F443386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 238 | 870 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0013651|Ga0453684_0013651_3355_4665 |
| Length | 340 |
| Sequence | MKVIKLIEVRSELGAGTRGASLGIDALKLASLDYGSYYFGKFKTKEIRDSSHLLFKNPIRAYAKRIRGVIKIFNKLATAVQTEIKEGRFPVVLSGDHSSAGGTIAGVKMAYPDKKIGVIWIDAHADLHSPYTTPSGNIHGMPLASALGLGNLKGGKNPVTGDTIPYWEILKNWGGICPKITPDSLVFVGLRDYEKEERDFIVKHQVKVVKVPEVRKGKIKELATKITQQYLGHCDVLYVSFDIDSLDSSLVPGTGTPVKNGLYVNETTKLLSEILKDQRLVCFEVTEINPLLDKENQTASRIFPIFRQAINTIEKRKVIQGKRVTKIPRVKPGLTAPKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 170 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 171 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 172 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 188 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 189 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 198 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 199 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 200 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 201 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 202 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 203 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 209 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 214 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 215 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 216 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 217 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 219 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 220 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 221 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 222 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 224 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 225 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 226 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 227 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 228 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 229 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 230 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 231 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 232 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 233 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 234 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 235 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 236 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 237 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 238 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.55 |
| Metatranscriptomes | 0 |
| Isolates | 3.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.97 |
| Nodule | 0 |
| Rhizoplane | 0.92 |
| Rhizosphere | 84.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0013651 | 3300044712 | Bacteria | 13161 |
| 2 | SwRhRL2b_contig_1886170 | 2162886007 | Bacteria | 206362 |
| 3 | JGI24739J22299_10001956 | 3300001989 | Bacteria | 7884 |
| 4 | JGI25154J39366_1000022 | 3300002738 | Bacteria | 219590 |
| 5 | rootH2_10075973 | 3300003320 | Bacteria | 1710 |
| 6 | rootH2_10113557 | 3300003320 | Bacteria | 5095 |
| 7 | rootH2_10222872 | 3300003320 | Bacteria | 2436 |
| 8 | rootL2_10029788 | 3300003322 | Bacteria | 2019 |
| 9 | rootL2_10044014 | 3300003322 | Bacteria | 4665 |
| 10 | rootL2_10243175 | 3300003322 | Bacteria | 4109 |
| 11 | rootH1_10011261 | 3300003323 | Bacteria | 13189 |
| 12 | rootH1_10088546 | 3300003323 | Bacteria | 7023 |
| 13 | JGI25160J50197_1007665 | 3300003354 | Bacteria | 4200 |
| 14 | JGI25160J50197_1008764 | 3300003354 | Bacteria | 3826 |
| 15 | JGI25160J50197_1012652 | 3300003354 | Bacteria | 2917 |
| 16 | Ga0055535_1001518 | 3300003761 | Bacteria | 11445 |
| 17 | Ga0055542_1004831 | 3300003762 | Bacteria | 3158 |
| 18 | Ga0055528_1000516 | 3300003790 | Bacteria | 30316 |
| 19 | Ga0055530_10004622 | 3300003791 | Bacteria | 7006 |
| 20 | Ga0055531_10000263 | 3300003794 | Bacteria | 55230 |
| 21 | Ga0065165_1000009 | 3300005262 | Bacteria | 327432 |
| 22 | Ga0065165_1012270 | 3300005262 | Bacteria | 3501 |
| 23 | Ga0065714_10075163 | 3300005288 | Bacteria | 2939 |
| 24 | Ga0065714_10117190 | 3300005288 | Unclassified | 1394 |
| 25 | Ga0065704_10070159 | 3300005289 | Bacteria | 207348 |
| 26 | Ga0065704_10076558 | 3300005289 | Bacteria | 5078 |
| 27 | Ga0070658_10059031 | 3300005327 | Bacteria | 3124 |
| 28 | Ga0070658_10449182 | 3300005327 | Bacteria | 1110 |
| 29 | Ga0070676_10008376 | 3300005328 | Bacteria | 5571 |
| 30 | Ga0070683_100056923 | 3300005329 | Bacteria | 3631 |
| 31 | Ga0070683_100100370 | 3300005329 | Unclassified | 2725 |
| 32 | Ga0070683_100290869 | 3300005329 | Bacteria | 1554 |
| 33 | Ga0070683_100434406 | 3300005329 | Bacteria | 1253 |
| 34 | Ga0070690_100011176 | 3300005330 | Bacteria | 5246 |
| 35 | Ga0070690_100067016 | 3300005330 | Bacteria | 2325 |
| 36 | Ga0068869_100044912 | 3300005334 | Bacteria | 3179 |
| 37 | Ga0068869_100079584 | 3300005334 | Bacteria | 2443 |
| 38 | Ga0070666_10119954 | 3300005335 | Bacteria | 1823 |
| 39 | Ga0070680_100017836 | 3300005336 | Bacteria | 5600 |
| 40 | Ga0070680_100091816 | 3300005336 | Bacteria | 2514 |
| 41 | Ga0070682_100000306 | 3300005337 | Bacteria | 34011 |
| 42 | Ga0068868_100070968 | 3300005338 | Bacteria | 2777 |
| 43 | Ga0070660_100004241 | 3300005339 | Bacteria | 9900 |
| 44 | Ga0070660_100048349 | 3300005339 | Unclassified | 3267 |
| 45 | Ga0070660_100180702 | 3300005339 | Bacteria | 1707 |
| 46 | Ga0070660_100184448 | 3300005339 | Bacteria | 1689 |
| 47 | Ga0070660_100247974 | 3300005339 | Bacteria | 1452 |
