F443392

General Info

Members Datasets Scaffolds Average Seq Length
435 328 328 347

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0035182|Ga0495653_0035182_2291_3439
Length 382
Sequence MKHEQRSLTIARLQKANNKIIEREPMFLRNAWYVAASEAELGEELYPVTLLNEPVVLYRKSDGTPVALEDACPHRKLPLSMGRRKGDDIECGYHGLTFDCSGSCVHAPGSRRIPQGAKVRSYPLAVRYGLIWIWMGDLELADETKICHVPEWGDPAWGLNRGDSMVIPCNYLYMTDNLLDPAHVAWVHQSSFGNSACAEEPLQTTVTDAGVIVSRWMRDVEVAPFYAKFVRFKGNCDRKQHYEVHYPAQAIIKALFTPAGTGSDEGALHEHVFLMNSYNFMTPIDESNTRYYWFQVRNFDTENEDVSRQFDEDVRHAFAEDRVVLSAVHKGMANKRSPNIDLASDSGPLRFRRNLSKLIAQEQHGSLIPLTEQHTAEQKTEA

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2511231008 Pseudomonas sp. GM21 Isolate Nodule
3 2511231017 Pseudomonas sp. GM55 Isolate Nodule
4 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
7 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
8 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
9 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
10 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
11 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
12 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
13 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
14 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
15 2643221618 Ensifer sp. Root231 Isolate Unclassified
16 2643221626 Ensifer sp. Root31 Isolate Unclassified
17 2643221655 Ensifer sp. Root1252 Isolate Unclassified
18 2643221659 Ensifer sp. Root127 Isolate Unclassified
19 2643221693 Rhizobium sp. Root491 Isolate Unclassified
20 2643221712 Ensifer sp. Root258 Isolate Unclassified
21 2643221723 Ensifer sp. Root278 Isolate Unclassified
22 2643221736 Bosea sp. Root483D1 Isolate Unclassified
23 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
24 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
25 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
26 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
27 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
28 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
29 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
30 2841760612 Bosea sp. Tri-49 Isolate Nodule
31 2844104063 Bosea sp. Tri-39 Isolate Nodule
32 2844163670 Ensifer sp. 1H6 Isolate Unclassified
33 2851182111 Bosea sp. Tri-44 Isolate Nodule
34 2851246043 Bosea sp. Tri-54 Isolate Nodule
35 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
36 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
37 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
38 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
39 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
40 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
41 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
42 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
43 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
44 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
45 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
46 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
47 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
48 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
49 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
50 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
51 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
52 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
53 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
54 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
55 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
56 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
57 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
58 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
59 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
60 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
61 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
62 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
63 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
64 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
65 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
66 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
67 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
68 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
69 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
70 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
71 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
72 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
73 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
74 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
75 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
76 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
77 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
78 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
79 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
80 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
81 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
82 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
83 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
84 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
85 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
86 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
87 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
88 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
89 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
90 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
91 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
92 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
93 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
94 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
95 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
