300026118 Bacteria 1123
202 Ga0207675_100993744 3300026118 Bacteria 857
203 Ga0207683_10045715 3300026121 Bacteria 3829
204 Ga0207683_10123462 3300026121 Bacteria 2326
205 Ga0209281_1000008 3300027111 Bacteria 867470
206 Ga0209281_1000221 3300027111 Bacteria 122380
207 Ga0209282_1000041 3300027666 Bacteria 122268
208 Ga0209971_1075743 3300027682 Unclassified 818
209 Ga0207428_10193599 3300027907 Bacteria 1532
210 Ga0268266_10007701 3300028379 Bacteria 9669
211 Ga0268266_10108270 3300028379 Bacteria 2459
212 Ga0268265_10306351 3300028380 Bacteria 1432
213 Ga0268264_10077749 3300028381 Bacteria 2827
214 Ga0307408_100012958 3300031548 Bacteria 5528
215 Ga0307408_100163112 3300031548 Bacteria 1772
216 Ga0307413_10033447 3300031824 Bacteria 2928
217 Ga0307413_10793717 3300031824 Bacteria 795
218 Ga0307407_10364838 3300031903 Bacteria 1027
219 Ga0307412_10232036 3300031911 Bacteria 1422
220 Ga0315914_1000030 3300031967 Bacteria 102599
221 Ga0307409_100369306 3300031995 Bacteria 1360
222 Ga0316593_10024439 3300032168 Bacteria 1915
223 Ga0315913_1000017 3300033430 Bacteria 102835
224 Ga0315915_1000017 3300033464 Bacteria 148111
225 Ga0373959_0026654 3300034820 Bacteria 1143
226 Ga0373934_0170663 3300035086 Bacteria 893
227 Ga0373936_0164129 3300035113 Bacteria 969
228 Ga0373954_0114422 3300035118 Bacteria 1307
229 Ga0373955_0088505 3300035172 Bacteria 1761
230 Ga0373955_0146147 3300035172 Bacteria 1389
231 Ga0373942_0083939 3300035207 Bacteria 950
232 Ga0373961_0005153 3300035241 Bacteria 3144
233 Ga0373931_0035863 3300035691 Bacteria 2581
234 Ga0373935_0015446 3300035692 Bacteria 4616
235 Ga0373935_0123363 3300035692 Bacteria 1733
236 Ga0373927_0433430 3300035695 Bacteria 868
237 Ga0373933_0046142 3300035724 Bacteria 2586
238 Ga0373947_0102977 3300035725 Bacteria 1796
239 Ga0373947_0153204 3300035725 Bacteria 1486
240 Ga0373947_0405281 3300035725 Bacteria 920
241 Ga0373937_0010930 3300036401 Bacteria 7950
242 Ga0373937_0107330 3300036401 Bacteria 2596
243 Ga0373937_0439227 3300036401 Bacteria 1239
244 Ga0373925_0139373 3300037068 Bacteria 1897
245 Ga0395899_0156131 3300037312 Bacteria 1614
246 Ga0395900_0025377 3300037418 Bacteria 6067
247 Ga0395898_0309570 3300037466 Bacteria 1506
248 Ga0395905_0344516 3300037471 Bacteria 1381
249 Ga0400483_029299 3300039062 Unclassified 3807
250 Ga0400483_216577 3300039062 Bacteria 7725
251 Ga0439436_0035385 3300041404 Bacteria 1442
252 Ga0439438_052690 3300041405 Bacteria 1031
253 Ga0439447_052801 3300041407 Bacteria 967
254 Ga0439465_0032874 3300041413 Bacteria 1657
255 Ga0451791_1315162 3300041451 Bacteria 1239
256 Ga0451837_0830409 3300041494 Bacteria 956
257 Ga0439445_0000253 3300042004 Bacteria 10167
258 Ga0439432_002156 3300042006 Bacteria 7425
259 Ga0439449_0005077 3300042007 Bacteria 5063
260 Ga0450895_000161 3300042132 Bacteria 3097
261 Ga0450896_021204 3300042133 Bacteria 954
262 Ga0450906_004428 3300042145 Bacteria 2945
263 Ga0450908_018875 3300042184 Bacteria 1216
264 Ga0439435_0027276 3300042436 Bacteria 1527
265 Ga0450918_005173 3300042531 Bacteria 2351
266 Ga0450918_069328 3300042531 Bacteria 660
