F443386

General Info

Members Datasets Scaffolds Average Seq Length
435 238 870 316

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0013651|Ga0453684_0013651_3355_4665
Length 340
Sequence MKVIKLIEVRSELGAGTRGASLGIDALKLASLDYGSYYFGKFKTKEIRDSSHLLFKNPIRAYAKRIRGVIKIFNKLATAVQTEIKEGRFPVVLSGDHSSAGGTIAGVKMAYPDKKIGVIWIDAHADLHSPYTTPSGNIHGMPLASALGLGNLKGGKNPVTGDTIPYWEILKNWGGICPKITPDSLVFVGLRDYEKEERDFIVKHQVKVVKVPEVRKGKIKELATKITQQYLGHCDVLYVSFDIDSLDSSLVPGTGTPVKNGLYVNETTKLLSEILKDQRLVCFEVTEINPLLDKENQTASRIFPIFRQAINTIEKRKVIQGKRVTKIPRVKPGLTAPKKK

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
201 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
202 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
217 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
224 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
225 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
226 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
227 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
228 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
229 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
230 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
231 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
232 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
233 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
234 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
235 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
236 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
237 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
238 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.97
Nodule 0
Rhizoplane 0.92
Rhizosphere 84.37
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0013651 3300044712 Bacteria 13161
2 SwRhRL2b_contig_1886170 2162886007 Bacteria 206362
3 JGI24739J22299_10001956 3300001989 Bacteria 7884
4 JGI25154J39366_1000022 3300002738 Bacteria 219590
5 rootH2_10075973 3300003320 Bacteria 1710
6 rootH2_10113557 3300003320 Bacteria 5095
7 rootH2_10222872 3300003320 Bacteria 2436
8 rootL2_10029788 3300003322 Bacteria 2019
9 rootL2_10044014 3300003322 Bacteria 4665
10 rootL2_10243175 3300003322 Bacteria 4109
11 rootH1_10011261 3300003323 Bacteria 13189
12 rootH1_10088546 3300003323 Bacteria 7023
13 JGI25160J50197_1007665 3300003354 Bacteria 4200
14 JGI25160J50197_1008764 3300003354 Bacteria 3826
15 JGI25160J50197_1012652 3300003354 Bacteria 2917
16 Ga0055535_1001518 3300003761 Bacteria 11445
17 Ga0055542_1004831 3300003762 Bacteria 3158
18 Ga0055528_1000516 3300003790 Bacteria 30316
19 Ga0055530_10004622 3300003791 Bacteria 7006
20 Ga0055531_10000263 3300003794 Bacteria 55230
21 Ga0065165_1000009 3300005262 Bacteria 327432
22 Ga0065165_1012270 3300005262 Bacteria 3501
23 Ga0065714_10075163 3300005288 Bacteria 2939
24 Ga0065714_10117190 3300005288 Unclassified 1394
25 Ga0065704_10070159 3300005289 Bacteria 207348
26 Ga0065704_10076558 3300005289 Bacteria 5078
27 Ga0070658_10059031 3300005327 Bacteria 3124
28 Ga0070658_10449182 3300005327 Bacteria 1110
29 Ga0070676_10008376 3300005328 Bacteria 5571
30 Ga0070683_100056923 3300005329 Bacteria 3631
31 Ga0070683_100100370 3300005329 Unclassified 2725
32 Ga0070683_100290869 3300005329 Bacteria 1554
33 Ga0070683_100434406 3300005329 Bacteria 1253
34 Ga0070690_100011176 3300005330 Bacteria 5246
35 Ga0070690_100067016 3300005330 Bacteria 2325
36 Ga0068869_100044912 3300005334 Bacteria 3179
37 Ga0068869_100079584 3300005334 Bacteria 2443
38 Ga0070666_10119954 3300005335 Bacteria 1823
39 Ga0070680_100017836 3300005336 Bacteria 5600
40 Ga0070680_100091816 3300005336 Bacteria 2514
41 Ga0070682_100000306 3300005337 Bacteria 34011
42 Ga0068868_100070968 3300005338 Bacteria 2777
43 Ga0070660_100004241 3300005339 Bacteria 9900
44 Ga0070660_100048349 3300005339 Unclassified 3267
45 Ga0070660_100180702 3300005339 Bacteria 1707
46 Ga0070660_100184448 3300005339 Bacteria 1689
47 Ga0070660_100247974 3300005339 Bacteria 1452
48 Ga0070689_100202767 3300005340 Unclassified 1620
49 Ga0070687_100090760 3300005343 Bacteria 1689
50 Ga0070661_100122823 3300005344 Bacteria 1946
51 Ga0070661_100139269 3300005344 Unclassified 1828
52 Ga0070669_100094667 3300005353 Bacteria 2245
53 Ga0070669_100124448 3300005353 Bacteria 1971