| 48 | Ga0070689_100202767 | 3300005340 | Unclassified | 1620 |
| 49 | Ga0070687_100090760 | 3300005343 | Bacteria | 1689 |
| 50 | Ga0070661_100122823 | 3300005344 | Bacteria | 1946 |
| 51 | Ga0070661_100139269 | 3300005344 | Unclassified | 1828 |
| 52 | Ga0070669_100094667 | 3300005353 | Bacteria | 2245 |
| 53 | Ga0070669_100124448 | 3300005353 | Bacteria | 1971 |
| 54 | Ga0070675_100018400 | 3300005354 | Bacteria | 5560 |
| 55 | Ga0070675_100045337 | 3300005354 | Bacteria | 3598 |
| 56 | Ga0070673_100039276 | 3300005364 | Bacteria | 3620 |
| 57 | Ga0070673_100047509 | 3300005364 | Bacteria | 3340 |
| 58 | Ga0070659_100014314 | 3300005366 | Bacteria | 5925 |
| 59 | Ga0070659_100067032 | 3300005366 | Bacteria | 2846 |
| 60 | Ga0070667_100161909 | 3300005367 | Bacteria | 1971 |
| 61 | Ga0070701_10059703 | 3300005438 | Bacteria | 2006 |
| 62 | Ga0070663_100140687 | 3300005455 | Bacteria | 1842 |
| 63 | Ga0070678_100032298 | 3300005456 | Bacteria | 3622 |
| 64 | Ga0070662_100022399 | 3300005457 | Bacteria | 4326 |
| 65 | Ga0070662_100392444 | 3300005457 | Bacteria | 1144 |
| 66 | Ga0070681_10241961 | 3300005458 | Bacteria | 1718 |
| 67 | Ga0070681_10323534 | 3300005458 | Bacteria | 1452 |
| 68 | Ga0068867_100269529 | 3300005459 | Bacteria | 1391 |
| 69 | Ga0070685_10025273 | 3300005466 | Bacteria | 3269 |
| 70 | Ga0070685_10085216 | 3300005466 | Unclassified | 1902 |
| 71 | Ga0070698_100000620 | 3300005471 | Bacteria | 38229 |
| 72 | Ga0070698_100089808 | 3300005471 | Bacteria | 3056 |
| 73 | Ga0070679_100008903 | 3300005530 | Bacteria | 9472 |
| 74 | Ga0070679_100022591 | 3300005530 | Bacteria | 6149 |
| 75 | Ga0070679_100167377 | 3300005530 | Bacteria | 2171 |
| 76 | Ga0070679_100192623 | 3300005530 | Bacteria | 2007 |
| 77 | Ga0070684_100006918 | 3300005535 | Bacteria | 8809 |
| 78 | Ga0070684_100107165 | 3300005535 | Bacteria | 2502 |
| 79 | Ga0068853_100042225 | 3300005539 | Bacteria | 3898 |
| 80 | Ga0068853_100053095 | 3300005539 | Bacteria | 3490 |
| 81 | Ga0068853_100095668 | 3300005539 | Bacteria | 2619 |
| 82 | Ga0068853_100350140 | 3300005539 | Bacteria | 1374 |
| 83 | Ga0070672_100081011 | 3300005543 | Bacteria | 2602 |
| 84 | Ga0070672_100201704 | 3300005543 | Bacteria | 1663 |
| 85 | Ga0070672_100396656 | 3300005543 | Bacteria | 1182 |
| 86 | Ga0070693_100111242 | 3300005547 | Bacteria | 1685 |
| 87 | Ga0070665_100001998 | 3300005548 | Bacteria | 22944 |
| 88 | Ga0068855_100002171 | 3300005563 | Bacteria | 24239 |
| 89 | Ga0068855_100002670 | 3300005563 | Bacteria | 21981 |
| 90 | Ga0068855_100104781 | 3300005563 | Bacteria | 3253 |
| 91 | Ga0068855_100260545 | 3300005563 | Unclassified | 1932 |
| 92 | Ga0068855_100544723 | 3300005563 | Bacteria | 1257 |
| 93 | Ga0068855_100569493 | 3300005563 | Bacteria | 1224 |
| 94 | Ga0070664_100032638 | 3300005564 | Bacteria | 4355 |
| 95 | Ga0070664_100050977 | 3300005564 | Bacteria | 3504 |
| 96 | Ga0070664_100443307 | 3300005564 | Unclassified | 1191 |
| 97 | Ga0068857_100025372 | 3300005577 | Bacteria | 5219 |
| 98 | Ga0068857_100108593 | 3300005577 | Bacteria | 2493 |
| 99 | Ga0068857_100409966 | 3300005577 | Bacteria | 1262 |
| 100 | Ga0068854_100020776 | 3300005578 | Bacteria | 4449 |
| 101 | Ga0068854_100068559 | 3300005578 | Bacteria | 2587 |
| 102 | Ga0068856_100013549 | 3300005614 | Bacteria | 7893 |
| 103 | Ga0068856_100033152 | 3300005614 | Bacteria | 5057 |
| 104 | Ga0068856_100461582 | 3300005614 | Bacteria | 1291 |
| 105 | Ga0070702_100032101 | 3300005615 | Bacteria | 2879 |
| 106 | Ga0068852_100014712 | 3300005616 | Bacteria | 6035 |
| 107 | Ga0068852_100054178 | 3300005616 | Unclassified | 3456 |
| 108 | Ga0068852_100381082 | 3300005616 | Bacteria | 1383 |
| 109 | Ga0068852_100554206 | 3300005616 | Unclassified | 1150 |
| 110 | Ga0068859_100123542 | 3300005617 | Bacteria | 2656 |
| 111 | Ga0068859_100758306 | 3300005617 | Bacteria | 1059 |
| 112 | Ga0068864_100035070 | 3300005618 | Bacteria | 4270 |
| 113 | Ga0068861_100101603 | 3300005719 | Bacteria | 2288 |
| 114 | Ga0068851_10071028 | 3300005834 | Bacteria | 1801 |
| 115 | Ga0068851_10117369 | 3300005834 | Bacteria | 1427 |
| 116 | Ga0068863_100032694 | 3300005841 | Bacteria | 4957 |
| 117 | Ga0068863_100137928 | 3300005841 | Bacteria | 2330 |
| 118 | Ga0068860_100006030 | 3300005843 | Bacteria | 12198 |
| 119 | Ga0068860_100023245 | 3300005843 | Bacteria | 5990 |
| 120 | Ga0068860_100519982 | 3300005843 | Unclassified | 1190 |
| 121 | Ga0068862_100009214 | 3300005844 | Bacteria | 8175 |
| 122 | Ga0097621_100009836 | 3300006237 | Bacteria | 6963 |
| 123 | Ga0097621_100086590 | 3300006237 | Bacteria | 2615 |
| 124 | Ga0097621_100438761 | 3300006237 | Bacteria | 1175 |
| 125 | Ga0068871_100007325 | 3300006358 | Bacteria | 7876 |
| 126 | Ga0068871_100041677 | 3300006358 | Bacteria | 3682 |
| 127 | Ga0068871_100228662 | 3300006358 | Bacteria | 1614 |
| 128 | Ga0075428_100000886 | 3300006844 | Bacteria | 31498 |
| 129 | Ga0075428_100099160 | 3300006844 | Bacteria | 3176 |
| 130 | Ga0075428_100325829 | 3300006844 | Unclassified | 1650 |
| 131 | Ga0075430_100008079 | 3300006846 | Bacteria | 8892 |
| 132 | Ga0075431_100040191 | 3300006847 | Bacteria | 4819 |
| 133 | Ga0075429_100061951 | 3300006880 | Bacteria | 3259 |
| 134 | Ga0075429_100129020 | 3300006880 | Bacteria | 2212 |
| 135 | Ga0075429_100182050 | 3300006880 | Bacteria | 1841 |
| 136 | Ga0097620_100123537 | 3300006931 | Bacteria | 2656 |
| 137 | Ga0097620_100758237 | 3300006931 | Bacteria | 1059 |
| 138 | Ga0105240_10000131 | 3300009093 | Bacteria | 154386 |
| 139 | Ga0105240_10279938 | 3300009093 | Bacteria | 1917 |
| 140 | Ga0105240_10421719 | 3300009093 | Bacteria | 1499 |