96 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
97 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
98 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
99 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
100 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
101 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
102 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
103 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
104 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
105 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
106 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
107 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
108 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
109 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
110 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
111 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
112 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
113 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
114 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
115 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
116 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
117 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
118 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
119 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
120 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
121 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
122 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
123 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
124 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
125 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
126 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
127 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
128 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
129 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
130 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
131 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
132 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
133 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
134 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
135 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
162 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
209 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
210 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
211 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
214 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
314 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
315 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
316 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
317 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
323 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
324 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
325 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
326 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
327 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
328 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75.4
Metatranscriptomes 0
Isolates 24.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.95
Nodule 15.63
Rhizoplane 6.21
Rhizosphere 50.34
Stem 0
Stem Tuber 0
Unclassified 15.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000490 3300002739 Bacteria 8016
2 JGI25159J45721_1000197 3300002987 Bacteria 27948
3 JGI25151J46595_10007654 3300003187 Bacteria 5270
4 JGI25165J46597_1000254 3300003214 Bacteria 71635
5 rootH1_10170575 3300003316 Bacteria 1955
6 rootH2_10024275 3300003320 Bacteria 3390
7 rootL2_10022718 3300003322 Bacteria 2044
8 rootH1_10192494 3300003323 Bacteria 4883
9 JGI25160J50197_1000074 3300003354 Bacteria 103621
10 JGI25160J50197_1001852 3300003354 Bacteria 10146
11 JGI25161J50226_1000897 3300003374 Bacteria 10750
12 Ga0055524_1003017 3300003775 Bacteria 8336
13 Ga0055536_1001205 3300003781 Bacteria 16057
14 Ga0055534_1004687 3300003784 Bacteria 3874
15 Ga0055531_10003279 3300003794 Bacteria 10376
16 Ga0055543_1000558 3300004625 Bacteria 20769
17 Ga0065165_1000203 3300005262 Bacteria 103001
18 Ga0065165_1003455 3300005262 Bacteria 11079
19 Ga0070658_10096908 3300005327 Bacteria 2435
20 Ga0070689_100102906 3300005340 Bacteria 2263
21 Ga0070675_100027993 3300005354 Unclassified 4531
22 Ga0070674_100006432 3300005356 Bacteria 6856
23 Ga0070674_100014583 3300005356 Unclassified 4889
24 Ga0070673_100138809 3300005364 Bacteria 2049
25 Ga0070688_100094578 3300005365 Unclassified 1960
26 Ga0070710_10221930 3300005437 Bacteria 1203
27 Ga0070681_10284297 3300005458 Bacteria 1565
28 Ga0068867_100005260 3300005459 Bacteria 9144
29 Ga0068867_100255809 3300005459 Bacteria 1426
30 Ga0070707_100317459 3300005468 Unclassified 1514
31 Ga0070679_100194936 3300005530 Bacteria 1993
32 Ga0068853_100120831 3300005539 Bacteria 2337
33 Ga0070665_100024780 3300005548 Bacteria 6044
34 Ga0068855_100106509 3300005563 Bacteria 3222
35 Ga0068858_100275349 3300005842 Bacteria 1602
36 Ga0068860_100013012 3300005843 Bacteria 8171
37 Ga0081455_10030375 3300005937 Bacteria 4907
38 Ga0075432_10001081 3300006058 Bacteria 8668
39 Ga0075432_10002331 3300006058 Bacteria 6322
40 Ga0075432_10009500 3300006058 Bacteria 3312
41 Ga0070716_100223672 3300006173 Bacteria 1266
42 Ga0075362_10002412 3300006177 Bacteria 6270
43 Ga0075367_10074819 3300006178 Bacteria 2042
44 Ga0075369_10023075 3300006186 Bacteria 2570
45 Ga0075366_10087066 3300006195 Bacteria 1869
46 Ga0097621_100418605 3300006237 Bacteria 1202
47 Ga0068865_100103459 3300006881 Bacteria 2089
48 Ga0105244_10000053 3300009036 Bacteria 133900
49 Ga0105240_10063142 3300009093 Bacteria 4608
50 Ga0105240_10162684 3300009093 Bacteria 2649