54 Ga0070675_100018400 3300005354 Bacteria 5560
55 Ga0070675_100045337 3300005354 Bacteria 3598
56 Ga0070673_100039276 3300005364 Bacteria 3620
57 Ga0070673_100047509 3300005364 Bacteria 3340
58 Ga0070659_100014314 3300005366 Bacteria 5925
59 Ga0070659_100067032 3300005366 Bacteria 2846
60 Ga0070667_100161909 3300005367 Bacteria 1971
61 Ga0070701_10059703 3300005438 Bacteria 2006
62 Ga0070663_100140687 3300005455 Bacteria 1842
63 Ga0070678_100032298 3300005456 Bacteria 3622
64 Ga0070662_100022399 3300005457 Bacteria 4326
65 Ga0070662_100392444 3300005457 Bacteria 1144
66 Ga0070681_10241961 3300005458 Bacteria 1718
67 Ga0070681_10323534 3300005458 Bacteria 1452
68 Ga0068867_100269529 3300005459 Bacteria 1391
69 Ga0070685_10025273 3300005466 Bacteria 3269
70 Ga0070685_10085216 3300005466 Unclassified 1902
71 Ga0070698_100000620 3300005471 Bacteria 38229
72 Ga0070698_100089808 3300005471 Bacteria 3056
73 Ga0070679_100008903 3300005530 Bacteria 9472
74 Ga0070679_100022591 3300005530 Bacteria 6149
75 Ga0070679_100167377 3300005530 Bacteria 2171
76 Ga0070679_100192623 3300005530 Bacteria 2007
77 Ga0070684_100006918 3300005535 Bacteria 8809
78 Ga0070684_100107165 3300005535 Bacteria 2502
79 Ga0068853_100042225 3300005539 Bacteria 3898
80 Ga0068853_100053095 3300005539 Bacteria 3490
81 Ga0068853_100095668 3300005539 Bacteria 2619
82 Ga0068853_100350140 3300005539 Bacteria 1374
83 Ga0070672_100081011 3300005543 Bacteria 2602
84 Ga0070672_100201704 3300005543 Bacteria 1663
85 Ga0070672_100396656 3300005543 Bacteria 1182
86 Ga0070693_100111242 3300005547 Bacteria 1685
87 Ga0070665_100001998 3300005548 Bacteria 22944
88 Ga0068855_100002171 3300005563 Bacteria 24239
89 Ga0068855_100002670 3300005563 Bacteria 21981
90 Ga0068855_100104781 3300005563 Bacteria 3253
91 Ga0068855_100260545 3300005563 Unclassified 1932
92 Ga0068855_100544723 3300005563 Bacteria 1257
93 Ga0068855_100569493 3300005563 Bacteria 1224
94 Ga0070664_100032638 3300005564 Bacteria 4355
95 Ga0070664_100050977 3300005564 Bacteria 3504
96 Ga0070664_100443307 3300005564 Unclassified 1191
97 Ga0068857_100025372 3300005577 Bacteria 5219
98 Ga0068857_100108593 3300005577 Bacteria 2493
99 Ga0068857_100409966 3300005577 Bacteria 1262
100 Ga0068854_100020776 3300005578 Bacteria 4449
101 Ga0068854_100068559 3300005578 Bacteria 2587
102 Ga0068856_100013549 3300005614 Bacteria 7893
103 Ga0068856_100033152 3300005614 Bacteria 5057
104 Ga0068856_100461582 3300005614 Bacteria 1291
105 Ga0070702_100032101 3300005615 Bacteria 2879
106 Ga0068852_100014712 3300005616 Bacteria 6035
107 Ga0068852_100054178 3300005616 Unclassified 3456
108 Ga0068852_100381082 3300005616 Bacteria 1383
109 Ga0068852_100554206 3300005616 Unclassified 1150
110 Ga0068859_100123542 3300005617 Bacteria 2656
111 Ga0068859_100758306 3300005617 Bacteria 1059
112 Ga0068864_100035070 3300005618 Bacteria 4270
113 Ga0068861_100101603 3300005719 Bacteria 2288
114 Ga0068851_10071028 3300005834 Bacteria 1801
115 Ga0068851_10117369 3300005834 Bacteria 1427
116 Ga0068863_100032694 3300005841 Bacteria 4957
117 Ga0068863_100137928 3300005841 Bacteria 2330
118 Ga0068860_100006030 3300005843 Bacteria 12198
119 Ga0068860_100023245 3300005843 Bacteria 5990
120 Ga0068860_100519982 3300005843 Unclassified 1190
121 Ga0068862_100009214 3300005844 Bacteria 8175
122 Ga0097621_100009836 3300006237 Bacteria 6963
123 Ga0097621_100086590 3300006237 Bacteria 2615
124 Ga0097621_100438761 3300006237 Bacteria 1175
125 Ga0068871_100007325 3300006358 Bacteria 7876
126 Ga0068871_100041677 3300006358 Bacteria 3682
127 Ga0068871_100228662 3300006358 Bacteria 1614
128 Ga0075428_100000886 3300006844 Bacteria 31498
129 Ga0075428_100099160 3300006844 Bacteria 3176
130 Ga0075428_100325829 3300006844 Unclassified 1650
131 Ga0075430_100008079 3300006846 Bacteria 8892
132 Ga0075431_100040191 3300006847 Bacteria 4819
133 Ga0075429_100061951 3300006880 Bacteria 3259
134 Ga0075429_100129020 3300006880 Bacteria 2212
135 Ga0075429_100182050 3300006880 Bacteria 1841
136 Ga0097620_100123537 3300006931 Bacteria 2656
137 Ga0097620_100758237 3300006931 Bacteria 1059
138 Ga0105240_10000131 3300009093 Bacteria 154386
139 Ga0105240_10279938 3300009093 Bacteria 1917
140 Ga0105240_10421719 3300009093 Bacteria 1499
141 Ga0105240_10428518 3300009093 Bacteria 1484