267 Ga0451577_0369339 3300042876 Bacteria 1301
268 Ga0453683_0133331 3300044673 Bacteria 1566
269 Ga0451576_0019065 3300045051 Bacteria 7497
270 Ga0451576_0232537 3300045051 Bacteria 1925
271 Ga0495627_000018 3300046453 Bacteria 315125
272 Ga0495592_0230569 3300046454 Bacteria 1233
273 Ga0495651_0006879 3300046462 Bacteria 8692
274 Ga0495653_0318443 3300046463 Bacteria 1009
275 Ga0495639_0142140 3300046475 Unclassified 1154
276 Ga0495606_0003152 3300046507 Bacteria 17859
277 Ga0495608_0076028 3300046511 Bacteria 2188
278 Ga0495628_0136288 3300046516 Bacteria 1876
279 Ga0495630_0067433 3300046517 Unclassified 2690
280 Ga0495654_0001734 3300046530 Bacteria 14624
281 Ga0495654_0089176 3300046530 Bacteria 1433
282 Ga0495640_0030924 3300046533 Bacteria 3828
283 Ga0495586_0038404 3300046535 Bacteria 2571
284 Ga0495667_0094771 3300046559 Bacteria 1933
285 Ga0495634_0000799 3300046642 Bacteria 30556
286 Ga0495634_0281103 3300046642 Bacteria 1011
287 Ga0495635_0138928 3300046663 Bacteria 1655
288 Ga0495599_0237155 3300046678 Bacteria 1113
289 Ga0495623_0214020 3300046679 Bacteria 1102
290 Ga0495658_0087335 3300046683 Bacteria 1841
291 Ga0495589_0000002 3300046794 Bacteria 758846
292 Ga0495674_0004182 3300047319 Bacteria 13917
293 Ga0495674_0073541 3300047319 Bacteria 2946
294 Ga0495680_0129833 3300047322 Bacteria 1853
295 Ga0496101_0040791 3300048904 Bacteria 3307
296 Ga0496103_0043765 3300048906 Bacteria 2758
297 Ga0496104_0008291 3300048907 Bacteria 9229
298 Ga0496104_0221833 3300048907 Bacteria 1803
299 Ga0496105_0020164 3300048908 Bacteria 5384
300 Ga0496106_0194695 3300048909 Bacteria 1612
301 Ga0496106_0200579 3300048909 Bacteria 1588
302 Ga0496108_0005488 3300048911 Bacteria 10260
303 Ga0496108_0031824 3300048911 Bacteria 4379
304 Ga0496108_0039295 3300048911 Bacteria 3944
305 Ga0496109_0138138 3300048912 Bacteria 2278
306 Ga0496110_0013550 3300048913 Bacteria 6746
307 Ga0496111_0000693 3300048914 Bacteria 17777
308 Ga0496112_0061358 3300048915 Bacteria 3706
309 Ga0496112_0451867 3300048915 Bacteria 1223
310 Ga0496113_0544819 3300048916 Bacteria 931
311 Ga0496114_0000758 3300048917 Bacteria 24093
312 Ga0496115_0240320 3300048918 Bacteria 1492
313 Ga0496116_0000023 3300048919 Bacteria 475792
314 Ga0496117_0000463 3300048920 Bacteria 67832
315 Ga0496118_0003815 3300048921 Bacteria 18566
316 Ga0496119_0001891 3300048922 Bacteria 24077
317 Ga0496119_0004881 3300048922 Bacteria 13128
318 Ga0496119_0034001 3300048922 Bacteria 3367
319 Ga0496120_0000052 3300048923 Bacteria 186071
320 Ga0496120_0000137 3300048923 Bacteria 123518
321 Ga0496121_0184962 3300048924 Bacteria 1499
322 Ga0496122_0127377 3300048925 Bacteria 1626
323 Ga0496123_0105611 3300048926 Bacteria 1625
324 Ga0496124_0000017 3300048927 Bacteria 444389
325 Ga0496124_0623042 3300048927 Bacteria 697
326 Ga0496126_0010126 3300048929 Bacteria 9930
327 Ga0496126_0511237 3300048929 Bacteria 958
328 Ga0501036_0016473 3300049572 Bacteria 6174
329 Ga0501038_0209562 3300049574 Bacteria 1560
330 Ga0501039_0101614 3300049575 Bacteria 2244
331 Ga0501040_0146390 3300049576 Bacteria 1665