51 Ga0105240_10333650 3300009093 Bacteria 1725
52 Ga0114129_10493052 3300009147 Bacteria 1601
53 Ga0105243_10017563 3300009148 Bacteria 5411
54 Ga0105242_10000674 3300009176 Bacteria 26770
55 Ga0105248_10079351 3300009177 Bacteria 3689
56 Ga0105237_10047452 3300009545 Bacteria 4318
57 Ga0105238_10220416 3300009551 Bacteria 1873
58 Ga0105033_102149 3300009986 Bacteria 1633
59 Ga0105239_10018942 3300010375 Bacteria 7607
60 Ga0157373_10002023 3300013100 Bacteria 15353
61 Ga0157373_10043019 3300013100 Bacteria 3227
62 Ga0157371_10000205 3300013102 Bacteria 86623
63 Ga0157370_10000752 3300013104 Bacteria 40508
64 Ga0157370_10201066 3300013104 Bacteria 1848
65 Ga0171463_1012 3300013249 Bacteria 176554
66 Ga0157378_10005470 3300013297 Bacteria 11128
67 Ga0163162_10002480 3300013306 Bacteria 17431
68 Ga0163162_10179717 3300013306 Bacteria 2242
69 Ga0163162_10253890 3300013306 Bacteria 1890
70 Ga0157375_10201598 3300013308 Bacteria 2146
71 Ga0182008_10011211 3300014497 Bacteria 4775
72 Ga0157379_10099067 3300014968 Bacteria 2616
73 Ga0157379_10102660 3300014968 Bacteria 2566
74 Ga0183365_10414 3300015684 Bacteria 1362
75 Ga0183363_1083 3300015690 Bacteria 28517
76 Ga0163161_10004824 3300017792 Bacteria 9395
77 Ga0209436_100849 3300025208 Bacteria 12284
78 Ga0209233_1000028 3300025261 Bacteria 642062
79 Ga0209233_1007264 3300025261 Bacteria 3518
80 Ga0209565_1019260 3300025263 Bacteria 1461
81 Ga0209130_1000242 3300025284 Bacteria 69580
82 Ga0209130_1001805 3300025284 Bacteria 12467
83 Ga0209130_1007780 3300025284 Bacteria 3254
84 Ga0209675_1002231 3300025291 Bacteria 10121
85 Ga0209676_1002608 3300025292 Bacteria 12353
86 Ga0209025_1003466 3300025294 Bacteria 14894
87 Ga0209564_1000338 3300025295 Bacteria 90246
88 Ga0209564_1024498 3300025295 Bacteria 2060
89 Ga0209050_1005855 3300025298 Bacteria 7530
90 Ga0209256_1004020 3300025299 Bacteria 9605
91 Ga0209256_1005992 3300025299 Bacteria 6671
92 Ga0207426_1000018 3300025302 Bacteria 566740
93 Ga0207426_1000483 3300025302 Bacteria 60265
94 Ga0209051_1014600 3300025303 Bacteria 3654
95 Ga0209051_1015845 3300025303 Bacteria 3450
96 Ga0209257_1004449 3300025304 Bacteria 10852
97 Ga0207655_1000049 3300025728 Bacteria 295872
98 Ga0207645_10221156 3300025907 Bacteria 1248
99 Ga0207705_10055720 3300025909 Bacteria 2850
100 Ga0207657_10002029 3300025919 Bacteria 21874
101 Ga0207657_10138064 3300025919 Bacteria 1993
102 Ga0207652_10032816 3300025921 Bacteria 4368
103 Ga0207681_10136690 3300025923 Bacteria 1820
104 Ga0207659_10304666 3300025926 Bacteria 1310
105 Ga0207700_10060357 3300025928 Bacteria 2872
106 Ga0207669_10006697 3300025937 Bacteria 5284
107 Ga0207704_10089435 3300025938 Bacteria 2018
108 Ga0207711_10087189 3300025941 Unclassified 2738
109 Ga0207708_10085130 3300026075 Unclassified 2432
110 Ga0207648_10013815 3300026089 Bacteria 7490
111 Ga0209813_10006081 3300027866 Bacteria 2966
112 Ga0207428_10001910 3300027907 Bacteria 21092
113 Ga0207428_10033711 3300027907 Bacteria 4202
114 Ga0207428_10099030 3300027907 Bacteria 2255
115 Ga0268266_10025224 3300028379 Bacteria 5061
116 Ga0268266_10025790 3300028379 Bacteria 5001
117 Ga0268264_10027110 3300028381 Bacteria 4680
118 Ga0265334_10005389 3300028573 Bacteria 5589
119 Ga0307515_10000068 3300028794 Bacteria 242305
120 Ga0307513_10002516 3300031456 Bacteria 25320
121 Ga0307513_10073373 3300031456 Bacteria 3563
122 Ga0307509_10000002 3300031507 Bacteria 607551
123 Ga0307510_10021387 3300033180 Bacteria 7538
124 Ga0373927_0002886 3300035695 Bacteria 12518
125 Ga0373925_0003076 3300037068 Bacteria 13106
126 Ga0373925_0509947 3300037068 Bacteria 988
127 Ga0395900_0007304 3300037418 Bacteria 11427
128 Ga0395900_0007844 3300037418 Bacteria 11004
129 Ga0395900_0276618 3300037418 Bacteria 1672
130 Ga0395898_0460104 3300037466 Bacteria 1211
131 Ga0395905_0000069 3300037471 Bacteria 176869
132 Ga0395905_0008159 3300037471 Bacteria 10343
133 Ga0395905_0054340 3300037471 Bacteria 3748
134 Ga0395905_0127225 3300037471 Bacteria 2396
135 Ga0436364_1306614 3300037853 Bacteria 3032
136 Ga0395901_0014117 3300038443 Bacteria 8132
137 Ga0395901_0144909 3300038443 Bacteria 2497
138 Ga0395901_0316419 3300038443 Bacteria 1616
139 Ga0400483_091689 3300039062 Bacteria 4874
140 Ga0400483_269689 3300039062 Bacteria 3206
141 Ga0436365_0170337 3300039437 Bacteria 5629
142 Ga0439466_0000871 3300041411 Bacteria 11500
143 Ga0451833_0339001 3300041491 Bacteria 14396
144 Ga0451835_0845791 3300041492 Bacteria 3347
145 Ga0451839_0731668 3300041496 Bacteria 10168
146 Ga0451841_0586496 3300041498 Bacteria 13968
147 Ga0451849_1159032 3300041505 Bacteria 7976
148 Ga0451851_1124435 3300041507 Bacteria 2073
149 Ga0451843_0128525 3300041509 Bacteria 18171
150 Ga0439432_018052 3300042006 Bacteria 2361
151 Ga0439451_006069 3300042009 Bacteria 2468
152 Ga0495603_0008450 3300046455 Bacteria 6220
153 Ga0495590_0013313 3300046457 Bacteria 3028
154 Ga0495629_0000104 3300046459 Bacteria 74918
155 Ga0495629_0000209 3300046459 Bacteria 52407
156 Ga0495638_0007141 3300046460 Bacteria 8049
157 Ga0495651_0067762 3300046462 Bacteria 2722
158 Ga0495653_0000110 3300046463 Bacteria 68799
159 Ga0495653_0000517 3300046463 Bacteria 29685
160 Ga0495653_0005171 3300046463 Bacteria 10603
161 Ga0495653_0035182 3300046463 Bacteria 3954
162 Ga0495653_0087386 3300046463 Bacteria 2290
163 Ga0495650_0001343 3300046471 Bacteria 24513
164 Ga0495650_0008604 3300046471 Bacteria 5924
165 Ga0495580_0007181 3300046472 Bacteria 8967
166 Ga0495580_0008464 3300046472 Bacteria 8183
167 Ga0495580_0009677 3300046472 Bacteria 7565
168 Ga0495580_0030945 3300046472 Bacteria 3870
169 Ga0495605_0010315 3300046474 Bacteria 5229
170 Ga0495639_0001255 3300046475 Bacteria 11434
171 Ga0495585_0000283 3300046492 Bacteria 50893
172 Ga0495594_0124978 3300046499 Bacteria 1455