142 Ga0105240_10448618 3300009093 Bacteria 1444
143 Ga0111539_10066958 3300009094 Bacteria 4242
144 Ga0111539_10193210 3300009094 Bacteria 2375
145 Ga0111539_10460182 3300009094 Bacteria 1481
146 Ga0114129_10182137 3300009147 Bacteria 2858
147 Ga0105242_10006523 3300009176 Bacteria 8980
148 Ga0105242_10015243 3300009176 Bacteria 5970
149 Ga0105237_10408048 3300009545 Bacteria 1363
150 Ga0105249_10063135 3300009553 Bacteria 3402
151 Ga0105239_10086087 3300010375 Bacteria 3463
152 Ga0105239_10193622 3300010375 Bacteria 2276
153 Ga0105246_10235416 3300011119 Bacteria 1444
154 Ga0157373_10001893 3300013100 Bacteria 15880
155 Ga0157373_10003168 3300013100 Bacteria 12430
156 Ga0157373_10016175 3300013100 Bacteria 5445
157 Ga0157373_10217722 3300013100 Bacteria 1347
158 Ga0157373_10237759 3300013100 Unclassified 1287
159 Ga0157371_10001373 3300013102 Bacteria 25524
160 Ga0157371_10001801 3300013102 Bacteria 21660
161 Ga0157371_10002444 3300013102 Bacteria 17704
162 Ga0157371_10005488 3300013102 Bacteria 10682
163 Ga0157371_10007780 3300013102 Bacteria 8612
164 Ga0157371_10013240 3300013102 Bacteria 6276
165 Ga0157371_10017091 3300013102 Bacteria 5398
166 Ga0157371_10024462 3300013102 Unclassified 4410
167 Ga0157371_10037672 3300013102 Bacteria 3461
168 Ga0157371_10055035 3300013102 Bacteria 2824
169 Ga0157370_10001882 3300013104 Bacteria 25842
170 Ga0157370_10003515 3300013104 Bacteria 18364
171 Ga0157370_10005502 3300013104 Bacteria 14200
172 Ga0157370_10072160 3300013104 Bacteria 3258
173 Ga0157370_10108684 3300013104 Bacteria 2593
174 Ga0157370_10129358 3300013104 Unclassified 2356
175 Ga0157370_10149268 3300013104 Bacteria 2176
176 Ga0157369_10019925 3300013105 Bacteria 7501
177 Ga0157369_10049350 3300013105 Bacteria 4563
178 Ga0157369_10059209 3300013105 Bacteria 4130
179 Ga0157369_10116529 3300013105 Bacteria 2836
180 Ga0157369_10272161 3300013105 Bacteria 1764
181 Ga0157369_10365233 3300013105 Bacteria 1498
182 Ga0157369_10474772 3300013105 Bacteria 1294
183 Ga0157374_10024433 3300013296 Bacteria 5419
184 Ga0157374_10055074 3300013296 Bacteria 3711
185 Ga0157374_10103708 3300013296 Unclassified 2729
186 Ga0157378_10001024 3300013297 Bacteria 25548
187 Ga0157378_10017774 3300013297 Bacteria 6243
188 Ga0157378_10023600 3300013297 Bacteria 5410
189 Ga0157378_10205145 3300013297 Bacteria 1867
190 Ga0157378_10467418 3300013297 Bacteria 1255
191 Ga0163162_10003984 3300013306 Bacteria 14163
192 Ga0163162_10012865 3300013306 Bacteria 8172
193 Ga0157372_10014269 3300013307 Bacteria 8495
194 Ga0157372_10035811 3300013307 Bacteria 5466
195 Ga0157372_10188046 3300013307 Bacteria 2391
196 Ga0157372_10637184 3300013307 Bacteria 1241
197 Ga0157375_10268442 3300013308 Bacteria 1868
198 Ga0157375_10292650 3300013308 Bacteria 1792
199 Ga0163163_10007700 3300014325 Bacteria 9517
200 Ga0163163_10385580 3300014325 Unclassified 1459
201 Ga0157380_10002726 3300014326 Bacteria 11984
202 Ga0157380_10197259 3300014326 Bacteria 1783
203 Ga0157377_10014443 3300014745 Bacteria 4019
204 Ga0157377_10075568 3300014745 Bacteria 1957
205 Ga0157377_10103887 3300014745 Bacteria 1698
206 Ga0157379_10225175 3300014968 Bacteria 1700
207 Ga0182005_1000056 3300015265 Bacteria 108603
208 Ga0163161_10107899 3300017792 Unclassified 2078
209 Ga0209436_101692 3300025208 Bacteria 7283
210 Ga0209436_102099 3300025208 Bacteria 6246
211 Ga0209258_100326 3300025242 Bacteria 72066
212 Ga0209646_1000003 3300025246 Bacteria 1160860
213 Ga0209026_1000144 3300025250 Bacteria 112177
214 Ga0209148_1000157 3300025254 Bacteria 142367
215 Ga0209673_1000103 3300025273 Bacteria 188104
216 Ga0209130_1000877 3300025284 Bacteria 24599
217 Ga0209564_1026401 3300025295 Bacteria 1920
218 Ga0209758_1002411 3300025297 Bacteria 19155
219 Ga0209758_1015072 3300025297 Bacteria 4039
220 Ga0209758_1016579 3300025297 Bacteria 3732
221 Ga0209050_1000156 3300025298 Bacteria 158788
222 Ga0207426_1000034 3300025302 Bacteria 454016
223 Ga0207426_1000414 3300025302 Bacteria 70302
224 Ga0207426_1006845 3300025302 Bacteria 4874
225 Ga0209257_1000025 3300025304 Bacteria 724838
226 Ga0209257_1001629 3300025304 Bacteria 25718
227 Ga0207682_10015865 3300025893 Bacteria 2936
228 Ga0207688_10025905 3300025901 Bacteria 3224
229 Ga0207680_10144213 3300025903 Bacteria 1582