| 141 | Ga0105240_10428518 | 3300009093 | Bacteria | 1484 |
| 142 | Ga0105240_10448618 | 3300009093 | Bacteria | 1444 |
| 143 | Ga0111539_10066958 | 3300009094 | Bacteria | 4242 |
| 144 | Ga0111539_10193210 | 3300009094 | Bacteria | 2375 |
| 145 | Ga0111539_10460182 | 3300009094 | Bacteria | 1481 |
| 146 | Ga0114129_10182137 | 3300009147 | Bacteria | 2858 |
| 147 | Ga0105242_10006523 | 3300009176 | Bacteria | 8980 |
| 148 | Ga0105242_10015243 | 3300009176 | Bacteria | 5970 |
| 149 | Ga0105237_10408048 | 3300009545 | Bacteria | 1363 |
| 150 | Ga0105249_10063135 | 3300009553 | Bacteria | 3402 |
| 151 | Ga0105239_10086087 | 3300010375 | Bacteria | 3463 |
| 152 | Ga0105239_10193622 | 3300010375 | Bacteria | 2276 |
| 153 | Ga0105246_10235416 | 3300011119 | Bacteria | 1444 |
| 154 | Ga0157373_10001893 | 3300013100 | Bacteria | 15880 |
| 155 | Ga0157373_10003168 | 3300013100 | Bacteria | 12430 |
| 156 | Ga0157373_10016175 | 3300013100 | Bacteria | 5445 |
| 157 | Ga0157373_10217722 | 3300013100 | Bacteria | 1347 |
| 158 | Ga0157373_10237759 | 3300013100 | Unclassified | 1287 |
| 159 | Ga0157371_10001373 | 3300013102 | Bacteria | 25524 |
| 160 | Ga0157371_10001801 | 3300013102 | Bacteria | 21660 |
| 161 | Ga0157371_10002444 | 3300013102 | Bacteria | 17704 |
| 162 | Ga0157371_10005488 | 3300013102 | Bacteria | 10682 |
| 163 | Ga0157371_10007780 | 3300013102 | Bacteria | 8612 |
| 164 | Ga0157371_10013240 | 3300013102 | Bacteria | 6276 |
| 165 | Ga0157371_10017091 | 3300013102 | Bacteria | 5398 |
| 166 | Ga0157371_10024462 | 3300013102 | Unclassified | 4410 |
| 167 | Ga0157371_10037672 | 3300013102 | Bacteria | 3461 |
| 168 | Ga0157371_10055035 | 3300013102 | Bacteria | 2824 |
| 169 | Ga0157370_10001882 | 3300013104 | Bacteria | 25842 |
| 170 | Ga0157370_10003515 | 3300013104 | Bacteria | 18364 |
| 171 | Ga0157370_10005502 | 3300013104 | Bacteria | 14200 |
| 172 | Ga0157370_10072160 | 3300013104 | Bacteria | 3258 |
| 173 | Ga0157370_10108684 | 3300013104 | Bacteria | 2593 |
| 174 | Ga0157370_10129358 | 3300013104 | Unclassified | 2356 |
| 175 | Ga0157370_10149268 | 3300013104 | Bacteria | 2176 |
| 176 | Ga0157369_10019925 | 3300013105 | Bacteria | 7501 |
| 177 | Ga0157369_10049350 | 3300013105 | Bacteria | 4563 |
| 178 | Ga0157369_10059209 | 3300013105 | Bacteria | 4130 |
| 179 | Ga0157369_10116529 | 3300013105 | Bacteria | 2836 |
| 180 | Ga0157369_10272161 | 3300013105 | Bacteria | 1764 |
| 181 | Ga0157369_10365233 | 3300013105 | Bacteria | 1498 |
| 182 | Ga0157369_10474772 | 3300013105 | Bacteria | 1294 |
| 183 | Ga0157374_10024433 | 3300013296 | Bacteria | 5419 |
| 184 | Ga0157374_10055074 | 3300013296 | Bacteria | 3711 |
| 185 | Ga0157374_10103708 | 3300013296 | Unclassified | 2729 |
| 186 | Ga0157378_10001024 | 3300013297 | Bacteria | 25548 |
| 187 | Ga0157378_10017774 | 3300013297 | Bacteria | 6243 |
| 188 | Ga0157378_10023600 | 3300013297 | Bacteria | 5410 |
| 189 | Ga0157378_10205145 | 3300013297 | Bacteria | 1867 |
| 190 | Ga0157378_10467418 | 3300013297 | Bacteria | 1255 |
| 191 | Ga0163162_10003984 | 3300013306 | Bacteria | 14163 |
| 192 | Ga0163162_10012865 | 3300013306 | Bacteria | 8172 |
| 193 | Ga0157372_10014269 | 3300013307 | Bacteria | 8495 |
| 194 | Ga0157372_10035811 | 3300013307 | Bacteria | 5466 |
| 195 | Ga0157372_10188046 | 3300013307 | Bacteria | 2391 |
| 196 | Ga0157372_10637184 | 3300013307 | Bacteria | 1241 |
| 197 | Ga0157375_10268442 | 3300013308 | Bacteria | 1868 |
| 198 | Ga0157375_10292650 | 3300013308 | Bacteria | 1792 |
| 199 | Ga0163163_10007700 | 3300014325 | Bacteria | 9517 |
| 200 | Ga0163163_10385580 | 3300014325 | Unclassified | 1459 |
| 201 | Ga0157380_10002726 | 3300014326 | Bacteria | 11984 |
| 202 | Ga0157380_10197259 | 3300014326 | Bacteria | 1783 |
| 203 | Ga0157377_10014443 | 3300014745 | Bacteria | 4019 |
| 204 | Ga0157377_10075568 | 3300014745 | Bacteria | 1957 |
| 205 | Ga0157377_10103887 | 3300014745 | Bacteria | 1698 |
| 206 | Ga0157379_10225175 | 3300014968 | Bacteria | 1700 |
| 207 | Ga0182005_1000056 | 3300015265 | Bacteria | 108603 |
| 208 | Ga0163161_10107899 | 3300017792 | Unclassified | 2078 |
| 209 | Ga0209436_101692 | 3300025208 | Bacteria | 7283 |
| 210 | Ga0209436_102099 | 3300025208 | Bacteria | 6246 |
| 211 | Ga0209258_100326 | 3300025242 | Bacteria | 72066 |
| 212 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 213 | Ga0209026_1000144 | 3300025250 | Bacteria | 112177 |
| 214 | Ga0209148_1000157 | 3300025254 | Bacteria | 142367 |
| 215 | Ga0209673_1000103 | 3300025273 | Bacteria | 188104 |
| 216 | Ga0209130_1000877 | 3300025284 | Bacteria | 24599 |
| 217 | Ga0209564_1026401 | 3300025295 | Bacteria | 1920 |
| 218 | Ga0209758_1002411 | 3300025297 | Bacteria | 19155 |
| 219 | Ga0209758_1015072 | 3300025297 | Bacteria | 4039 |
| 220 | Ga0209758_1016579 | 3300025297 | Bacteria | 3732 |
| 221 | Ga0209050_1000156 | 3300025298 | Bacteria | 158788 |
| 222 | Ga0207426_1000034 | 3300025302 | Bacteria | 454016 |
| 223 | Ga0207426_1000414 | 3300025302 | Bacteria | 70302 |
| 224 | Ga0207426_1006845 | 3300025302 | Bacteria | 4874 |
| 225 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 226 | Ga0209257_1001629 | 3300025304 | Bacteria | 25718 |
| 227 | Ga0207682_10015865 | 3300025893 | Bacteria | 2936 |
| 228 | Ga0207688_10025905 | 3300025901 | Bacteria | 3224 |
| 229 | Ga0207680_10144213 | 3300025903 | Bacteria | 1582 |
| 230 | Ga0207647_10000648 | 3300025904 | Bacteria | 27210 |
| 231 | Ga0207647_10003926 | 3300025904 | Bacteria | 11109 |
| 232 | Ga0207645_10018723 | 3300025907 | Bacteria | 4548 |
| 233 | Ga0207643_10004783 | 3300025908 | Bacteria | 7253 |