173 Ga0495596_0047102 3300046500 Bacteria 1692
174 Ga0495607_0001056 3300046501 Bacteria 25163
175 Ga0495583_0005642 3300046506 Bacteria 8428
176 Ga0495583_0018856 3300046506 Bacteria 3618
177 Ga0495606_0000421 3300046507 Bacteria 70842
178 Ga0495606_0047573 3300046507 Bacteria 2826
179 Ga0495610_0069303 3300046512 Bacteria 1651
180 Ga0495620_0001400 3300046515 Bacteria 14475
181 Ga0495620_0072777 3300046515 Bacteria 1403
182 Ga0495628_0006670 3300046516 Bacteria 10067
183 Ga0495628_0163275 3300046516 Bacteria 1692
184 Ga0495630_0004931 3300046517 Bacteria 9385
185 Ga0495630_0005234 3300046517 Bacteria 9144
186 Ga0495630_0011729 3300046517 Bacteria 6350
187 Ga0495630_0034117 3300046517 Bacteria 3797
188 Ga0495631_0043517 3300046518 Bacteria 1981
189 Ga0495637_0001742 3300046520 Bacteria 12478
190 Ga0495637_0032671 3300046520 Bacteria 2291
191 Ga0495648_0000186 3300046524 Bacteria 71253
192 Ga0495666_0000015 3300046526 Bacteria 76311
193 Ga0495666_0000164 3300046526 Bacteria 28060
194 Ga0495642_0000413 3300046528 Bacteria 22884
195 Ga0495665_0011501 3300046531 Bacteria 4792
196 Ga0495586_0177507 3300046535 Bacteria 1204
197 Ga0495587_0000602 3300046536 Bacteria 24603
198 Ga0495587_0104537 3300046536 Bacteria 1630
199 Ga0495645_0003123 3300046543 Bacteria 11221
200 Ga0495633_0013795 3300046558 Bacteria 4245
201 Ga0495633_0049725 3300046558 Bacteria 1978
202 Ga0495667_0039675 3300046559 Bacteria 3130
203 Ga0495656_0013761 3300046615 Bacteria 3017
204 Ga0495668_0008617 3300046616 Bacteria 6342
205 Ga0495668_0042527 3300046616 Bacteria 2530
206 Ga0495611_0070887 3300046648 Bacteria 1593
207 Ga0495625_0069709 3300046660 Bacteria 2470
208 Ga0495625_0073793 3300046660 Bacteria 2391
209 Ga0495661_0000013 3300046665 Bacteria 259387
210 Ga0495599_0001241 3300046678 Bacteria 14475
211 Ga0495623_0000396 3300046679 Bacteria 28785
212 Ga0495623_0001967 3300046679 Bacteria 13800
213 Ga0495623_0024229 3300046679 Bacteria 3913
214 Ga0495646_0000341 3300046680 Bacteria 23869
215 Ga0495646_0002839 3300046680 Bacteria 10718
216 Ga0495646_0086281 3300046680 Bacteria 1821
217 Ga0495613_0081429 3300046689 Bacteria 2352
218 Ga0495624_0013125 3300046690 Bacteria 5649
219 Ga0495624_0041078 3300046690 Bacteria 2960
220 Ga0495649_0000533 3300046694 Bacteria 32351
221 Ga0495649_0147982 3300046694 Bacteria 1234
222 Ga0495589_0004967 3300046794 Bacteria 7045
223 Ga0495589_0019150 3300046794 Bacteria 3512
224 Ga0495600_0024857 3300046809 Bacteria 3856
225 Ga0495600_0037420 3300046809 Bacteria 3154
226 Ga0495600_0129446 3300046809 Bacteria 1641
227 Ga0495581_0002241 3300047315 Bacteria 10877
228 Ga0495604_0000098 3300047317 Bacteria 74604
229 Ga0495604_0000779 3300047317 Bacteria 26812
230 Ga0495604_0006984 3300047317 Bacteria 8944
231 Ga0495674_0001278 3300047319 Bacteria 24446
232 Ga0495674_0012079 3300047319 Bacteria 8139
233 Ga0495674_0016966 3300047319 Bacteria 6787
234 Ga0495674_0043189 3300047319 Bacteria 4014
235 Ga0495674_0072095 3300047319 Bacteria 2979
236 Ga0495672_0016031 3300047320 Bacteria 5069
237 Ga0495672_0022634 3300047320 Bacteria 4081
238 Ga0495672_0059412 3300047320 Bacteria 2212
239 Ga0495676_0014494 3300047321 Bacteria 7053
240 Ga0495680_0003509 3300047322 Bacteria 15383
241 Ga0495680_0153117 3300047322 Bacteria 1679
242 Ga0495683_0000019 3300047323 Bacteria 183206
243 Ga0495683_0006491 3300047323 Bacteria 6389
244 Ga0495687_036740 3300047443 Bacteria 2188
245 Ga0495675_0002056 3300047444 Bacteria 12034
246 Ga0495675_0032269 3300047444 Bacteria 3341
247 Ga0495679_000008 3300047446 Bacteria 367186
248 Ga0495673_0000525 3300047469 Bacteria 40095
249 Ga0495673_0017130 3300047469 Bacteria 3687
250 Ga0495681_0000639 3300047470 Bacteria 26632
251 Ga0495681_0002188 3300047470 Bacteria 14144
252 Ga0495681_0004356 3300047470 Bacteria 9680
253 Ga0495681_0025440 3300047470 Bacteria 3097
254 Ga0495684_0016375 3300047471 Bacteria 5708
255 Ga0495686_0000110 3300047472 Bacteria 169827
256 Ga0495686_0142019 3300047472 Bacteria 1416
257 Ga0495593_0000396 3300047673 Bacteria 24233
258 Ga0495593_0000716 3300047673 Bacteria 19215
259 Ga0495593_0005137 3300047673 Bacteria 7736
260 Ga0495593_0014162 3300047673 Bacteria 4538
261 Ga0495602_0003815 3300048088 Bacteria 15675
262 Ga0495614_0008406 3300048089 Bacteria 4590
263 Ga0495626_0025256 3300048091 Bacteria 2907
264 Ga0496100_0000040 3300048903 Bacteria 92907
265 Ga0496100_0030763 3300048903 Bacteria 3332
266 Ga0496100_0424519 3300048903 Bacteria 1016
267 Ga0496101_0001993 3300048904 Bacteria 12383
268 Ga0496101_0006830 3300048904 Bacteria 7366
269 Ga0496101_0008563 3300048904 Bacteria 6687
270 Ga0496101_0018207 3300048904 Bacteria 4773
271 Ga0496102_0001350 3300048905 Bacteria 21980
272 Ga0496102_0006708 3300048905 Bacteria 9832
273 Ga0496102_0201897 3300048905 Bacteria 1874
274 Ga0496103_0000387 3300048906 Bacteria 39388
275 Ga0496103_0132204 3300048906 Bacteria 1594
276 Ga0496104_0017610 3300048907 Bacteria 6509
277 Ga0496104_0023270 3300048907 Bacteria 5696
278 Ga0496105_0026867 3300048908 Bacteria 4697
279 Ga0496106_0108235 3300048909 Bacteria 2162
280 Ga0496106_0333898 3300048909 Bacteria 1217
281 Ga0496107_0021356 3300048910 Bacteria 4576
282 Ga0496109_0341967 3300048912 Bacteria 1413
283 Ga0496110_0007558 3300048913 Bacteria 8681
284 Ga0496110_0047802 3300048913 Bacteria 3748
285 Ga0496111_0210500 3300048914 Bacteria 1444
286 Ga0496112_0003508 3300048915 Bacteria 12998
287 Ga0496112_0056518 3300048915 Bacteria 3862
288 Ga0496114_0046251 3300048917 Bacteria 3616
289 Ga0496115_0368865 3300048918 Bacteria 1169
290 Ga0496116_0000309 3300048919 Bacteria 81667
291 Ga0496116_0009905 3300048919 Bacteria 8058
292 Ga0496116_0064470 3300048919 Bacteria 2355
293 Ga0496117_0000002 3300048920 Bacteria 2483758
294 Ga0496117_0001866 3300048920 Bacteria 28433