230 Ga0207647_10000648 3300025904 Bacteria 27210
231 Ga0207647_10003926 3300025904 Bacteria 11109
232 Ga0207645_10018723 3300025907 Bacteria 4548
233 Ga0207643_10004783 3300025908 Bacteria 7253
234 Ga0207705_10036475 3300025909 Bacteria 3518
235 Ga0207705_10173710 3300025909 Bacteria 1623
236 Ga0207707_10156689 3300025912 Bacteria 1992
237 Ga0207707_10157398 3300025912 Bacteria 1987
238 Ga0207695_10000217 3300025913 Bacteria 155047
239 Ga0207695_10040131 3300025913 Bacteria 5023
240 Ga0207695_10048669 3300025913 Bacteria 4476
241 Ga0207695_10130180 3300025913 Bacteria 2474
242 Ga0207671_10000588 3300025914 Bacteria 48606
243 Ga0207662_10057025 3300025918 Bacteria 2334
244 Ga0207657_10009263 3300025919 Bacteria 9919
245 Ga0207657_10015521 3300025919 Bacteria 7378
246 Ga0207657_10029735 3300025919 Bacteria 4968
247 Ga0207657_10415763 3300025919 Bacteria 1057
248 Ga0207649_10091439 3300025920 Bacteria 1993
249 Ga0207652_10000016 3300025921 Bacteria 188815
250 Ga0207652_10000541 3300025921 Bacteria 38299
251 Ga0207652_10015949 3300025921 Bacteria 6124
252 Ga0207652_10049701 3300025921 Bacteria 3591
253 Ga0207652_10057219 3300025921 Bacteria 3357
254 Ga0207652_10167186 3300025921 Bacteria 1972
255 Ga0207681_10249133 3300025923 Bacteria 1386
256 Ga0207650_10003011 3300025925 Bacteria 11611
257 Ga0207650_10047948 3300025925 Bacteria 3149
258 Ga0207650_10229941 3300025925 Bacteria 1495
259 Ga0207659_10076779 3300025926 Bacteria 2457
260 Ga0207659_10108759 3300025926 Unclassified 2103
261 Ga0207659_10125623 3300025926 Bacteria 1972
262 Ga0207644_10006488 3300025931 Bacteria 7626
263 Ga0207690_10003448 3300025932 Bacteria 9435
264 Ga0207690_10038325 3300025932 Bacteria 3118
265 Ga0207706_10024696 3300025933 Bacteria 5386
266 Ga0207686_10003687 3300025934 Bacteria 8210
267 Ga0207686_10016917 3300025934 Bacteria 4098
268 Ga0207669_10217765 3300025937 Bacteria 1399
269 Ga0207689_10017784 3300025942 Bacteria 6007
270 Ga0207661_10074750 3300025944 Bacteria 2778
271 Ga0207661_10081088 3300025944 Bacteria 2679
272 Ga0207661_10503095 3300025944 Bacteria 1107
273 Ga0207679_10037169 3300025945 Bacteria 3459
274 Ga0207679_10313254 3300025945 Unclassified 1357
275 Ga0207667_10000478 3300025949 Bacteria 53228
276 Ga0207667_10010177 3300025949 Bacteria 11014
277 Ga0207667_10354390 3300025949 Bacteria 1496
278 Ga0207651_10025353 3300025960 Bacteria 3684
279 Ga0207651_10072893 3300025960 Bacteria 2440
280 Ga0207651_10431789 3300025960 Bacteria 1127
281 Ga0207712_10103729 3300025961 Bacteria 2119
282 Ga0207712_10224177 3300025961 Bacteria 1505
283 Ga0207658_10084098 3300025986 Bacteria 2448
284 Ga0207658_10187166 3300025986 Bacteria 1718
285 Ga0207677_10114699 3300026023 Unclassified 2014
286 Ga0207639_10034738 3300026041 Bacteria 3729
287 Ga0207639_10308082 3300026041 Bacteria 1402
288 Ga0207639_10309922 3300026041 Bacteria 1398
289 Ga0207678_10276537 3300026067 Bacteria 1440
290 Ga0207702_10068946 3300026078 Unclassified 3039
291 Ga0207641_10011153 3300026088 Bacteria 7372
292 Ga0207641_10016921 3300026088 Bacteria 5969
293 Ga0207641_10376476 3300026088 Unclassified 1358
294 Ga0207648_10062451 3300026089 Bacteria 3247
295 Ga0207648_10264177 3300026089 Bacteria 1536
296 Ga0207648_10287877 3300026089 Unclassified 1470
297 Ga0207648_10314892 3300026089 Unclassified 1405
298 Ga0207676_10043138 3300026095 Bacteria 3471
299 Ga0207676_10164260 3300026095 Bacteria 1927
300 Ga0207676_10572235 3300026095 Bacteria 1082
301 Ga0207674_10049522 3300026116 Bacteria 4296
302 Ga0207674_10138483 3300026116 Bacteria 2394
303 Ga0207674_10180543 3300026116 Bacteria 2062
304 Ga0207674_10373633 3300026116 Bacteria 1378
305 Ga0207675_100011079 3300026118 Bacteria 8448
306 Ga0207675_100286462 3300026118 Bacteria 1602
307 Ga0207683_10071240 3300026121 Bacteria 3072
308 Ga0207683_10305446 3300026121 Bacteria 1456
309 Ga0207683_10557651 3300026121 Unclassified 1059
310 Ga0207698_10204632 3300026142 Bacteria 1771
311 Ga0207698_10500694 3300026142 Bacteria 1182
312 Ga0207698_10628452 3300026142 Bacteria 1061
313 Ga0209995_1002788 3300027471 Bacteria 2770
314 Ga0268266_10001978 3300028379 Bacteria 22975
315 Ga0268264_10014637 3300028381 Bacteria 6446
316 Ga0268264_10014849 3300028381 Bacteria 6396
317 Ga0268264_10514368 3300028381 Bacteria 1169