| 234 | Ga0207705_10036475 | 3300025909 | Bacteria | 3518 |
| 235 | Ga0207705_10173710 | 3300025909 | Bacteria | 1623 |
| 236 | Ga0207707_10156689 | 3300025912 | Bacteria | 1992 |
| 237 | Ga0207707_10157398 | 3300025912 | Bacteria | 1987 |
| 238 | Ga0207695_10000217 | 3300025913 | Bacteria | 155047 |
| 239 | Ga0207695_10040131 | 3300025913 | Bacteria | 5023 |
| 240 | Ga0207695_10048669 | 3300025913 | Bacteria | 4476 |
| 241 | Ga0207695_10130180 | 3300025913 | Bacteria | 2474 |
| 242 | Ga0207671_10000588 | 3300025914 | Bacteria | 48606 |
| 243 | Ga0207662_10057025 | 3300025918 | Bacteria | 2334 |
| 244 | Ga0207657_10009263 | 3300025919 | Bacteria | 9919 |
| 245 | Ga0207657_10015521 | 3300025919 | Bacteria | 7378 |
| 246 | Ga0207657_10029735 | 3300025919 | Bacteria | 4968 |
| 247 | Ga0207657_10415763 | 3300025919 | Bacteria | 1057 |
| 248 | Ga0207649_10091439 | 3300025920 | Bacteria | 1993 |
| 249 | Ga0207652_10000016 | 3300025921 | Bacteria | 188815 |
| 250 | Ga0207652_10000541 | 3300025921 | Bacteria | 38299 |
| 251 | Ga0207652_10015949 | 3300025921 | Bacteria | 6124 |
| 252 | Ga0207652_10049701 | 3300025921 | Bacteria | 3591 |
| 253 | Ga0207652_10057219 | 3300025921 | Bacteria | 3357 |
| 254 | Ga0207652_10167186 | 3300025921 | Bacteria | 1972 |
| 255 | Ga0207681_10249133 | 3300025923 | Bacteria | 1386 |
| 256 | Ga0207650_10003011 | 3300025925 | Bacteria | 11611 |
| 257 | Ga0207650_10047948 | 3300025925 | Bacteria | 3149 |
| 258 | Ga0207650_10229941 | 3300025925 | Bacteria | 1495 |
| 259 | Ga0207659_10076779 | 3300025926 | Bacteria | 2457 |
| 260 | Ga0207659_10108759 | 3300025926 | Unclassified | 2103 |
| 261 | Ga0207659_10125623 | 3300025926 | Bacteria | 1972 |
| 262 | Ga0207644_10006488 | 3300025931 | Bacteria | 7626 |
| 263 | Ga0207690_10003448 | 3300025932 | Bacteria | 9435 |
| 264 | Ga0207690_10038325 | 3300025932 | Bacteria | 3118 |
| 265 | Ga0207706_10024696 | 3300025933 | Bacteria | 5386 |
| 266 | Ga0207686_10003687 | 3300025934 | Bacteria | 8210 |
| 267 | Ga0207686_10016917 | 3300025934 | Bacteria | 4098 |
| 268 | Ga0207669_10217765 | 3300025937 | Bacteria | 1399 |
| 269 | Ga0207689_10017784 | 3300025942 | Bacteria | 6007 |
| 270 | Ga0207661_10074750 | 3300025944 | Bacteria | 2778 |
| 271 | Ga0207661_10081088 | 3300025944 | Bacteria | 2679 |
| 272 | Ga0207661_10503095 | 3300025944 | Bacteria | 1107 |
| 273 | Ga0207679_10037169 | 3300025945 | Bacteria | 3459 |
| 274 | Ga0207679_10313254 | 3300025945 | Unclassified | 1357 |
| 275 | Ga0207667_10000478 | 3300025949 | Bacteria | 53228 |
| 276 | Ga0207667_10010177 | 3300025949 | Bacteria | 11014 |
| 277 | Ga0207667_10354390 | 3300025949 | Bacteria | 1496 |
| 278 | Ga0207651_10025353 | 3300025960 | Bacteria | 3684 |
| 279 | Ga0207651_10072893 | 3300025960 | Bacteria | 2440 |
| 280 | Ga0207651_10431789 | 3300025960 | Bacteria | 1127 |
| 281 | Ga0207712_10103729 | 3300025961 | Bacteria | 2119 |
| 282 | Ga0207712_10224177 | 3300025961 | Bacteria | 1505 |
| 283 | Ga0207658_10084098 | 3300025986 | Bacteria | 2448 |
| 284 | Ga0207658_10187166 | 3300025986 | Bacteria | 1718 |
| 285 | Ga0207677_10114699 | 3300026023 | Unclassified | 2014 |
| 286 | Ga0207639_10034738 | 3300026041 | Bacteria | 3729 |
| 287 | Ga0207639_10308082 | 3300026041 | Bacteria | 1402 |
| 288 | Ga0207639_10309922 | 3300026041 | Bacteria | 1398 |
| 289 | Ga0207678_10276537 | 3300026067 | Bacteria | 1440 |
| 290 | Ga0207702_10068946 | 3300026078 | Unclassified | 3039 |
| 291 | Ga0207641_10011153 | 3300026088 | Bacteria | 7372 |
| 292 | Ga0207641_10016921 | 3300026088 | Bacteria | 5969 |
| 293 | Ga0207641_10376476 | 3300026088 | Unclassified | 1358 |
| 294 | Ga0207648_10062451 | 3300026089 | Bacteria | 3247 |
| 295 | Ga0207648_10264177 | 3300026089 | Bacteria | 1536 |
| 296 | Ga0207648_10287877 | 3300026089 | Unclassified | 1470 |
| 297 | Ga0207648_10314892 | 3300026089 | Unclassified | 1405 |
| 298 | Ga0207676_10043138 | 3300026095 | Bacteria | 3471 |
| 299 | Ga0207676_10164260 | 3300026095 | Bacteria | 1927 |
| 300 | Ga0207676_10572235 | 3300026095 | Bacteria | 1082 |
| 301 | Ga0207674_10049522 | 3300026116 | Bacteria | 4296 |
| 302 | Ga0207674_10138483 | 3300026116 | Bacteria | 2394 |
| 303 | Ga0207674_10180543 | 3300026116 | Bacteria | 2062 |
| 304 | Ga0207674_10373633 | 3300026116 | Bacteria | 1378 |
| 305 | Ga0207675_100011079 | 3300026118 | Bacteria | 8448 |
| 306 | Ga0207675_100286462 | 3300026118 | Bacteria | 1602 |
| 307 | Ga0207683_10071240 | 3300026121 | Bacteria | 3072 |
| 308 | Ga0207683_10305446 | 3300026121 | Bacteria | 1456 |
| 309 | Ga0207683_10557651 | 3300026121 | Unclassified | 1059 |
| 310 | Ga0207698_10204632 | 3300026142 | Bacteria | 1771 |
| 311 | Ga0207698_10500694 | 3300026142 | Bacteria | 1182 |
| 312 | Ga0207698_10628452 | 3300026142 | Bacteria | 1061 |
| 313 | Ga0209995_1002788 | 3300027471 | Bacteria | 2770 |
| 314 | Ga0268266_10001978 | 3300028379 | Bacteria | 22975 |
| 315 | Ga0268264_10014637 | 3300028381 | Bacteria | 6446 |
| 316 | Ga0268264_10014849 | 3300028381 | Bacteria | 6396 |
| 317 | Ga0268264_10514368 | 3300028381 | Bacteria | 1169 |
| 318 | Ga0265334_10005185 | 3300028573 | Bacteria | 5711 |
| 319 | Ga0265334_10040387 | 3300028573 | Bacteria | 1828 |
| 320 | Ga0265338_10229601 | 3300028800 | Bacteria | 1381 |
| 321 | Ga0265324_10033752 | 3300029957 | Bacteria | 1784 |
| 322 | Ga0265327_10000009 | 3300031251 | Bacteria | 616360 |
| 323 | Ga0265327_10000975 | 3300031251 | Bacteria | 40891 |
| 324 | Ga0307509_10076924 | 3300031507 | Bacteria | 3461 |
| 325 | Ga0307408_100172234 | 3300031548 | Bacteria | 1729 |
| 326 | Ga0307508_10002565 | 3300031616 | Bacteria | 19118 |