295 Ga0496118_0000206 3300048921 Bacteria 104093
296 Ga0496118_0000501 3300048921 Bacteria 64803
297 Ga0496118_0007662 3300048921 Bacteria 11365
298 Ga0496120_0000093 3300048923 Bacteria 146905
299 Ga0496121_0022382 3300048924 Bacteria 6136
300 Ga0496121_0185386 3300048924 Bacteria 1497
301 Ga0496122_0000004 3300048925 Bacteria 645283
302 Ga0496122_0000072 3300048925 Bacteria 222436
303 Ga0496123_0000007 3300048926 Bacteria 645283
304 Ga0496123_0000035 3300048926 Bacteria 267288
305 Ga0496124_0001839 3300048927 Bacteria 29294
306 Ga0496124_0032089 3300048927 Bacteria 4644
307 Ga0496124_0086770 3300048927 Bacteria 2561
308 Ga0496125_0009321 3300048928 Bacteria 10120
309 Ga0496126_0000243 3300048929 Bacteria 117685
310 Ga0495682_0000174 3300049460 Bacteria 54279
311 Ga0501034_0478563 3300049571 Bacteria 1161
312 Ga0501036_0263076 3300049572 Bacteria 1445
313 Ga0501080_0083529 3300049742 Bacteria 2967
314 Ga0501083_0123493 3300049744 Bacteria 1698
315 Ga0501035_0094681 3300049822 Bacteria 2626
316 nmdc:mga00v17_1745_c1 3300050491 Bacteria 11304
317 nmdc:mga0yw44_3693_c1 3300050492 Bacteria 6850
318 nmdc:mga0k408_88988_c1 3300050493 Bacteria 1813
319 nmdc:mga0sz30_193_c1 3300050516 Bacteria 22669
320 Ga0500560_002587 3300053107 Bacteria 3492
321 Ga0500572_007745 3300053111 Bacteria 2493
322 Ga0500658_0022645 3300053134 Bacteria 2392
323 Ga0500604_0001768 3300053151 Bacteria 6043
324 Ga0500604_0011533 3300053151 Bacteria 2374
325 Ga0500616_0007080 3300053153 Bacteria 7195
326 Ga0500622_0006191 3300053156 Bacteria 7008
327 Ga0500624_000364 3300053157 Bacteria 14575
328 Ga0500627_0005202 3300053158 Bacteria 4292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0424519 Ga0496100_0424519_22_918 291
2 3300048909 Ga0496106_0333898 Ga0496106_0333898_307_1203 291
3 3300037068 Ga0373925_0509947 Ga0373925_0509947_32_976 312
4 3300005842 Ga0068858_100275349 Ga0068858_1002753492 316
5 3300005843 Ga0068860_100013012 Ga0068860_1000130124 316
6 3300028381 Ga0268264_10027110 Ga0268264_100271105 316
7 3300033180 Ga0307510_10021387 Ga0307510_100213875 321
8 3300046472 Ga0495580_0008464 Ga0495580_0008464_2552_3565 327
9 3300046506 Ga0495583_0005642 Ga0495583_0005642_7170_8183 327
10 3300046616 Ga0495668_0008617 Ga0495668_0008617_1477_2586 327
11 3300046809 Ga0495600_0129446 Ga0495600_0129446_14_1027 327
12 3300047319 Ga0495674_0043189 Ga0495674_0043189_1778_2791 327
13 3300047320 Ga0495672_0059412 Ga0495672_0059412_545_1558 327
14 3300047443 Ga0495687_036740 Ga0495687_036740_545_1558 327
15 3300047469 Ga0495673_0017130 Ga0495673_0017130_1926_2939 327
16 3300048903 Ga0496100_0000040 Ga0496100_0000040_9423_10436 327
17 3300048904 Ga0496101_0001993 Ga0496101_0001993_9334_10347 327
18 3300048905 Ga0496102_0001350 Ga0496102_0001350_20702_21715 327
19 3300048906 Ga0496103_0000387 Ga0496103_0000387_6233_7246 327
20 3300048907 Ga0496104_0023270 Ga0496104_0023270_3903_4916 327
21 3300048909 Ga0496106_0108235 Ga0496106_0108235_344_1357 327
22 3300048915 Ga0496112_0003508 Ga0496112_0003508_6256_7269 327
23 3300048918 Ga0496115_0368865 Ga0496115_0368865_95_1108 327
24 3300048919 Ga0496116_0064470 Ga0496116_0064470_642_1655 327
25 3300048920 Ga0496117_0001866 Ga0496117_0001866_24006_25019 327
26 3300048921 Ga0496118_0000206 Ga0496118_0000206_82388_83401 327
27 3300048924 Ga0496121_0022382 Ga0496121_0022382_2037_3050 327
28 3300053151 Ga0500604_0001768 Ga0500604_0001768_597_1706 327
29 3300025919 Ga0207657_10138064 Ga0207657_101380641 329
30 3300025923 Ga0207681_10136690 Ga0207681_101366902 329
31 3300053156 Ga0500622_0006191 Ga0500622_0006191_4941_5966 329
32 3300025928 Ga0207700_10060357 Ga0207700_100603573 333
33 3300031456 Ga0307513_10073373 Ga0307513_100733732 334
34 3300046460 Ga0495638_0007141 Ga0495638_0007141_3348_4409 334
35 3300005937 Ga0081455_10030375 Ga0081455_100303753 335
36 3300047470 Ga0495681_0000639 Ga0495681_0000639_16186_17199 335
37 3300049571 Ga0501034_0478563 Ga0501034_0478563_111_1133 335
38 3300003322 rootL2_10022718 rootL2_100227181 336
39 3300003784 Ga0055534_1004687 Ga0055534_10046873 336
40 3300013306 Ga0163162_10179717 Ga0163162_101797173 336
41 3300017792 Ga0163161_10004824 Ga0163161_100048243 336
42 3300025284 Ga0209130_1001805 Ga0209130_100180510 336
43 3300025291 Ga0209675_1002231 Ga0209675_10022318 336
44 3300025303 Ga0209051_1014600 Ga0209051_10146003 336
45 3300046475 Ga0495639_0001255 Ga0495639_0001255_9755_10774 336
46 3300046535 Ga0495586_0177507 Ga0495586_0177507_107_1126 336
47 3300046615 Ga0495656_0013761 Ga0495656_0013761_460_1485 336
48 3300046694 Ga0495649_0147982 Ga0495649_0147982_47_1126 336
49 3300047673 Ga0495593_0014162 Ga0495593_0014162_2377_3456 336
50 3300048903 Ga0496100_0030763 Ga0496100_0030763_1538_2557 336
51 3300048904 Ga0496101_0008563 Ga0496101_0008563_1883_2902 336
52 3300048905 Ga0496102_0006708 Ga0496102_0006708_1922_2941 336
53 3300048907 Ga0496104_0017610 Ga0496104_0017610_307_1326 336
54 3300048908 Ga0496105_0026867 Ga0496105_0026867_413_1432 336
55 3300048912 Ga0496109_0341967 Ga0496109_0341967_199_1224 336
56 3300048913 Ga0496110_0007558 Ga0496110_0007558_529_1548 336
57 3300048914 Ga0496111_0210500 Ga0496111_0210500_28_1053 336
58 3300037471 Ga0395905_0127225 Ga0395905_0127225_785_1876 338
59 3300047320 Ga0495672_0022634 Ga0495672_0022634_2637_3707 338
60 3300014968 Ga0157379_10099067 Ga0157379_100990671 339
61 3300049744 Ga0501083_0123493 Ga0501083_0123493_380_1423 339
62 iso_pu_bacteria 8048746797 8048749879 339
63 3300005468 Ga0070707_100317459 Ga0070707_1003174591 340
64 iso_pu_bacteria 2739367655 2739613714 340
65 3300005327 Ga0070658_10096908 Ga0070658_100969083 341
66 3300005458 Ga0070681_10284297 Ga0070681_102842971 341
67 3300005530 Ga0070679_100194936 Ga0070679_1001949362 341
68 3300005539 Ga0068853_100120831 Ga0068853_1001208311 341