318 Ga0265334_10005185 3300028573 Bacteria 5711
319 Ga0265334_10040387 3300028573 Bacteria 1828
320 Ga0265338_10229601 3300028800 Bacteria 1381
321 Ga0265324_10033752 3300029957 Bacteria 1784
322 Ga0265327_10000009 3300031251 Bacteria 616360
323 Ga0265327_10000975 3300031251 Bacteria 40891
324 Ga0307509_10076924 3300031507 Bacteria 3461
325 Ga0307408_100172234 3300031548 Bacteria 1729
326 Ga0307508_10002565 3300031616 Bacteria 19118
327 Ga0265314_10033369 3300031711 Bacteria 3776
328 Ga0307405_10060863 3300031731 Bacteria 2384
329 Ga0307413_10010015 3300031824 Bacteria 4570
330 Ga0307413_10253627 3300031824 Unclassified 1307
331 Ga0307407_10024067 3300031903 Bacteria 3187
332 Ga0307409_100009385 3300031995 Bacteria 6008
333 Ga0307414_10179644 3300032004 Bacteria 1701
334 Ga0307411_10160712 3300032005 Unclassified 1682
335 Ga0307415_100001047 3300032126 Bacteria 12840
336 Ga0395899_0002265 3300037312 Bacteria 15731
337 Ga0395899_0028634 3300037312 Bacteria 4193
338 Ga0395899_0050688 3300037312 Bacteria 3082
339 Ga0395899_0143752 3300037312 Bacteria 1695
340 Ga0395900_0004008 3300037418 Bacteria 15728
341 Ga0395900_0021378 3300037418 Bacteria 6614
342 Ga0395900_0068255 3300037418 Bacteria 3653
343 Ga0395900_0134901 3300037418 Bacteria 2528
344 Ga0395900_0148830 3300037418 Bacteria 2393
345 Ga0395900_0188894 3300037418 Unclassified 2090
346 Ga0395898_0001712 3300037466 Bacteria 29076
347 Ga0395898_0006132 3300037466 Bacteria 12886
348 Ga0395898_0413636 3300037466 Bacteria 1285
349 Ga0395905_0005098 3300037471 Bacteria 13502
350 Ga0395905_0060028 3300037471 Unclassified 3556
351 Ga0395905_0127821 3300037471 Bacteria 2390
352 Ga0395905_0169420 3300037471 Unclassified 2051
353 Ga0395901_0001588 3300038443 Bacteria 23510
354 Ga0395901_0023432 3300038443 Bacteria 6329
355 Ga0451791_1448639 3300041451 Bacteria 1283
356 Ga0439431_0000426 3300041997 Bacteria 8947
357 Ga0439445_0004590 3300042004 Bacteria 3129
358 Ga0439449_0034823 3300042007 Bacteria 1875
359 Ga0439444_0003703 3300042437 Bacteria 2176
360 Ga0451577_0000329 3300042876 Bacteria 88404
361 Ga0453683_0075093 3300044673 Unclassified 2116
362 Ga0453684_0008748 3300044712 Bacteria 17983
363 Ga0466957_0166496 3300044842 Bacteria 1434
364 Ga0466959_0014638 3300045049 Bacteria 5706
365 Ga0466959_0225871 3300045049 Bacteria 1297
366 Ga0495633_0000529 3300046558 Bacteria 38115
367 Ga0495668_0000624 3300046616 Bacteria 42812
368 Ga0495668_0003296 3300046616 Bacteria 12233
369 Ga0495668_0073415 3300046616 Bacteria 1879
370 Ga0495625_0180918 3300046660 Bacteria 1402
371 Ga0495635_0218309 3300046663 Bacteria 1290
372 Ga0495636_0000045 3300047318 Bacteria 53503
373 Ga0495674_0118903 3300047319 Bacteria 2234
374 Ga0495686_0004760 3300047472 Bacteria 10981
375 Ga0496105_0317795 3300048908 Bacteria 1249
376 Ga0496114_0000645 3300048917 Bacteria 25686
377 Ga0496115_0027630 3300048918 Bacteria 4441
378 Ga0496121_0000028 3300048924 Bacteria 439193
379 Ga0501298_002704 3300049521 Bacteria 2707
380 Ga0501032_0058867 3300049569 Bacteria 2579
381 Ga0501033_0099689 3300049570 Bacteria 2121
382 Ga0501034_0000114 3300049571 Bacteria 148505
383 Ga0501034_0106487 3300049571 Bacteria 2797
384 Ga0501043_0188737 3300049579 Bacteria 1603
385 Ga0501046_0028214 3300049580 Bacteria 4573
386 Ga0501047_0066874 3300049581 Bacteria 3464
387 Ga0501047_0088956 3300049581 Bacteria 2965
388 Ga0501048_0190943 3300049582 Bacteria 1451
389 Ga0501073_0019001 3300049589 Bacteria 4965
390 Ga0501202_000556 3300049652 Bacteria 5413
391 Ga0501223_009569 3300049663 Bacteria 1960
392 Ga0501235_002733 3300049669 Bacteria 3791
393 Ga0501253_026486 3300049683 Bacteria 1069
394 Ga0501219_000987 3300049703 Bacteria 3371
395 Ga0501221_003284 3300049704 Bacteria 2658
396 Ga0501225_0002223 3300049705 Bacteria 5999
397 Ga0501080_0082275 3300049742 Bacteria 2990
398 Ga0501080_0100230 3300049742 Unclassified 2687
399 Ga0501241_020693 3300049758 Bacteria 1211
400 Ga0501035_0172244 3300049822 Bacteria 1869
401 Ga0501035_0265385 3300049822 Bacteria 1454
402 Ga0501044_0049307 3300049823 Bacteria 4347
403 Ga0501044_0169889 3300049823 Bacteria 2153
404 Ga0501284_00029 3300050005 Bacteria 74818
405 nmdc:mga09592_137929_c1 3300050508 Bacteria 2101
406 nmdc:mga09592_2585_c1 3300050508 Bacteria 14656