| 327 | Ga0265314_10033369 | 3300031711 | Bacteria | 3776 |
| 328 | Ga0307405_10060863 | 3300031731 | Bacteria | 2384 |
| 329 | Ga0307413_10010015 | 3300031824 | Bacteria | 4570 |
| 330 | Ga0307413_10253627 | 3300031824 | Unclassified | 1307 |
| 331 | Ga0307407_10024067 | 3300031903 | Bacteria | 3187 |
| 332 | Ga0307409_100009385 | 3300031995 | Bacteria | 6008 |
| 333 | Ga0307414_10179644 | 3300032004 | Bacteria | 1701 |
| 334 | Ga0307411_10160712 | 3300032005 | Unclassified | 1682 |
| 335 | Ga0307415_100001047 | 3300032126 | Bacteria | 12840 |
| 336 | Ga0395899_0002265 | 3300037312 | Bacteria | 15731 |
| 337 | Ga0395899_0028634 | 3300037312 | Bacteria | 4193 |
| 338 | Ga0395899_0050688 | 3300037312 | Bacteria | 3082 |
| 339 | Ga0395899_0143752 | 3300037312 | Bacteria | 1695 |
| 340 | Ga0395900_0004008 | 3300037418 | Bacteria | 15728 |
| 341 | Ga0395900_0021378 | 3300037418 | Bacteria | 6614 |
| 342 | Ga0395900_0068255 | 3300037418 | Bacteria | 3653 |
| 343 | Ga0395900_0134901 | 3300037418 | Bacteria | 2528 |
| 344 | Ga0395900_0148830 | 3300037418 | Bacteria | 2393 |
| 345 | Ga0395900_0188894 | 3300037418 | Unclassified | 2090 |
| 346 | Ga0395898_0001712 | 3300037466 | Bacteria | 29076 |
| 347 | Ga0395898_0006132 | 3300037466 | Bacteria | 12886 |
| 348 | Ga0395898_0413636 | 3300037466 | Bacteria | 1285 |
| 349 | Ga0395905_0005098 | 3300037471 | Bacteria | 13502 |
| 350 | Ga0395905_0060028 | 3300037471 | Unclassified | 3556 |
| 351 | Ga0395905_0127821 | 3300037471 | Bacteria | 2390 |
| 352 | Ga0395905_0169420 | 3300037471 | Unclassified | 2051 |
| 353 | Ga0395901_0001588 | 3300038443 | Bacteria | 23510 |
| 354 | Ga0395901_0023432 | 3300038443 | Bacteria | 6329 |
| 355 | Ga0451791_1448639 | 3300041451 | Bacteria | 1283 |
| 356 | Ga0439431_0000426 | 3300041997 | Bacteria | 8947 |
| 357 | Ga0439445_0004590 | 3300042004 | Bacteria | 3129 |
| 358 | Ga0439449_0034823 | 3300042007 | Bacteria | 1875 |
| 359 | Ga0439444_0003703 | 3300042437 | Bacteria | 2176 |
| 360 | Ga0451577_0000329 | 3300042876 | Bacteria | 88404 |
| 361 | Ga0453683_0075093 | 3300044673 | Unclassified | 2116 |
| 362 | Ga0453684_0008748 | 3300044712 | Bacteria | 17983 |
| 363 | Ga0466957_0166496 | 3300044842 | Bacteria | 1434 |
| 364 | Ga0466959_0014638 | 3300045049 | Bacteria | 5706 |
| 365 | Ga0466959_0225871 | 3300045049 | Bacteria | 1297 |
| 366 | Ga0495633_0000529 | 3300046558 | Bacteria | 38115 |
| 367 | Ga0495668_0000624 | 3300046616 | Bacteria | 42812 |
| 368 | Ga0495668_0003296 | 3300046616 | Bacteria | 12233 |
| 369 | Ga0495668_0073415 | 3300046616 | Bacteria | 1879 |
| 370 | Ga0495625_0180918 | 3300046660 | Bacteria | 1402 |
| 371 | Ga0495635_0218309 | 3300046663 | Bacteria | 1290 |
| 372 | Ga0495636_0000045 | 3300047318 | Bacteria | 53503 |
| 373 | Ga0495674_0118903 | 3300047319 | Bacteria | 2234 |
| 374 | Ga0495686_0004760 | 3300047472 | Bacteria | 10981 |
| 375 | Ga0496105_0317795 | 3300048908 | Bacteria | 1249 |
| 376 | Ga0496114_0000645 | 3300048917 | Bacteria | 25686 |
| 377 | Ga0496115_0027630 | 3300048918 | Bacteria | 4441 |
| 378 | Ga0496121_0000028 | 3300048924 | Bacteria | 439193 |
| 379 | Ga0501298_002704 | 3300049521 | Bacteria | 2707 |
| 380 | Ga0501032_0058867 | 3300049569 | Bacteria | 2579 |
| 381 | Ga0501033_0099689 | 3300049570 | Bacteria | 2121 |
| 382 | Ga0501034_0000114 | 3300049571 | Bacteria | 148505 |
| 383 | Ga0501034_0106487 | 3300049571 | Bacteria | 2797 |
| 384 | Ga0501043_0188737 | 3300049579 | Bacteria | 1603 |
| 385 | Ga0501046_0028214 | 3300049580 | Bacteria | 4573 |
| 386 | Ga0501047_0066874 | 3300049581 | Bacteria | 3464 |
| 387 | Ga0501047_0088956 | 3300049581 | Bacteria | 2965 |
| 388 | Ga0501048_0190943 | 3300049582 | Bacteria | 1451 |
| 389 | Ga0501073_0019001 | 3300049589 | Bacteria | 4965 |
| 390 | Ga0501202_000556 | 3300049652 | Bacteria | 5413 |
| 391 | Ga0501223_009569 | 3300049663 | Bacteria | 1960 |
| 392 | Ga0501235_002733 | 3300049669 | Bacteria | 3791 |
| 393 | Ga0501253_026486 | 3300049683 | Bacteria | 1069 |
| 394 | Ga0501219_000987 | 3300049703 | Bacteria | 3371 |
| 395 | Ga0501221_003284 | 3300049704 | Bacteria | 2658 |
| 396 | Ga0501225_0002223 | 3300049705 | Bacteria | 5999 |
| 397 | Ga0501080_0082275 | 3300049742 | Bacteria | 2990 |
| 398 | Ga0501080_0100230 | 3300049742 | Unclassified | 2687 |
| 399 | Ga0501241_020693 | 3300049758 | Bacteria | 1211 |
| 400 | Ga0501035_0172244 | 3300049822 | Bacteria | 1869 |
| 401 | Ga0501035_0265385 | 3300049822 | Bacteria | 1454 |
| 402 | Ga0501044_0049307 | 3300049823 | Bacteria | 4347 |
| 403 | Ga0501044_0169889 | 3300049823 | Bacteria | 2153 |
| 404 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 405 | nmdc:mga09592_137929_c1 | 3300050508 | Bacteria | 2101 |
| 406 | nmdc:mga09592_2585_c1 | 3300050508 | Bacteria | 14656 |
| 407 | nmdc:mga08y16_46584_c1 | 3300050511 | Bacteria | 4539 |
| 408 | Ga0500644_0000226 | 3300053088 | Bacteria | 32397 |
| 409 | Ga0500556_0006132 | 3300053104 | Bacteria | 3409 |
| 410 | Ga0500594_0022139 | 3300053118 | Bacteria | 1600 |
| 411 | Ga0500559_0019187 | 3300053136 | Bacteria | 2890 |
| 412 | Ga0500568_0016626 | 3300053139 | Bacteria | 3265 |
| 413 | Ga0500588_0008125 | 3300053146 | Unclassified | 2441 |
| 414 | Ga0500590_015500 | 3300053148 | Bacteria | 3934 |
| 415 | Ga0500616_0001400 | 3300053153 | Bacteria | 23227 |
| 416 | Ga0500622_0004747 | 3300053156 | Bacteria | 8376 |
| 417 | Ga0500627_0032787 | 3300053158 | Unclassified | 2191 |
| 418 | Ga0500633_0025549 | 3300053160 | Bacteria | 1848 |
| 419 | Ga0500636_0007045 | 3300053177 | Bacteria | 6485 |
| 420 | Ga0500611_000007 | 3300053727 | Bacteria | 210964 |