332 Ga0501048_0062089 3300049582 Bacteria 2645
333 Ga0501067_0025349 3300049583 Bacteria 3287
334 Ga0501068_0119888 3300049584 Bacteria 1640
335 Ga0501071_0206471 3300049587 Bacteria 1476
336 Ga0501072_0038692 3300049588 Bacteria 3744
337 Ga0501073_0068617 3300049589 Bacteria 2471
338 Ga0501075_0015576 3300049591 Bacteria 5457
339 Ga0501076_0006691 3300049592 Bacteria 8364
340 Ga0501077_0105578 3300049593 Bacteria 1785
341 Ga0501077_0120877 3300049593 Bacteria 1660
342 Ga0501079_0033564 3300049741 Bacteria 3948
343 Ga0501081_0013488 3300049743 Bacteria 5371
344 Ga0501081_0039616 3300049743 Bacteria 3226
345 Ga0501083_0349067 3300049744 Bacteria 962
346 Ga0501045_0000154 3300049824 Bacteria 36954
347 Ga0501045_0006742 3300049824 Bacteria 7954
348 nmdc:mga0yw44_378366_c1 3300050492 Bacteria 956
349 nmdc:mga05p37_186278_c1 3300050507 Bacteria 2523
350 nmdc:mga09592_218294_c1 3300050508 Bacteria 1652
351 nmdc:mga0qj67_246219_c1 3300050509 Bacteria 1450
352 nmdc:mga08y16_1995_c1 3300050511 Bacteria 20856
353 nmdc:mga08y16_28843_c1 3300050511 Bacteria 5850
354 Ga0495601_0068890 3300053077 Bacteria 2256
355 Ga0495619_0339468 3300053085 Bacteria 1040
356 Ga0500643_001524 3300053087 Bacteria 13197
357 Ga0500555_014224 3300053103 Eukaryota 2294
358 Ga0500607_001616 3300053121 Eukaryota 19904
359 Ga0500568_0001653 3300053139 Bacteria 13981
360 Ga0500624_027224 3300053157 Bacteria 962
361 Ga0501084_0042744 3300054114 Bacteria 3791
362 Ga0530510_0003503 3300061734 Bacteria 10788
363 2506577575 2506520007 Bacteria 5442880
364 2506582713 2506520008 Bacteria 5443009
365 2508851511 2508501071 Bacteria 5454741
366 2512533429 2512047086 Bacteria 6850303
367 2512971009 2512875026 Bacteria 6861065
368 2513604633 2513237089 Bacteria 6553624
369 2513984513 2513237156 Bacteria 6402557
370 2513996991 2513237159 Bacteria 6810126
371 2515608849 2515154107 Bacteria 6795637
372 2517570107 2517487022 Bacteria 7227575
373 2585200337 2582581294 Bacteria 6626667
374 2600195759 2599185352 Bacteria 7228948
375 2643803468 2643221557 Bacteria 7184309
376 2644067434 2643221610 Bacteria 7480339
377 2644107591 2643221618 Bacteria 7717186
378 2644146186 2643221626 Bacteria 8069654
379 2644308987 2643221655 Bacteria 7722067
380 2644332814 2643221659 Bacteria 7890716
381 2644375113 2643221668 Bacteria 7306521
382 2644418487 2643221675 Bacteria 7473456
383 2644451854 2643221680 Bacteria 7473610
384 2644491863 2643221688 Bacteria 5260751
385 2644501429 2643221689 Bacteria 6042950
386 2644540294 2643221698 Bacteria 7756764
387 2644614928 2643221712 Bacteria 7729434
388 2644676441 2643221723 Bacteria 7095460
389 2644690616 2643221726 Bacteria 7455827
390 2656277462 2654587920 Bacteria 5475511
391 2656279087 2654587920 Bacteria 5475511
392 2689444053 2687453601 Bacteria 5546041
393 2772438094 2772190666 Bacteria 5117644
394 2802719599 2802428858 Bacteria 6636079
395 2802726807 2802428859 Bacteria 6667919
396 2802732332 2802428860 Bacteria 6525526
397 2802739935 2802428861 Bacteria 6534206
398 2802745441 2802428862 Bacteria 6633353