69 3300005563 Ga0068855_100106509 Ga0068855_1001065093 341
70 3300006195 Ga0075366_10087066 Ga0075366_100870662 341
71 3300009551 Ga0105238_10220416 Ga0105238_102204161 341
72 3300013100 Ga0157373_10043019 Ga0157373_100430193 341
73 3300013104 Ga0157370_10201066 Ga0157370_102010662 341
74 3300025909 Ga0207705_10055720 Ga0207705_100557201 341
75 3300025919 Ga0207657_10002029 Ga0207657_1000202919 341
76 3300025921 Ga0207652_10032816 Ga0207652_100328164 341
77 3300031507 Ga0307509_10000002 Ga0307509_10000002177 341
78 3300048924 Ga0496121_0185386 Ga0496121_0185386_416_1447 341
79 3300050493 nmdc:mga0k408_88988_c1 nmdc:mga0k408_88988_c1_299_1333 341
80 iso_pu_bacteria 2508501123 2509115544 341
81 iso_pu_bacteria 2513237164 2514034600 341
82 iso_pu_bacteria 2617270742 2617385246 341
83 iso_pu_bacteria 2643221550 2643772211 341
84 iso_pu_bacteria 2687453392 2688597930 341
85 iso_pu_bacteria 2856320880 2856324018 341
86 iso_pu_bacteria 2856328259 2856333638 341
87 iso_pu_bacteria 2856334872 2856338030 341
88 iso_pu_bacteria 2857367948 2857374138 341
89 iso_pu_bacteria 2869271264 2869276113 341
90 iso_pu_bacteria 2869278585 2869282066 341
91 iso_pu_bacteria 2874139085 2874144835 341
92 iso_pu_bacteria 2874162495 2874165021 341
93 iso_pu_bacteria 2876399893 2876405039 341
94 iso_pu_bacteria 2876406927 2876409623 341
95 iso_pu_bacteria 2878738818 2878739763 341
96 iso_pu_bacteria 2878774303 2878777978 341
97 iso_pu_bacteria 2878781027 2878787679 341
98 iso_pu_bacteria 2906386501 2906388097 341
99 iso_pu_bacteria 2906408224 2906411170 341
100 iso_pu_bacteria 2922151315 2922156684 341
101 iso_pu_bacteria 2922172374 2922178480 341
102 iso_pu_bacteria 2922178524 2922182034 341
103 iso_pu_bacteria 2924718760 2924725948 341
104 iso_pu_bacteria 2924733363 2924733380 341
105 iso_pu_bacteria 2924748358 2924750791 341
106 iso_pu_bacteria 2924762789 2924769094 341
107 iso_pu_bacteria 2924776078 2924777381 341
108 iso_pu_bacteria 2937848649 2937848788 341
109 iso_pu_bacteria 2937877337 2937878897 341
110 iso_pu_bacteria 2937972304 2937975895 341
111 iso_pu_bacteria 2958034702 2958037861 341
112 iso_pu_bacteria 2958041894 2958048800 341
113 iso_pu_bacteria 2958064165 2958068465 341
114 iso_pu_bacteria 2958084443 2958087357 341
115 iso_pu_bacteria 2958092219 2958097837 341
116 iso_pu_bacteria 2958122699 2958128732 341
117 iso_pu_bacteria 2958137437 2958142851 341
118 iso_pu_bacteria 2958144490 2958150047 341
119 iso_pu_bacteria 2958158011 2958160813 341
120 iso_pu_bacteria 2961136820 2961137580 341
121 iso_pu_bacteria 2965025482 2965025931 341
122 iso_pu_bacteria 2965032056 2965035034 341
123 iso_pu_bacteria 2965047637 2965052950 341
124 iso_pu_bacteria 2965102966 2965105879 341
125 iso_pu_bacteria 2965110997 2965117126 341
126 iso_pu_bacteria 2968016561 2968021774 341
127 iso_pu_bacteria 2970469710 2970474364 341
128 iso_pu_bacteria 2970489779 2970492203 341
129 iso_pu_bacteria 2970547951 2970551625 341
130 iso_pu_bacteria 2970593180 2970596669 341
131 iso_pu_bacteria 2977872689 2977873237 341
132 iso_pu_bacteria 2977922695 2977928368 341
133 iso_pu_bacteria 2977935797 2977942022 341
134 iso_pu_bacteria 2977957713 2977961834 341
135 iso_pu_bacteria 2979793036 2979798864 341
136 iso_pu_bacteria 2987645492 2987647709 341
137 iso_pu_bacteria 2987666974 2987672946 341
138 iso_pu_bacteria 2987673487 2987677030 341
139 iso_pu_bacteria 2996348954 2996353774 341
140 iso_pu_bacteria 3000135777 3000136938 341
141 iso_pu_bacteria 3004211236 3004215625 341
142 iso_pu_bacteria 3004218560 3004222071 341
143 iso_pu_bacteria 3004239961 3004246642 341
144 iso_pu_bacteria 3004275668 3004280442 341
145 iso_pu_bacteria 3004289098 3004295770 341
146 iso_pu_bacteria 649633066 649872465 341
147 iso_pu_bacteria 8002392321 8002396030 341
148 iso_pu_bacteria 8004300914 8004307246 341
149 3300005437 Ga0070710_10221930 Ga0070710_102219301 342
150 3300025938 Ga0207704_10089435 Ga0207704_100894353 342
151 3300037853 Ga0436364_1306614 Ga0436364_1306614_1277_2323 342
152 3300038443 Ga0395901_0316419 Ga0395901_0316419_69_1100 342
153 3300039437 Ga0436365_0170337 Ga0436365_0170337_1819_2850 342
154 3300048927 Ga0496124_0001839 Ga0496124_0001839_13132_14178 342
155 iso_pu_bacteria 2515154114 2515645147 342
156 iso_pu_bacteria 2534681796 2535518664 342
157 iso_pu_bacteria 2554235003 2554248700 342
158 iso_pu_bacteria 2558860242 2559295788 342
159 iso_pu_bacteria 2582581866 2585397158 342
160 iso_pu_bacteria 2643221693 2644523245 342
161 iso_pu_bacteria 2724679232 2725946955 342
162 iso_pu_bacteria 2808606387 2808987478 342
163 iso_pu_bacteria 2851182111 2851185370 342
164 iso_pu_bacteria 2899845264 2899848982 342
165 iso_pu_bacteria 2926760298 2926762361 342
166 iso_pu_bacteria 2979089926 2979092369 342
167 iso_pu_bacteria 2979095461 2979100241 342
168 iso_pu_bacteria 650716007 650740999 342
169 iso_pu_bacteria 8003570095 8003575377 342
170 3300028573 Ga0265334_10005389 Ga0265334_100053894 343
171 iso_pu_bacteria 2511231008 2511279223 343
172 iso_pu_bacteria 2511231017 2511331248 343
173 iso_pu_bacteria 2513237166 2514049160 343
174 iso_pu_bacteria 2562617112 2563064961 343
175 iso_pu_bacteria 2643221736 2644742689 343
176 iso_pu_bacteria 2711768613 2713482049 343
177 iso_pu_bacteria 2841760612 2841761205 343
178 iso_pu_bacteria 2844104063 2844104230 343
179 iso_pu_bacteria 2851246043 2851247218 343
180 iso_pu_bacteria 3007619802 3007620748 343
181 3300009093 Ga0105240_10162684 Ga0105240_101626841 344
182 3300009147 Ga0114129_10493052 Ga0114129_104930522 344
183 3300039062 Ga0400483_091689 Ga0400483_091689_2783_3823 344
184 3300039062 Ga0400483_269689 Ga0400483_269689_1573_2613 344
185 3300053153 Ga0500616_0007080 Ga0500616_0007080_5952_7004 344
186 iso_pu_bacteria 2599185352 2600196312 344
187 iso_pu_bacteria 2643221618 2644110483 344