| 421 | 2819572788 | 2818991442 | Bacteria | 8318214 |
| 422 | 2819681136 | 2818991460 | Bacteria | 7595395 |
| 423 | 2821139799 | 2821136567 | Bacteria | 8080116 |
| 424 | 2883069417 | 2883068021 | Bacteria | 6192739 |
| 425 | 2884794933 | 2884791551 | Bacteria | 8511252 |
| 426 | 2896088148 | 2896085136 | Bacteria | 6129793 |
| 427 | 2896112119 | 2896109856 | Bacteria | 7140722 |
| 428 | 2904473450 | 2904467357 | Bacteria | 8057758 |
| 429 | 2929179432 | 2929177148 | Bacteria | 7883697 |
| 430 | 2929244699 | 2929239360 | Bacteria | 7745570 |
| 431 | 2929926861 | 2929921140 | Bacteria | 8649150 |
| 432 | 2945981842 | 2945977869 | Bacteria | 7777518 |
| 433 | 2946018757 | 2946013367 | Bacteria | 7766675 |
| 434 | 8003153979 | 8003151029 | Bacteria | 8187759 |
| 435 | 8007373880 | 8007371054 | Bacteria | 4849201 |
| 436 | Ga0453684_0013651 | |||
| 437 | SwRhRL2b_contig_1886170 | |||
| 438 | JGI24739J22299_10001956 | |||
| 439 | JGI25154J39366_1000022 | |||
| 440 | rootH2_10075973 | |||
| 441 | rootH2_10113557 | |||
| 442 | rootH2_10222872 | |||
| 443 | rootL2_10029788 | |||
| 444 | rootL2_10044014 | |||
| 445 | rootL2_10243175 | |||
| 446 | rootH1_10011261 | |||
| 447 | rootH1_10088546 | |||
| 448 | JGI25160J50197_1007665 | |||
| 449 | JGI25160J50197_1008764 | |||
| 450 | JGI25160J50197_1012652 | |||
| 451 | Ga0055535_1001518 | |||
| 452 | Ga0055542_1004831 | |||
| 453 | Ga0055528_1000516 | |||
| 454 | Ga0055530_10004622 | |||
| 455 | Ga0055531_10000263 | |||
| 456 | Ga0065165_1000009 | |||
| 457 | Ga0065165_1012270 | |||
| 458 | Ga0065714_10075163 | |||
| 459 | Ga0065714_10117190 | |||
| 460 | Ga0065704_10070159 | |||
| 461 | Ga0065704_10076558 | |||
| 462 | Ga0070658_10059031 | |||
| 463 | Ga0070658_10449182 | |||
| 464 | Ga0070676_10008376 | |||
| 465 | Ga0070683_100056923 | |||
| 466 | Ga0070683_100100370 | |||
| 467 | Ga0070683_100290869 | |||
| 468 | Ga0070683_100434406 | |||
| 469 | Ga0070690_100011176 | |||
| 470 | Ga0070690_100067016 | |||
| 471 | Ga0068869_100044912 | |||
| 472 | Ga0068869_100079584 | |||
| 473 | Ga0070666_10119954 | |||
| 474 | Ga0070680_100017836 | |||
| 475 | Ga0070680_100091816 | |||
| 476 | Ga0070682_100000306 | |||
| 477 | Ga0068868_100070968 | |||
| 478 | Ga0070660_100004241 | |||
| 479 | Ga0070660_100048349 | |||
| 480 | Ga0070660_100180702 | |||
| 481 | Ga0070660_100184448 | |||
| 482 | Ga0070660_100247974 | |||
| 483 | Ga0070689_100202767 | |||
| 484 | Ga0070687_100090760 | |||
| 485 | Ga0070661_100122823 | |||
| 486 | Ga0070661_100139269 | |||
| 487 | Ga0070669_100094667 | |||
| 488 | Ga0070669_100124448 | |||
| 489 | Ga0070675_100018400 | |||
| 490 | Ga0070675_100045337 | |||
| 491 | Ga0070673_100039276 | |||
| 492 | Ga0070673_100047509 | |||
| 493 | Ga0070659_100014314 | |||
| 494 | Ga0070659_100067032 | |||
| 495 | Ga0070667_100161909 | |||
| 496 | Ga0070701_10059703 | |||
| 497 | Ga0070663_100140687 | |||
| 498 | Ga0070678_100032298 | |||
| 499 | Ga0070662_100022399 | |||
| 500 | Ga0070662_100392444 | |||
| 501 | Ga0070681_10241961 | |||
| 502 | Ga0070681_10323534 | |||
| 503 | Ga0068867_100269529 | |||
| 504 | Ga0070685_10025273 | |||
| 505 | Ga0070685_10085216 | |||
| 506 | Ga0070698_100000620 | |||
| 507 | Ga0070698_100089808 | |||
| 508 | Ga0070679_100008903 | |||
| 509 | Ga0070679_100022591 | |||
| 510 | Ga0070679_100167377 | |||
| 511 | Ga0070679_100192623 | |||
| 512 | Ga0070684_100006918 | |||
| 513 | Ga0070684_100107165 | |||
| 514 | Ga0068853_100042225 | |||
| 515 | Ga0068853_100053095 | |||
| 516 | Ga0068853_100095668 | |||
| 517 | Ga0068853_100350140 | |||
| 518 | Ga0070672_100081011 | |||
| 519 | Ga0070672_100201704 | |||
| 520 | Ga0070672_100396656 | |||
| 521 | Ga0070693_100111242 | |||
| 522 | Ga0070665_100001998 | |||
| 523 | Ga0068855_100002171 | |||
| 524 | Ga0068855_100002670 | |||
| 525 | Ga0068855_100104781 | |||
| 526 | Ga0068855_100260545 | |||
| 527 | Ga0068855_100544723 | |||
| 528 | Ga0068855_100569493 | |||
| 529 | Ga0070664_100032638 | |||
| 530 | Ga0070664_100050977 | |||
| 531 | Ga0070664_100443307 | |||
| 532 | Ga0068857_100025372 | |||
| 533 | Ga0068857_100108593 | |||
| 534 | Ga0068857_100409966 | |||
| 535 | Ga0068854_100020776 | |||
| 536 | Ga0068854_100068559 | |||
| 537 | Ga0068856_100013549 | |||
| 538 | Ga0068856_100033152 | |||
| 539 | Ga0068856_100461582 | |||
| 540 | Ga0070702_100032101 | |||
| 541 | Ga0068852_100014712 | |||
| 542 | Ga0068852_100054178 | |||
| 543 | Ga0068852_100381082 | |||
| 544 | Ga0068852_100554206 | |||
| 545 | Ga0068859_100123542 | |||
| 546 | Ga0068859_100758306 | |||
| 547 | Ga0068864_100035070 | |||
| 548 | Ga0068861_100101603 | |||
| 549 | Ga0068851_10071028 | |||
| 550 | Ga0068851_10117369 | |||
| 551 | Ga0068863_100032694 | |||
| 552 | Ga0068863_100137928 | |||
| 553 | Ga0068860_100006030 | |||
| 554 | Ga0068860_100023245 | |||
| 555 | Ga0068860_100519982 | |||
| 556 | Ga0068862_100009214 | |||
| 557 | Ga0097621_100009836 | |||
| 558 | Ga0097621_100086590 | |||
| 559 | Ga0097621_100438761 | |||
| 560 | Ga0068871_100007325 | |||
| 561 | Ga0068871_100041677 | |||
| 562 | Ga0068871_100228662 | |||
| 563 | Ga0075428_100000886 | |||
| 564 | Ga0075428_100099160 | |||
| 565 | Ga0075428_100325829 | |||
| 566 | Ga0075430_100008079 | |||
| 567 | Ga0075431_100040191 | |||
| 568 | Ga0075429_100061951 | |||
| 569 | Ga0075429_100129020 | |||
| 570 | Ga0075429_100182050 | |||
| 571 | Ga0097620_100123537 | |||
| 572 | Ga0097620_100758237 | |||
| 573 | Ga0105240_10000131 | |||
| 574 | Ga0105240_10279938 | |||
| 575 | Ga0105240_10421719 | |||
| 576 | Ga0105240_10428518 | |||
| 577 | Ga0105240_10448618 | |||