399 2802752833 2802428863 Bacteria 6410669
400 2807177076 2806310673 Bacteria 4801221
401 2838079467 2838074704 Bacteria 6785777
402 2842522769 2842521101 Bacteria 6569494
403 2844167225 2844163670 Bacteria 7266046
404 2850081245 2850079185 Bacteria 6848280
405 2869553419 2869551831 Bacteria 5474685
406 2888368109 2888366609 Bacteria 5155009
407 2888374272 2888373701 Bacteria 5098052
408 2896384979 2896384573 Bacteria 7700774
409 2913299582 2913295892 Bacteria 6333755
410 2915981803 2915980308 Bacteria 6624279
411 2916067490 2916061851 Bacteria 6737736
412 2920824843 2920822456 Bacteria 6897201
413 2921251086 2921250672 Bacteria 6677771
414 2936998036 2936996657 Bacteria 6298727
415 2937031362 2937029754 Bacteria 6424026
416 2937039464 2937036028 Bacteria 6846469
417 2937079882 2937078374 Bacteria 6610289
418 2937090141 2937084907 Bacteria 6618516
419 2937969838 2937967321 Bacteria 5094075
420 2941504865 2941499720 Bacteria 7599444
421 2957376669 2957375807 Bacteria 6425588
422 2957438403 2957437181 Bacteria 6568994
423 2960592633 2960591022 Bacteria 6622873
424 2960635854 2960631154 Bacteria 6732508
425 2960681944 2960680706 Bacteria 6624464
426 2960694196 2960693952 Bacteria 6749742
427 2967690603 2967686174 Bacteria 6678622
428 2967735066 2967728569 Bacteria 6641507
429 2970031650 2970026789 Bacteria 6785236
430 2970148134 2970143518 Bacteria 6446480
431 2977531753 2977530762 Bacteria 6951399
432 2977549977 2977544691 Bacteria 6875412
433 640937080 640753048 Bacteria 5495657
434 8004001478 8003999396 Bacteria 7063185
435 8015397193 8015394850 Bacteria 5064660
436 Ga0373925_0043198
437 JGI25158J39367_1004629
438 JGI25152J39213_1015367
439 JGI25159J45721_1000020
440 JGI25151J46595_10001264
441 JGI25151J46595_10060881
442 rootH1_10003899
443 rootH1_10079257
444 JGI25160J50197_1000055
445 JGI25161J50226_1001297
446 Ga0055526_1022667
447 Ga0055524_1004529
448 Ga0055524_1012340
449 Ga0055524_1019752
450 Ga0055524_1028136
451 Ga0055536_1019227
452 Ga0055528_1002212
453 Ga0055530_10010082
454 Ga0055531_10003924
455 Ga0055543_1000508
456 Ga0065165_1000265
457 Ga0065703_1019585
458 Ga0065704_10103111
459 Ga0065704_10218479
460 Ga0065715_10208784
461 Ga0065707_10224827
462 Ga0070690_100001757
463 Ga0070690_100018534
464 Ga0070690_100045287
465 Ga0068869_100139917
466 Ga0068869_100527673
467 Ga0070666_10007497
468 Ga0070666_10556379
469 Ga0070666_10618846
470 Ga0070682_100229141
471 Ga0068868_100124935
472 Ga0068868_100126314
473 Ga0070689_100010709
474 Ga0070689_100020745
475 Ga0070689_100253493
476 Ga0070691_10007475
477 Ga0070692_10233993
478 Ga0070669_100065477
479 Ga0070675_100112522
480 Ga0070675_100196494
481 Ga0070671_100018049
482 Ga0070674_100011742
483 Ga0070673_100000104
484 Ga0070673_100043709
485 Ga0070673_100056087
486 Ga0070673_100148713
487 Ga0070688_100015030
488 Ga0070688_100016660
489 Ga0070659_101225906
490 Ga0070667_100008074
491 Ga0070667_100249348
492 Ga0070701_10043997
493 Ga0070700_100020203
494 Ga0070694_100261523
495 Ga0070694_100781036
496 Ga0070663_100423562
497 Ga0070678_100142808
498 Ga0068867_100031006
499 Ga0070685_10081198