188 iso_pu_bacteria 2643221626 2644145018 344
189 iso_pu_bacteria 2643221655 2644307235 344
190 iso_pu_bacteria 2643221659 2644337119 344
191 iso_pu_bacteria 2643221712 2644613315 344
192 iso_pu_bacteria 2643221723 2644673420 344
193 iso_pu_bacteria 2821443989 2821444376 344
194 iso_pu_bacteria 2838042994 2838044503 344
195 iso_pu_bacteria 2844163670 2844168770 344
196 iso_pu_bacteria 8005246636 8005248287 344
197 3300003214 JGI25165J46597_1000254 JGI25165J46597_100025464 345
198 3300005354 Ga0070675_100027993 Ga0070675_1000279932 345
199 3300005356 Ga0070674_100014583 Ga0070674_1000145835 345
200 3300005459 Ga0068867_100255809 Ga0068867_1002558091 345
201 3300005548 Ga0070665_100024780 Ga0070665_1000247807 345
202 3300006058 Ga0075432_10002331 Ga0075432_100023312 345
203 3300009093 Ga0105240_10063142 Ga0105240_100631423 345
204 3300009093 Ga0105240_10333650 Ga0105240_103336502 345
205 3300009545 Ga0105237_10047452 Ga0105237_100474524 345
206 3300009986 Ga0105033_102149 Ga0105033_1021491 345
207 3300010375 Ga0105239_10018942 Ga0105239_100189423 345
208 3300014497 Ga0182008_10011211 Ga0182008_100112113 345
209 3300025261 Ga0209233_1000028 Ga0209233_1000028610 345
210 3300025261 Ga0209233_1007264 Ga0209233_10072641 345
211 3300025907 Ga0207645_10221156 Ga0207645_102211561 345
212 3300025926 Ga0207659_10304666 Ga0207659_103046662 345
213 3300025937 Ga0207669_10006697 Ga0207669_100066974 345
214 3300027907 Ga0207428_10099030 Ga0207428_100990302 345
215 3300028379 Ga0268266_10025224 Ga0268266_100252245 345
216 3300035695 Ga0373927_0002886 Ga0373927_0002886_10641_11702 345
217 3300037068 Ga0373925_0003076 Ga0373925_0003076_4726_5787 345
218 3300037418 Ga0395900_0007304 Ga0395900_0007304_9968_11011 345
219 3300037418 Ga0395900_0007844 Ga0395900_0007844_2194_3234 345
220 3300037418 Ga0395900_0276618 Ga0395900_0276618_558_1598 345
221 3300037466 Ga0395898_0460104 Ga0395898_0460104_86_1126 345
222 3300037471 Ga0395905_0008159 Ga0395905_0008159_5946_6986 345
223 3300037471 Ga0395905_0054340 Ga0395905_0054340_2579_3619 345
224 3300038443 Ga0395901_0014117 Ga0395901_0014117_6049_7089 345
225 3300038443 Ga0395901_0144909 Ga0395901_0144909_271_1374 345
226 3300046457 Ga0495590_0013313 Ga0495590_0013313_1338_2375 345
227 3300046459 Ga0495629_0000104 Ga0495629_0000104_6715_7752 345
228 3300046463 Ga0495653_0005171 Ga0495653_0005171_2191_3228 345
229 3300046471 Ga0495650_0008604 Ga0495650_0008604_1457_2494 345
230 3300046472 Ga0495580_0009677 Ga0495580_0009677_2261_3298 345
231 3300046472 Ga0495580_0030945 Ga0495580_0030945_418_1455 345
232 3300046474 Ga0495605_0010315 Ga0495605_0010315_2146_3183 345
233 3300046500 Ga0495596_0047102 Ga0495596_0047102_277_1314 345
234 3300046506 Ga0495583_0018856 Ga0495583_0018856_716_1753 345
235 3300046507 Ga0495606_0047573 Ga0495606_0047573_687_1724 345
236 3300046515 Ga0495620_0072777 Ga0495620_0072777_296_1336 345
237 3300046517 Ga0495630_0005234 Ga0495630_0005234_4459_5496 345
238 3300046558 Ga0495633_0049725 Ga0495633_0049725_368_1405 345
239 3300046616 Ga0495668_0042527 Ga0495668_0042527_1348_2388 345
240 3300046648 Ga0495611_0070887 Ga0495611_0070887_495_1532 345
241 3300046660 Ga0495625_0069709 Ga0495625_0069709_1390_2430 345
242 3300046680 Ga0495646_0002839 Ga0495646_0002839_8509_9546 345
243 3300046689 Ga0495613_0081429 Ga0495613_0081429_625_1662 345
244 3300046690 Ga0495624_0013125 Ga0495624_0013125_48_1085 345
245 3300046690 Ga0495624_0041078 Ga0495624_0041078_48_1085 345
246 3300046794 Ga0495589_0019150 Ga0495589_0019150_329_1366 345
247 3300047319 Ga0495674_0012079 Ga0495674_0012079_7073_8110 345
248 3300047319 Ga0495674_0072095 Ga0495674_0072095_1880_2917 345
249 3300047323 Ga0495683_0006491 Ga0495683_0006491_461_1498 345
250 3300047446 Ga0495679_000008 Ga0495679_000008_241278_242315 345
251 3300047470 Ga0495681_0004356 Ga0495681_0004356_4198_5235 345
252 3300047472 Ga0495686_0142019 Ga0495686_0142019_144_1181 345
253 3300047673 Ga0495593_0005137 Ga0495593_0005137_85_1122 345
254 3300048091 Ga0495626_0025256 Ga0495626_0025256_1452_2489 345
255 3300048905 Ga0496102_0201897 Ga0496102_0201897_279_1316 345
256 3300048915 Ga0496112_0056518 Ga0496112_0056518_2368_3408 345
257 3300048921 Ga0496118_0007662 Ga0496118_0007662_9982_11019 345
258 3300049572 Ga0501036_0263076 Ga0501036_0263076_222_1292 345
259 3300049742 Ga0501080_0083529 Ga0501080_0083529_262_1305 345
260 3300049822 Ga0501035_0094681 Ga0501035_0094681_1104_2174 345
261 3300053134 Ga0500658_0022645 Ga0500658_0022645_480_1520 345
262 3300053151 Ga0500604_0011533 Ga0500604_0011533_496_1536 345
263 3300053158 Ga0500627_0005202 Ga0500627_0005202_1727_2767 345
264 3300005340 Ga0070689_100102906 Ga0070689_1001029062 346
265 3300005356 Ga0070674_100006432 Ga0070674_1000064323 346
266 3300005364 Ga0070673_100138809 Ga0070673_1001388092 346
267 3300005365 Ga0070688_100094578 Ga0070688_1000945783 346
268 3300005459 Ga0068867_100005260 Ga0068867_1000052605 346
269 3300006058 Ga0075432_10001081 Ga0075432_100010818 346
270 3300006173 Ga0070716_100223672 Ga0070716_1002236722 346
271 3300006177 Ga0075362_10002412 Ga0075362_100024122 346
272 3300006178 Ga0075367_10074819 Ga0075367_100748191 346
273 3300006186 Ga0075369_10023075 Ga0075369_100230752 346
274 3300006237 Ga0097621_100418605 Ga0097621_1004186051 346
275 3300006881 Ga0068865_100103459 Ga0068865_1001034592 346
276 3300009036 Ga0105244_10000053 Ga0105244_1000005370 346
277 3300009148 Ga0105243_10017563 Ga0105243_100175633 346
278 3300009176 Ga0105242_10000674 Ga0105242_1000067417 346
279 3300009177 Ga0105248_10079351 Ga0105248_100793513 346
280 3300013100 Ga0157373_10002023 Ga0157373_1000202311 346
281 3300013102 Ga0157371_10000205 Ga0157371_1000020568 346
282 3300013104 Ga0157370_10000752 Ga0157370_100007525 346
283 3300013297 Ga0157378_10005470 Ga0157378_100054705 346