| 578 | Ga0111539_10066958 | |||
| 579 | Ga0111539_10193210 | |||
| 580 | Ga0111539_10460182 | |||
| 581 | Ga0114129_10182137 | |||
| 582 | Ga0105242_10006523 | |||
| 583 | Ga0105242_10015243 | |||
| 584 | Ga0105237_10408048 | |||
| 585 | Ga0105249_10063135 | |||
| 586 | Ga0105239_10086087 | |||
| 587 | Ga0105239_10193622 | |||
| 588 | Ga0105246_10235416 | |||
| 589 | Ga0157373_10001893 | |||
| 590 | Ga0157373_10003168 | |||
| 591 | Ga0157373_10016175 | |||
| 592 | Ga0157373_10217722 | |||
| 593 | Ga0157373_10237759 | |||
| 594 | Ga0157371_10001373 | |||
| 595 | Ga0157371_10001801 | |||
| 596 | Ga0157371_10002444 | |||
| 597 | Ga0157371_10005488 | |||
| 598 | Ga0157371_10007780 | |||
| 599 | Ga0157371_10013240 | |||
| 600 | Ga0157371_10017091 | |||
| 601 | Ga0157371_10024462 | |||
| 602 | Ga0157371_10037672 | |||
| 603 | Ga0157371_10055035 | |||
| 604 | Ga0157370_10001882 | |||
| 605 | Ga0157370_10003515 | |||
| 606 | Ga0157370_10005502 | |||
| 607 | Ga0157370_10072160 | |||
| 608 | Ga0157370_10108684 | |||
| 609 | Ga0157370_10129358 | |||
| 610 | Ga0157370_10149268 | |||
| 611 | Ga0157369_10019925 | |||
| 612 | Ga0157369_10049350 | |||
| 613 | Ga0157369_10059209 | |||
| 614 | Ga0157369_10116529 | |||
| 615 | Ga0157369_10272161 | |||
| 616 | Ga0157369_10365233 | |||
| 617 | Ga0157369_10474772 | |||
| 618 | Ga0157374_10024433 | |||
| 619 | Ga0157374_10055074 | |||
| 620 | Ga0157374_10103708 | |||
| 621 | Ga0157378_10001024 | |||
| 622 | Ga0157378_10017774 | |||
| 623 | Ga0157378_10023600 | |||
| 624 | Ga0157378_10205145 | |||
| 625 | Ga0157378_10467418 | |||
| 626 | Ga0163162_10003984 | |||
| 627 | Ga0163162_10012865 | |||
| 628 | Ga0157372_10014269 | |||
| 629 | Ga0157372_10035811 | |||
| 630 | Ga0157372_10188046 | |||
| 631 | Ga0157372_10637184 | |||
| 632 | Ga0157375_10268442 | |||
| 633 | Ga0157375_10292650 | |||
| 634 | Ga0163163_10007700 | |||
| 635 | Ga0163163_10385580 | |||
| 636 | Ga0157380_10002726 | |||
| 637 | Ga0157380_10197259 | |||
| 638 | Ga0157377_10014443 | |||
| 639 | Ga0157377_10075568 | |||
| 640 | Ga0157377_10103887 | |||
| 641 | Ga0157379_10225175 | |||
| 642 | Ga0182005_1000056 | |||
| 643 | Ga0163161_10107899 | |||
| 644 | Ga0209436_101692 | |||
| 645 | Ga0209436_102099 | |||
| 646 | Ga0209258_100326 | |||
| 647 | Ga0209646_1000003 | |||
| 648 | Ga0209026_1000144 | |||
| 649 | Ga0209148_1000157 | |||
| 650 | Ga0209673_1000103 | |||
| 651 | Ga0209130_1000877 | |||
| 652 | Ga0209564_1026401 | |||
| 653 | Ga0209758_1002411 | |||
| 654 | Ga0209758_1015072 | |||
| 655 | Ga0209758_1016579 | |||
| 656 | Ga0209050_1000156 | |||
| 657 | Ga0207426_1000034 | |||
| 658 | Ga0207426_1000414 | |||
| 659 | Ga0207426_1006845 | |||
| 660 | Ga0209257_1000025 | |||
| 661 | Ga0209257_1001629 | |||
| 662 | Ga0207682_10015865 | |||
| 663 | Ga0207688_10025905 | |||
| 664 | Ga0207680_10144213 | |||
| 665 | Ga0207647_10000648 | |||
| 666 | Ga0207647_10003926 | |||
| 667 | Ga0207645_10018723 | |||
| 668 | Ga0207643_10004783 | |||
| 669 | Ga0207705_10036475 | |||
| 670 | Ga0207705_10173710 | |||
| 671 | Ga0207707_10156689 | |||
| 672 | Ga0207707_10157398 | |||
| 673 | Ga0207695_10000217 | |||
| 674 | Ga0207695_10040131 | |||
| 675 | Ga0207695_10048669 | |||
| 676 | Ga0207695_10130180 | |||
| 677 | Ga0207671_10000588 | |||
| 678 | Ga0207662_10057025 | |||
| 679 | Ga0207657_10009263 | |||
| 680 | Ga0207657_10015521 | |||
| 681 | Ga0207657_10029735 | |||
| 682 | Ga0207657_10415763 | |||
| 683 | Ga0207649_10091439 | |||
| 684 | Ga0207652_10000016 | |||
| 685 | Ga0207652_10000541 | |||
| 686 | Ga0207652_10015949 | |||
| 687 | Ga0207652_10049701 | |||
| 688 | Ga0207652_10057219 | |||
| 689 | Ga0207652_10167186 | |||
| 690 | Ga0207681_10249133 | |||
| 691 | Ga0207650_10003011 | |||
| 692 | Ga0207650_10047948 | |||
| 693 | Ga0207650_10229941 | |||
| 694 | Ga0207659_10076779 | |||
| 695 | Ga0207659_10108759 | |||
| 696 | Ga0207659_10125623 | |||
| 697 | Ga0207644_10006488 | |||
| 698 | Ga0207690_10003448 | |||
| 699 | Ga0207690_10038325 | |||
| 700 | Ga0207706_10024696 | |||
| 701 | Ga0207686_10003687 | |||
| 702 | Ga0207686_10016917 | |||
| 703 | Ga0207669_10217765 | |||
| 704 | Ga0207689_10017784 | |||
| 705 | Ga0207661_10074750 | |||
| 706 | Ga0207661_10081088 | |||
| 707 | Ga0207661_10503095 | |||
| 708 | Ga0207679_10037169 | |||
| 709 | Ga0207679_10313254 | |||
| 710 | Ga0207667_10000478 | |||
| 711 | Ga0207667_10010177 | |||
| 712 | Ga0207667_10354390 | |||
| 713 | Ga0207651_10025353 | |||
| 714 | Ga0207651_10072893 | |||
| 715 | Ga0207651_10431789 | |||
| 716 | Ga0207712_10103729 | |||
| 717 | Ga0207712_10224177 | |||
| 718 | Ga0207658_10084098 | |||
| 719 | Ga0207658_10187166 | |||
| 720 | Ga0207677_10114699 | |||
| 721 | Ga0207639_10034738 | |||
| 722 | Ga0207639_10308082 | |||
| 723 | Ga0207639_10309922 | |||
| 724 | Ga0207678_10276537 | |||
| 725 | Ga0207702_10068946 | |||
| 726 | Ga0207641_10011153 | |||
| 727 | Ga0207641_10016921 | |||
| 728 | Ga0207641_10376476 | |||
| 729 | Ga0207648_10062451 | |||
| 730 | Ga0207648_10264177 | |||
| 731 | Ga0207648_10287877 | |||
| 732 | Ga0207648_10314892 | |||
| 733 | Ga0207676_10043138 | |||
| 734 | Ga0207676_10164260 | |||
| 735 | Ga0207676_10572235 | |||
| 736 | Ga0207674_10049522 | |||
| 737 | Ga0207674_10138483 | |||
| 738 | Ga0207674_10180543 | |||
| 739 | Ga0207674_10373633 | |||
| 740 | Ga0207675_100011079 | |||
| 741 | Ga0207675_100286462 | |||
| 742 | Ga0207683_10071240 | |||
| 743 | Ga0207683_10305446 | |||
| 744 | Ga0207683_10557651 | |||
| 745 | Ga0207698_10204632 | |||
| 746 | Ga0207698_10500694 | |||
| 747 | Ga0207698_10628452 | |||
| 748 | Ga0209995_1002788 | |||