500 Ga0070698_100306055
501 Ga0070684_100028474
502 Ga0070684_100636011
503 Ga0068853_100545475
504 Ga0070672_100045471
505 Ga0070672_100102402
506 Ga0070686_100050144
507 Ga0070686_100218485
508 Ga0070686_100241712
509 Ga0070693_100351325
510 Ga0070665_100020765
511 Ga0070665_100077190
512 Ga0070704_100946763
513 Ga0068854_100320534
514 Ga0070702_100457985
515 Ga0068859_100046441
516 Ga0068864_100079658
517 Ga0068866_10080173
518 Ga0068861_100632775
519 Ga0068861_101069041
520 Ga0068863_100126913
521 Ga0068858_100048940
522 Ga0068858_100345103
523 Ga0068858_100414749
524 Ga0068860_100121506
525 Ga0068862_100591180
526 Ga0081539_10034205
527 Ga0070715_10065893
528 Ga0070712_100464240
529 Ga0075366_10077775
530 Ga0097621_100021811
531 Ga0075370_10103582
532 Ga0068871_100361318
533 Ga0075428_100688770
534 Ga0075430_100162791
535 Ga0075429_100217457
536 Ga0068865_100001875
537 Ga0068865_100063961
538 Ga0097620_100046441
539 Ga0079104_1001522
540 Ga0105251_10000119
541 Ga0105251_10002336
542 Ga0105244_10070706
543 Ga0105250_10001728
544 Ga0111539_10015342
545 Ga0111539_10548538
546 Ga0105245_10008954
547 Ga0105245_11069625
548 Ga0105247_10000025
549 Ga0105247_10018427
550 Ga0114129_10162091
551 Ga0105243_10542828
552 Ga0105241_10000004
553 Ga0105242_10626687
554 Ga0105248_10039806
555 Ga0105249_10131991
556 Ga0157373_10000690
557 Ga0171463_1003
558 Ga0157374_10273404
559 Ga0157378_10046548
560 Ga0157378_10127492
561 Ga0163162_11048280
562 Ga0157375_10034660
563 Ga0157375_10519443
564 Ga0163163_10105959
565 Ga0157380_10002596
566 Ga0157380_10028584
567 Ga0157380_11953719
568 Ga0182008_10003944
569 Ga0157379_10012952
570 Ga0157376_10133468
571 Ga0183363_1044
572 Ga0163161_10000001
573 Ga0214542_1000604
574 Ga0214543_1000028
575 Ga0228711_1000016
576 Ga0228710_1000013
577 Ga0209436_103733
578 Ga0209129_1000161
579 Ga0209565_1041003
580 Ga0209673_1000010
581 Ga0209130_1000026
582 Ga0209130_1008856
583 Ga0209676_1005276
584 Ga0209676_1012667
585 Ga0209025_1000162
586 Ga0209025_1001199
587 Ga0209564_1000208
588 Ga0209050_1016223
589 Ga0209256_1000042
590 Ga0209256_1007074
591 Ga0207426_1000006
592 Ga0209051_1016452
593 Ga0209257_1002448
594 Ga0207696_1000001
595 Ga0207713_1000024
596 Ga0207713_1000026
597 Ga0207710_10000140
598 Ga0207680_10111078
599 Ga0207680_10163315
600 Ga0207647_10374258
601 Ga0207685_10057258
602 Ga0207645_10059555
603 Ga0207654_10000006
604 Ga0207662_10089213
605 Ga0207662_10567259
606 Ga0207681_10156606
607 Ga0207659_10262314
608 Ga0207659_10351977
609 Ga0207659_10755160
610 Ga0207644_10118488
611 Ga0207706_10843971
612 Ga0207670_10014580
613 Ga0207670_10064170
614 Ga0207670_10217286
615 Ga0207669_10091771
616 Ga0207704_10013306
617 Ga0207704_10090680
618 Ga0207691_10033322
619 Ga0207691_10080669
620 Ga0207711_10008514
621 Ga0207689_10421182
622 Ga0207661_10006901
623 Ga0207651_10002617
624 Ga0207651_10431272
625 Ga0207658_10069244
626 Ga0207658_10293877
627 Ga0207658_10420537
628 Ga0207677_10289027
629 Ga0207703_10012028
630 Ga0207703_10172533
631 Ga0207708_10300749
632 Ga0207641_10045370
633 Ga0207648_10108753