407 nmdc:mga08y16_46584_c1 3300050511 Bacteria 4539
408 Ga0500644_0000226 3300053088 Bacteria 32397
409 Ga0500556_0006132 3300053104 Bacteria 3409
410 Ga0500594_0022139 3300053118 Bacteria 1600
411 Ga0500559_0019187 3300053136 Bacteria 2890
412 Ga0500568_0016626 3300053139 Bacteria 3265
413 Ga0500588_0008125 3300053146 Unclassified 2441
414 Ga0500590_015500 3300053148 Bacteria 3934
415 Ga0500616_0001400 3300053153 Bacteria 23227
416 Ga0500622_0004747 3300053156 Bacteria 8376
417 Ga0500627_0032787 3300053158 Unclassified 2191
418 Ga0500633_0025549 3300053160 Bacteria 1848
419 Ga0500636_0007045 3300053177 Bacteria 6485
420 Ga0500611_000007 3300053727 Bacteria 210964
421 2819572788 2818991442 Bacteria 8318214
422 2819681136 2818991460 Bacteria 7595395
423 2821139799 2821136567 Bacteria 8080116
424 2883069417 2883068021 Bacteria 6192739
425 2884794933 2884791551 Bacteria 8511252
426 2896088148 2896085136 Bacteria 6129793
427 2896112119 2896109856 Bacteria 7140722
428 2904473450 2904467357 Bacteria 8057758
429 2929179432 2929177148 Bacteria 7883697
430 2929244699 2929239360 Bacteria 7745570
431 2929926861 2929921140 Bacteria 8649150
432 2945981842 2945977869 Bacteria 7777518
433 2946018757 2946013367 Bacteria 7766675
434 8003153979 8003151029 Bacteria 8187759
435 8007373880 8007371054 Bacteria 4849201
436 Ga0453684_0013651
437 SwRhRL2b_contig_1886170
438 JGI24739J22299_10001956
439 JGI25154J39366_1000022
440 rootH2_10075973
441 rootH2_10113557
442 rootH2_10222872
443 rootL2_10029788
444 rootL2_10044014
445 rootL2_10243175
446 rootH1_10011261
447 rootH1_10088546
448 JGI25160J50197_1007665
449 JGI25160J50197_1008764
450 JGI25160J50197_1012652
451 Ga0055535_1001518
452 Ga0055542_1004831
453 Ga0055528_1000516
454 Ga0055530_10004622
455 Ga0055531_10000263
456 Ga0065165_1000009
457 Ga0065165_1012270
458 Ga0065714_10075163
459 Ga0065714_10117190
460 Ga0065704_10070159
461 Ga0065704_10076558
462 Ga0070658_10059031
463 Ga0070658_10449182
464 Ga0070676_10008376
465 Ga0070683_100056923
466 Ga0070683_100100370
467 Ga0070683_100290869
468 Ga0070683_100434406
469 Ga0070690_100011176
470 Ga0070690_100067016
471 Ga0068869_100044912
472 Ga0068869_100079584
473 Ga0070666_10119954
474 Ga0070680_100017836
475 Ga0070680_100091816
476 Ga0070682_100000306
477 Ga0068868_100070968
478 Ga0070660_100004241
479 Ga0070660_100048349
480 Ga0070660_100180702
481 Ga0070660_100184448
482 Ga0070660_100247974
483 Ga0070689_100202767
484 Ga0070687_100090760
485 Ga0070661_100122823
486 Ga0070661_100139269
487 Ga0070669_100094667
488 Ga0070669_100124448
489 Ga0070675_100018400
490 Ga0070675_100045337
491 Ga0070673_100039276
492 Ga0070673_100047509
493 Ga0070659_100014314
494 Ga0070659_100067032
495 Ga0070667_100161909
496 Ga0070701_10059703
497 Ga0070663_100140687
498 Ga0070678_100032298
499 Ga0070662_100022399
500 Ga0070662_100392444
501 Ga0070681_10241961
502 Ga0070681_10323534
503 Ga0068867_100269529
504 Ga0070685_10025273
505 Ga0070685_10085216
506 Ga0070698_100000620
507 Ga0070698_100089808
508 Ga0070679_100008903
509 Ga0070679_100022591
510 Ga0070679_100167377
511 Ga0070679_100192623
512 Ga0070684_100006918
513 Ga0070684_100107165
514 Ga0068853_100042225
515 Ga0068853_100053095
516 Ga0068853_100095668
517 Ga0068853_100350140
518 Ga0070672_100081011
519 Ga0070672_100201704
520 Ga0070672_100396656
521 Ga0070693_100111242
522 Ga0070665_100001998
523 Ga0068855_100002171
524 Ga0068855_100002670
525 Ga0068855_100104781
526 Ga0068855_100260545
527 Ga0068855_100544723
528 Ga0068855_100569493
529 Ga0070664_100032638
530 Ga0070664_100050977
531 Ga0070664_100443307
532 Ga0068857_100025372
533 Ga0068857_100108593
534 Ga0068857_100409966
535 Ga0068854_100020776
536 Ga0068854_100068559
537 Ga0068856_100013549
538 Ga0068856_100033152
539 Ga0068856_100461582
540 Ga0070702_100032101
541 Ga0068852_100014712
542 Ga0068852_100054178
543 Ga0068852_100381082
544 Ga0068852_100554206
545 Ga0068859_100123542
546 Ga0068859_100758306
547 Ga0068864_100035070
548 Ga0068861_100101603
549 Ga0068851_10071028
550 Ga0068851_10117369
551 Ga0068863_100032694
552 Ga0068863_100137928
553 Ga0068860_100006030
554 Ga0068860_100023245
555 Ga0068860_100519982
556 Ga0068862_100009214
557 Ga0097621_100009836
558 Ga0097621_100086590
559 Ga0097621_100438761