| 749 | Ga0268266_10001978 | |||
| 750 | Ga0268264_10014637 | |||
| 751 | Ga0268264_10014849 | |||
| 752 | Ga0268264_10514368 | |||
| 753 | Ga0265334_10005185 | |||
| 754 | Ga0265334_10040387 | |||
| 755 | Ga0265338_10229601 | |||
| 756 | Ga0265324_10033752 | |||
| 757 | Ga0265327_10000009 | |||
| 758 | Ga0265327_10000975 | |||
| 759 | Ga0307509_10076924 | |||
| 760 | Ga0307408_100172234 | |||
| 761 | Ga0307508_10002565 | |||
| 762 | Ga0265314_10033369 | |||
| 763 | Ga0307405_10060863 | |||
| 764 | Ga0307413_10010015 | |||
| 765 | Ga0307413_10253627 | |||
| 766 | Ga0307407_10024067 | |||
| 767 | Ga0307409_100009385 | |||
| 768 | Ga0307414_10179644 | |||
| 769 | Ga0307411_10160712 | |||
| 770 | Ga0307415_100001047 | |||
| 771 | Ga0395899_0002265 | |||
| 772 | Ga0395899_0028634 | |||
| 773 | Ga0395899_0050688 | |||
| 774 | Ga0395899_0143752 | |||
| 775 | Ga0395900_0004008 | |||
| 776 | Ga0395900_0021378 | |||
| 777 | Ga0395900_0068255 | |||
| 778 | Ga0395900_0134901 | |||
| 779 | Ga0395900_0148830 | |||
| 780 | Ga0395900_0188894 | |||
| 781 | Ga0395898_0001712 | |||
| 782 | Ga0395898_0006132 | |||
| 783 | Ga0395898_0413636 | |||
| 784 | Ga0395905_0005098 | |||
| 785 | Ga0395905_0060028 | |||
| 786 | Ga0395905_0127821 | |||
| 787 | Ga0395905_0169420 | |||
| 788 | Ga0395901_0001588 | |||
| 789 | Ga0395901_0023432 | |||
| 790 | Ga0451791_1448639 | |||
| 791 | Ga0439431_0000426 | |||
| 792 | Ga0439445_0004590 | |||
| 793 | Ga0439449_0034823 | |||
| 794 | Ga0439444_0003703 | |||
| 795 | Ga0451577_0000329 | |||
| 796 | Ga0453683_0075093 | |||
| 797 | Ga0453684_0008748 | |||
| 798 | Ga0466957_0166496 | |||
| 799 | Ga0466959_0014638 | |||
| 800 | Ga0466959_0225871 | |||
| 801 | Ga0495633_0000529 | |||
| 802 | Ga0495668_0000624 | |||
| 803 | Ga0495668_0003296 | |||
| 804 | Ga0495668_0073415 | |||
| 805 | Ga0495625_0180918 | |||
| 806 | Ga0495635_0218309 | |||
| 807 | Ga0495636_0000045 | |||
| 808 | Ga0495674_0118903 | |||
| 809 | Ga0495686_0004760 | |||
| 810 | Ga0496105_0317795 | |||
| 811 | Ga0496114_0000645 | |||
| 812 | Ga0496115_0027630 | |||
| 813 | Ga0496121_0000028 | |||
| 814 | Ga0501298_002704 | |||
| 815 | Ga0501032_0058867 | |||
| 816 | Ga0501033_0099689 | |||
| 817 | Ga0501034_0000114 | |||
| 818 | Ga0501034_0106487 | |||
| 819 | Ga0501043_0188737 | |||
| 820 | Ga0501046_0028214 | |||
| 821 | Ga0501047_0066874 | |||
| 822 | Ga0501047_0088956 | |||
| 823 | Ga0501048_0190943 | |||
| 824 | Ga0501073_0019001 | |||
| 825 | Ga0501202_000556 | |||
| 826 | Ga0501223_009569 | |||
| 827 | Ga0501235_002733 | |||
| 828 | Ga0501253_026486 | |||
| 829 | Ga0501219_000987 | |||
| 830 | Ga0501221_003284 | |||
| 831 | Ga0501225_0002223 | |||
| 832 | Ga0501080_0082275 | |||
| 833 | Ga0501080_0100230 | |||
| 834 | Ga0501241_020693 | |||
| 835 | Ga0501035_0172244 | |||
| 836 | Ga0501035_0265385 | |||
| 837 | Ga0501044_0049307 | |||
| 838 | Ga0501044_0169889 | |||
| 839 | Ga0501284_00029 | |||
| 840 | nmdc:mga09592_137929_c1 | |||
| 841 | nmdc:mga09592_2585_c1 | |||
| 842 | nmdc:mga08y16_46584_c1 | |||
| 843 | Ga0500644_0000226 | |||
| 844 | Ga0500556_0006132 | |||
| 845 | Ga0500594_0022139 | |||
| 846 | Ga0500559_0019187 | |||
| 847 | Ga0500568_0016626 | |||
| 848 | Ga0500588_0008125 | |||
| 849 | Ga0500590_015500 | |||
| 850 | Ga0500616_0001400 | |||
| 851 | Ga0500622_0004747 | |||
| 852 | Ga0500627_0032787 | |||
| 853 | Ga0500633_0025549 | |||
| 854 | Ga0500636_0007045 | |||
| 855 | Ga0500611_000007 | |||
| 856 | 2819572788 | |||
| 857 | 2819681136 | |||
| 858 | 2821139799 | |||
| 859 | 2883069417 | |||
| 860 | 2884794933 | |||
| 861 | 2896088148 | |||
| 862 | 2896112119 | |||
| 863 | 2904473450 | |||
| 864 | 2929179432 | |||
| 865 | 2929244699 | |||
| 866 | 2929926861 | |||
| 867 | 2945981842 | |||
| 868 | 2946018757 | |||
| 869 | 8003153979 | |||
| 870 | 8007373880 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dkt-assembly4.cif.gz_D | crystal structure of arginase from bacillus subtilis | 0.9089 | 2 | 312 |
| 6nfp-assembly1.cif.gz_A | 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. subtilis str. 168 | 0.8955 | 2 | 312 |
| 6dkt-assembly6.cif.gz_F | crystal structure of arginase from bacillus subtilis | 0.8913 | 2 | 312 |
| 6dkt-assembly4.cif.gz_D | crystal structure of arginase from bacillus subtilis | 0.8904 | 2 | 312 |
| 6dkt-assembly5.cif.gz_E | crystal structure of arginase from bacillus subtilis | 0.887 | 4 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6nfpA00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.897 | 2 | 312 | 3.40.800.10 |
| 6nfpA00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.8795 | 2 | 312 | 3.40.800.10 |
| af_A0A1X7RC97_10_314_3.40.800.10 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.8749 | 2 | 314 | 3.40.800.10 |
| af_A0A1X7RC97_10_314_3.40.800.10 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.8397 | 2 | 314 | 3.40.800.10 |
| 3pzlA00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain | 0.8339 | 2 | 312 | 3.40.800.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3KSU2-F1-model_v4 | Arginase (EC 3.5.3.1) | 0.9898 | 103 | 314 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |
| AF-A0A142ENP1-F1-model_v4 | Arginase (EC 3.5.3.1) | 0.9799 | 1 | 315 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |
| AF-A0A258KJY3-F1-model_v4 | Arginase | 0.9797 | 103 | 196 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |
| AF-A0A7Y7AFG3-F1-model_v4 | Arginase (EC 3.5.3.1) | 0.979 | 1 | 312 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |
| AF-A0A2E2NZH2-F1-model_v4 | Arginase (EC 3.5.3.1) | 0.9778 | 1 | 312 |
GO:0004053
GO:0005829 GO:0019547 GO:0030145 |