634 Ga0207676_10022585
635 Ga0207675_100000361
636 Ga0207675_100579674
637 Ga0207675_100993744
638 Ga0207683_10045715
639 Ga0207683_10123462
640 Ga0209281_1000008
641 Ga0209281_1000221
642 Ga0209282_1000041
643 Ga0209971_1075743
644 Ga0207428_10193599
645 Ga0268266_10007701
646 Ga0268266_10108270
647 Ga0268265_10306351
648 Ga0268264_10077749
649 Ga0307408_100012958
650 Ga0307408_100163112
651 Ga0307413_10033447
652 Ga0307413_10793717
653 Ga0307407_10364838
654 Ga0307412_10232036
655 Ga0315914_1000030
656 Ga0307409_100369306
657 Ga0316593_10024439
658 Ga0315913_1000017
659 Ga0315915_1000017
660 Ga0373959_0026654
661 Ga0373934_0170663
662 Ga0373936_0164129
663 Ga0373954_0114422
664 Ga0373955_0088505
665 Ga0373955_0146147
666 Ga0373942_0083939
667 Ga0373961_0005153
668 Ga0373931_0035863
669 Ga0373935_0015446
670 Ga0373935_0123363
671 Ga0373927_0433430
672 Ga0373933_0046142
673 Ga0373947_0102977
674 Ga0373947_0153204
675 Ga0373947_0405281
676 Ga0373937_0010930
677 Ga0373937_0107330
678 Ga0373937_0439227
679 Ga0373925_0139373
680 Ga0395899_0156131
681 Ga0395900_0025377
682 Ga0395898_0309570
683 Ga0395905_0344516
684 Ga0400483_029299
685 Ga0400483_216577
686 Ga0439436_0035385
687 Ga0439438_052690
688 Ga0439447_052801
689 Ga0439465_0032874
690 Ga0451791_1315162
691 Ga0451837_0830409
692 Ga0439445_0000253
693 Ga0439432_002156
694 Ga0439449_0005077
695 Ga0450895_000161
696 Ga0450896_021204
697 Ga0450906_004428
698 Ga0450908_018875
699 Ga0439435_0027276
700 Ga0450918_005173
701 Ga0450918_069328
702 Ga0451577_0369339
703 Ga0453683_0133331
704 Ga0451576_0019065
705 Ga0451576_0232537
706 Ga0495627_000018
707 Ga0495592_0230569
708 Ga0495651_0006879
709 Ga0495653_0318443
710 Ga0495639_0142140
711 Ga0495606_0003152
712 Ga0495608_0076028
713 Ga0495628_0136288
714 Ga0495630_0067433
715 Ga0495654_0001734
716 Ga0495654_0089176
717 Ga0495640_0030924
718 Ga0495586_0038404
719 Ga0495667_0094771
720 Ga0495634_0000799
721 Ga0495634_0281103
722 Ga0495635_0138928
723 Ga0495599_0237155
724 Ga0495623_0214020
725 Ga0495658_0087335
726 Ga0495589_0000002
727 Ga0495674_0004182
728 Ga0495674_0073541
729 Ga0495680_0129833
730 Ga0496101_0040791
731 Ga0496103_0043765
732 Ga0496104_0008291
733 Ga0496104_0221833
734 Ga0496105_0020164
735 Ga0496106_0194695
736 Ga0496106_0200579
737 Ga0496108_0005488
738 Ga0496108_0031824
739 Ga0496108_0039295
740 Ga0496109_0138138
741 Ga0496110_0013550
742 Ga0496111_0000693
743 Ga0496112_0061358
744 Ga0496112_0451867
745 Ga0496113_0544819
746 Ga0496114_0000758
747 Ga0496115_0240320
748 Ga0496116_0000023
749 Ga0496117_0000463
750 Ga0496118_0003815
751 Ga0496119_0001891
752 Ga0496119_0004881
753 Ga0496119_0034001
754 Ga0496120_0000052
755 Ga0496120_0000137
756 Ga0496121_0184962
757 Ga0496122_0127377
758 Ga0496123_0105611
759 Ga0496124_0000017
760 Ga0496124_0623042
761 Ga0496126_0010126
762 Ga0496126_0511237
763 Ga0501036_0016473
764 Ga0501038_0209562
765 Ga0501039_0101614
766 Ga0501040_0146390
767 Ga0501048_0062089
768 Ga0501067_0025349
769 Ga0501068_0119888
770 Ga0501071_0206471
771 Ga0501072_0038692
772 Ga0501073_0068617