560 Ga0068871_100007325
561 Ga0068871_100041677
562 Ga0068871_100228662
563 Ga0075428_100000886
564 Ga0075428_100099160
565 Ga0075428_100325829
566 Ga0075430_100008079
567 Ga0075431_100040191
568 Ga0075429_100061951
569 Ga0075429_100129020
570 Ga0075429_100182050
571 Ga0097620_100123537
572 Ga0097620_100758237
573 Ga0105240_10000131
574 Ga0105240_10279938
575 Ga0105240_10421719
576 Ga0105240_10428518
577 Ga0105240_10448618
578 Ga0111539_10066958
579 Ga0111539_10193210
580 Ga0111539_10460182
581 Ga0114129_10182137
582 Ga0105242_10006523
583 Ga0105242_10015243
584 Ga0105237_10408048
585 Ga0105249_10063135
586 Ga0105239_10086087
587 Ga0105239_10193622
588 Ga0105246_10235416
589 Ga0157373_10001893
590 Ga0157373_10003168
591 Ga0157373_10016175
592 Ga0157373_10217722
593 Ga0157373_10237759
594 Ga0157371_10001373
595 Ga0157371_10001801
596 Ga0157371_10002444
597 Ga0157371_10005488
598 Ga0157371_10007780
599 Ga0157371_10013240
600 Ga0157371_10017091
601 Ga0157371_10024462
602 Ga0157371_10037672
603 Ga0157371_10055035
604 Ga0157370_10001882
605 Ga0157370_10003515
606 Ga0157370_10005502
607 Ga0157370_10072160
608 Ga0157370_10108684
609 Ga0157370_10129358
610 Ga0157370_10149268
611 Ga0157369_10019925
612 Ga0157369_10049350
613 Ga0157369_10059209
614 Ga0157369_10116529
615 Ga0157369_10272161
616 Ga0157369_10365233
617 Ga0157369_10474772
618 Ga0157374_10024433
619 Ga0157374_10055074
620 Ga0157374_10103708
621 Ga0157378_10001024
622 Ga0157378_10017774
623 Ga0157378_10023600
624 Ga0157378_10205145
625 Ga0157378_10467418
626 Ga0163162_10003984
627 Ga0163162_10012865
628 Ga0157372_10014269
629 Ga0157372_10035811
630 Ga0157372_10188046
631 Ga0157372_10637184
632 Ga0157375_10268442
633 Ga0157375_10292650
634 Ga0163163_10007700
635 Ga0163163_10385580
636 Ga0157380_10002726
637 Ga0157380_10197259
638 Ga0157377_10014443
639 Ga0157377_10075568
640 Ga0157377_10103887
641 Ga0157379_10225175
642 Ga0182005_1000056
643 Ga0163161_10107899
644 Ga0209436_101692
645 Ga0209436_102099
646 Ga0209258_100326
647 Ga0209646_1000003
648 Ga0209026_1000144
649 Ga0209148_1000157
650 Ga0209673_1000103
651 Ga0209130_1000877
652 Ga0209564_1026401
653 Ga0209758_1002411
654 Ga0209758_1015072
655 Ga0209758_1016579
656 Ga0209050_1000156
657 Ga0207426_1000034
658 Ga0207426_1000414
659 Ga0207426_1006845
660 Ga0209257_1000025
661 Ga0209257_1001629
662 Ga0207682_10015865
663 Ga0207688_10025905
664 Ga0207680_10144213
665 Ga0207647_10000648
666 Ga0207647_10003926
667 Ga0207645_10018723
668 Ga0207643_10004783
669 Ga0207705_10036475
670 Ga0207705_10173710
671 Ga0207707_10156689
672 Ga0207707_10157398
673 Ga0207695_10000217
674 Ga0207695_10040131
675 Ga0207695_10048669
676 Ga0207695_10130180
677 Ga0207671_10000588
678 Ga0207662_10057025
679 Ga0207657_10009263
680 Ga0207657_10015521
681 Ga0207657_10029735
682 Ga0207657_10415763
683 Ga0207649_10091439
684 Ga0207652_10000016
685 Ga0207652_10000541
686 Ga0207652_10015949
687 Ga0207652_10049701
688 Ga0207652_10057219
689 Ga0207652_10167186
690 Ga0207681_10249133
691 Ga0207650_10003011
692 Ga0207650_10047948
693 Ga0207650_10229941
694 Ga0207659_10076779
695 Ga0207659_10108759
696 Ga0207659_10125623
697 Ga0207644_10006488
698 Ga0207690_10003448
699 Ga0207690_10038325
700 Ga0207706_10024696
701 Ga0207686_10003687
702 Ga0207686_10016917
703 Ga0207669_10217765
704 Ga0207689_10017784
705 Ga0207661_10074750
706 Ga0207661_10081088
707 Ga0207661_10503095
708 Ga0207679_10037169
709 Ga0207679_10313254
710 Ga0207667_10000478
711 Ga0207667_10010177
712 Ga0207667_10354390
713 Ga0207651_10025353
714 Ga0207651_10072893
715 Ga0207651_10431789
716 Ga0207712_10103729
717 Ga0207712_10224177
718 Ga0207658_10084098
719 Ga0207658_10187166
720 Ga0207677_10114699
721 Ga0207639_10034738
722 Ga0207639_10308082
723 Ga0207639_10309922
724 Ga0207678_10276537
725 Ga0207702_10068946
726 Ga0207641_10011153
727 Ga0207641_10016921
728 Ga0207641_10376476
729 Ga0207648_10062451
730 Ga0207648_10264177
731 Ga0207648_10287877
732 Ga0207648_10314892
733 Ga0207676_10043138
734 Ga0207676_10164260
735 Ga0207676_10572235
736 Ga0207674_10049522
737 Ga0207674_10138483
738 Ga0207674_10180543
739 Ga0207674_10373633
740 Ga0207675_100011079
741 Ga0207675_100286462
742 Ga0207683_10071240
743 Ga0207683_10305446
744 Ga0207683_10557651
745 Ga0207698_10204632