773 Ga0501075_0015576
774 Ga0501076_0006691
775 Ga0501077_0105578
776 Ga0501077_0120877
777 Ga0501079_0033564
778 Ga0501081_0013488
779 Ga0501081_0039616
780 Ga0501083_0349067
781 Ga0501045_0000154
782 Ga0501045_0006742
783 nmdc:mga0yw44_378366_c1
784 nmdc:mga05p37_186278_c1
785 nmdc:mga09592_218294_c1
786 nmdc:mga0qj67_246219_c1
787 nmdc:mga08y16_1995_c1
788 nmdc:mga08y16_28843_c1
789 Ga0495601_0068890
790 Ga0495619_0339468
791 Ga0500643_001524
792 Ga0500555_014224
793 Ga0500607_001616
794 Ga0500568_0001653
795 Ga0500624_027224
796 Ga0501084_0042744
797 Ga0530510_0003503
798 2506577575
799 2506582713
800 2508851511
801 2512533429
802 2512971009
803 2513604633
804 2513984513
805 2513996991
806 2515608849
807 2517570107
808 2585200337
809 2600195759
810 2643803468
811 2644067434
812 2644107591
813 2644146186
814 2644308987
815 2644332814
816 2644375113
817 2644418487
818 2644451854
819 2644491863
820 2644501429
821 2644540294
822 2644614928
823 2644676441
824 2644690616
825 2656277462
826 2656279087
827 2689444053
828 2772438094
829 2802719599
830 2802726807
831 2802732332
832 2802739935
833 2802745441
834 2802752833
835 2807177076
836 2838079467
837 2842522769
838 2844167225
839 2850081245
840 2869553419
841 2888368109
842 2888374272
843 2896384979
844 2913299582
845 2915981803
846 2916067490
847 2920824843
848 2921251086
849 2936998036
850 2937031362
851 2937039464
852 2937079882
853 2937090141
854 2937969838
855 2941504865
856 2957376669
857 2957438403
858 2960592633
859 2960635854
860 2960681944
861 2960694196
862 2967690603
863 2967735066
864 2970031650
865 2970148134
866 2977531753
867 2977549977
868 640937080
869 8004001478
870 8015397193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06041

DUF924

Bacterial protein of unknown function (DUF924)

27

216

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.9555 10 180
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.9138 10 180
1zu2-assembly1.cif.gz_A solution nmr structure of the plant tom20 mitochondrial import receptor from arabidopsis thaliana 0.5434 19 156
6hc2-assembly2.cif.gz_G crystal structure of numa/lgn hetero-hexamers 0.5189 31 156
5t8y-assembly1.cif.gz_A structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. 0.5126 61 153
ID Description Score Start End Superfamily
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9521 87 180 1.25.40.10
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9144 87 180 1.25.40.10
af_A0A0P0X1M5_204_347_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5673 32 159 1.25.40.10
af_Q9ZU65_234_291_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.561 116 158 1.25.10.10
af_Q9VSA4_3_123_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5396 43 156 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A249PBX2-F1-model_v4 DUF924 domain-containing protein 0.9956 60 186
AF-A0A6P1B4G9-F1-model_v4 deleted 0.9912 78 159
AF-I0HK39-F1-model_v4 DUF924 domain-containing protein 0.9874 64 186
AF-W7Q5G3-F1-model_v4 DUF924 domain-containing protein 0.987 60 186
AF-A0A7X6IS57-F1-model_v4 deleted 0.9868 30 121

Map