746 Ga0207698_10500694
747 Ga0207698_10628452
748 Ga0209995_1002788
749 Ga0268266_10001978
750 Ga0268264_10014637
751 Ga0268264_10014849
752 Ga0268264_10514368
753 Ga0265334_10005185
754 Ga0265334_10040387
755 Ga0265338_10229601
756 Ga0265324_10033752
757 Ga0265327_10000009
758 Ga0265327_10000975
759 Ga0307509_10076924
760 Ga0307408_100172234
761 Ga0307508_10002565
762 Ga0265314_10033369
763 Ga0307405_10060863
764 Ga0307413_10010015
765 Ga0307413_10253627
766 Ga0307407_10024067
767 Ga0307409_100009385
768 Ga0307414_10179644
769 Ga0307411_10160712
770 Ga0307415_100001047
771 Ga0395899_0002265
772 Ga0395899_0028634
773 Ga0395899_0050688
774 Ga0395899_0143752
775 Ga0395900_0004008
776 Ga0395900_0021378
777 Ga0395900_0068255
778 Ga0395900_0134901
779 Ga0395900_0148830
780 Ga0395900_0188894
781 Ga0395898_0001712
782 Ga0395898_0006132
783 Ga0395898_0413636
784 Ga0395905_0005098
785 Ga0395905_0060028
786 Ga0395905_0127821
787 Ga0395905_0169420
788 Ga0395901_0001588
789 Ga0395901_0023432
790 Ga0451791_1448639
791 Ga0439431_0000426
792 Ga0439445_0004590
793 Ga0439449_0034823
794 Ga0439444_0003703
795 Ga0451577_0000329
796 Ga0453683_0075093
797 Ga0453684_0008748
798 Ga0466957_0166496
799 Ga0466959_0014638
800 Ga0466959_0225871
801 Ga0495633_0000529
802 Ga0495668_0000624
803 Ga0495668_0003296
804 Ga0495668_0073415
805 Ga0495625_0180918
806 Ga0495635_0218309
807 Ga0495636_0000045
808 Ga0495674_0118903
809 Ga0495686_0004760
810 Ga0496105_0317795
811 Ga0496114_0000645
812 Ga0496115_0027630
813 Ga0496121_0000028
814 Ga0501298_002704
815 Ga0501032_0058867
816 Ga0501033_0099689
817 Ga0501034_0000114
818 Ga0501034_0106487
819 Ga0501043_0188737
820 Ga0501046_0028214
821 Ga0501047_0066874
822 Ga0501047_0088956
823 Ga0501048_0190943
824 Ga0501073_0019001
825 Ga0501202_000556
826 Ga0501223_009569
827 Ga0501235_002733
828 Ga0501253_026486
829 Ga0501219_000987
830 Ga0501221_003284
831 Ga0501225_0002223
832 Ga0501080_0082275
833 Ga0501080_0100230
834 Ga0501241_020693
835 Ga0501035_0172244
836 Ga0501035_0265385
837 Ga0501044_0049307
838 Ga0501044_0169889
839 Ga0501284_00029
840 nmdc:mga09592_137929_c1
841 nmdc:mga09592_2585_c1
842 nmdc:mga08y16_46584_c1
843 Ga0500644_0000226
844 Ga0500556_0006132
845 Ga0500594_0022139
846 Ga0500559_0019187
847 Ga0500568_0016626
848 Ga0500588_0008125
849 Ga0500590_015500
850 Ga0500616_0001400
851 Ga0500622_0004747
852 Ga0500627_0032787
853 Ga0500633_0025549
854 Ga0500636_0007045
855 Ga0500611_000007
856 2819572788
857 2819681136
858 2821139799
859 2883069417
860 2884794933
861 2896088148
862 2896112119
863 2904473450
864 2929179432
865 2929244699
866 2929926861
867 2945981842
868 2946018757
869 8003153979
870 8007373880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

3

311

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dkt-assembly4.cif.gz_D crystal structure of arginase from bacillus subtilis 0.9089 2 312
6nfp-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. subtilis str. 168 0.8955 2 312
6dkt-assembly6.cif.gz_F crystal structure of arginase from bacillus subtilis 0.8913 2 312
6dkt-assembly4.cif.gz_D crystal structure of arginase from bacillus subtilis 0.8904 2 312
6dkt-assembly5.cif.gz_E crystal structure of arginase from bacillus subtilis 0.887 4 312
ID Description Score Start End Superfamily
6nfpA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.897 2 312 3.40.800.10
6nfpA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8795 2 312 3.40.800.10
af_A0A1X7RC97_10_314_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8749 2 314 3.40.800.10
af_A0A1X7RC97_10_314_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8397 2 314 3.40.800.10
3pzlA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8339 2 312 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A7C3KSU2-F1-model_v4 Arginase (EC 3.5.3.1) 0.9898 103 314 GO:0004053
GO:0005829
GO:0019547
GO:0030145
AF-A0A142ENP1-F1-model_v4 Arginase (EC 3.5.3.1) 0.9799 1 315 GO:0004053
GO:0005829
GO:0019547
GO:0030145
AF-A0A258KJY3-F1-model_v4 Arginase 0.9797 103 196 GO:0004053
GO:0005829
GO:0019547
GO:0030145
AF-A0A7Y7AFG3-F1-model_v4 Arginase (EC 3.5.3.1) 0.979 1 312 GO:0004053
GO:0005829
GO:0019547
GO:0030145
AF-A0A2E2NZH2-F1-model_v4 Arginase (EC 3.5.3.1) 0.9778 1 312 GO:0004053
GO:0005829
GO:0019547
GO:0030145

Map