284 3300013306 Ga0163162_10253890 Ga0163162_102538902 346
285 3300013308 Ga0157375_10201598 Ga0157375_102015983 346
286 3300014968 Ga0157379_10102660 Ga0157379_101026601 346
287 3300025728 Ga0207655_1000049 Ga0207655_1000049220 346
288 3300025941 Ga0207711_10087189 Ga0207711_100871893 346
289 3300026075 Ga0207708_10085130 Ga0207708_100851302 346
290 3300026089 Ga0207648_10013815 Ga0207648_100138153 346
291 3300027866 Ga0209813_10006081 Ga0209813_100060812 346
292 3300027907 Ga0207428_10033711 Ga0207428_100337113 346
293 3300028379 Ga0268266_10025790 Ga0268266_100257904 346
294 3300028794 Ga0307515_10000068 Ga0307515_1000006870 346
295 3300031456 Ga0307513_10002516 Ga0307513_1000251619 346
296 3300041491 Ga0451833_0339001 Ga0451833_0339001_9027_10067 346
297 3300041492 Ga0451835_0845791 Ga0451835_0845791_849_1889 346
298 3300041496 Ga0451839_0731668 Ga0451839_0731668_7451_8491 346
299 3300041498 Ga0451841_0586496 Ga0451841_0586496_10622_11662 346
300 3300041505 Ga0451849_1159032 Ga0451849_1159032_3893_4933 346
301 3300041507 Ga0451851_1124435 Ga0451851_1124435_928_1968 346
302 3300041509 Ga0451843_0128525 Ga0451843_0128525_11320_12360 346
303 3300046463 Ga0495653_0000110 Ga0495653_0000110_62060_63124 346
304 3300046492 Ga0495585_0000283 Ga0495585_0000283_40435_41499 346
305 3300046501 Ga0495607_0001056 Ga0495607_0001056_5172_6236 346
306 3300046507 Ga0495606_0000421 Ga0495606_0000421_62422_63486 346
307 3300046512 Ga0495610_0069303 Ga0495610_0069303_183_1259 346
308 3300046515 Ga0495620_0001400 Ga0495620_0001400_13070_14152 346
309 3300046518 Ga0495631_0043517 Ga0495631_0043517_245_1309 346
310 3300046520 Ga0495637_0001742 Ga0495637_0001742_191_1273 346
311 3300046520 Ga0495637_0032671 Ga0495637_0032671_993_2057 346
312 3300046524 Ga0495648_0000186 Ga0495648_0000186_56289_57344 346
313 3300046558 Ga0495633_0013795 Ga0495633_0013795_2494_3534 346
314 3300046660 Ga0495625_0073793 Ga0495625_0073793_355_1395 346
315 3300046665 Ga0495661_0000013 Ga0495661_0000013_202255_203319 346
316 3300046694 Ga0495649_0000533 Ga0495649_0000533_11722_12786 346
317 3300047321 Ga0495676_0014494 Ga0495676_0014494_5275_6339 346
318 3300047323 Ga0495683_0000019 Ga0495683_0000019_149824_150903 346
319 3300047469 Ga0495673_0000525 Ga0495673_0000525_27261_28343 346
320 3300047470 Ga0495681_0002188 Ga0495681_0002188_5410_6486 346
321 3300048904 Ga0496101_0018207 Ga0496101_0018207_3538_4599 346
322 3300048906 Ga0496103_0132204 Ga0496103_0132204_190_1251 346
323 3300048910 Ga0496107_0021356 Ga0496107_0021356_3203_4264 346
324 3300048913 Ga0496110_0047802 Ga0496110_0047802_2534_3595 346
325 3300048917 Ga0496114_0046251 Ga0496114_0046251_1634_2695 346
326 3300048919 Ga0496116_0009905 Ga0496116_0009905_5578_6618 346
327 3300048920 Ga0496117_0000002 Ga0496117_0000002_9321_10361 346
328 3300048921 Ga0496118_0000501 Ga0496118_0000501_8963_10003 346
329 3300048923 Ga0496120_0000093 Ga0496120_0000093_136857_137897 346
330 3300048925 Ga0496122_0000004 Ga0496122_0000004_635315_636355 346
331 3300048926 Ga0496123_0000007 Ga0496123_0000007_635315_636355 346
332 3300048927 Ga0496124_0086770 Ga0496124_0086770_796_1836 346
333 3300050491 nmdc:mga00v17_1745_c1 nmdc:mga00v17_1745_c1_9008_10048 346
334 3300050492 nmdc:mga0yw44_3693_c1 nmdc:mga0yw44_3693_c1_1401_2441 346
335 3300050516 nmdc:mga0sz30_193_c1 nmdc:mga0sz30_193_c1_12610_13650 346
336 3300053107 Ga0500560_002587 Ga0500560_002587_1782_2822 346
337 3300053111 Ga0500572_007745 Ga0500572_007745_1043_2083 346
338 3300053157 Ga0500624_000364 Ga0500624_000364_597_1637 346
339 3300003316 rootH1_10170575 rootH1_101705752 347
340 3300003320 rootH2_10024275 rootH2_100242753 347
341 3300003323 rootH1_10192494 rootH1_101924944 347
342 3300003354 JGI25160J50197_1000074 JGI25160J50197_100007484 347
343 3300005262 Ga0065165_1000203 Ga0065165_100020320 347
344 3300006058 Ga0075432_10009500 Ga0075432_100095003 347
345 3300013306 Ga0163162_10002480 Ga0163162_100024804 347
346 3300025284 Ga0209130_1007780 Ga0209130_10077802 347
347 3300025295 Ga0209564_1024498 Ga0209564_10244982 347
348 3300025302 Ga0207426_1000018 Ga0207426_1000018267 347
349 3300027907 Ga0207428_10001910 Ga0207428_1000191018 347
350 3300037471 Ga0395905_0000069 Ga0395905_0000069_7296_8369 347
351 3300041411 Ga0439466_0000871 Ga0439466_0000871_5184_6257 347
352 3300042006 Ga0439432_018052 Ga0439432_018052_46_1119 347
353 3300042009 Ga0439451_006069 Ga0439451_006069_256_1329 347
354 3300046455 Ga0495603_0008450 Ga0495603_0008450_1470_2549 347
355 3300046459 Ga0495629_0000209 Ga0495629_0000209_16773_17852 347
356 3300046462 Ga0495651_0067762 Ga0495651_0067762_833_1906 347
357 3300046463 Ga0495653_0000517 Ga0495653_0000517_4307_5377 347
358 3300046463 Ga0495653_0035182 Ga0495653_0035182_2291_3439 347
359 3300046463 Ga0495653_0087386 Ga0495653_0087386_410_1489 347
360 3300046471 Ga0495650_0001343 Ga0495650_0001343_16516_17595 347
361 3300046472 Ga0495580_0007181 Ga0495580_0007181_6131_7210 347
362 3300046499 Ga0495594_0124978 Ga0495594_0124978_36_1115 347
363 3300046516 Ga0495628_0006670 Ga0495628_0006670_3416_4465 347
364 3300046516 Ga0495628_0163275 Ga0495628_0163275_132_1202 347
365 3300046517 Ga0495630_0004931 Ga0495630_0004931_7284_8354 347
366 3300046517 Ga0495630_0011729 Ga0495630_0011729_4992_6140 347
367 3300046517 Ga0495630_0034117 Ga0495630_0034117_2534_3607 347
368 3300046526 Ga0495666_0000015 Ga0495666_0000015_73435_74583 347
369 3300046526 Ga0495666_0000164 Ga0495666_0000164_21972_23042 347
370 3300046528 Ga0495642_0000413 Ga0495642_0000413_5044_6123 347
371 3300046531 Ga0495665_0011501 Ga0495665_0011501_2980_4059 347
372 3300046536 Ga0495587_0000602 Ga0495587_0000602_4232_5302 347
373 3300046536 Ga0495587_0104537 Ga0495587_0104537_250_1323 347
374 3300046543 Ga0495645_0003123 Ga0495645_0003123_6900_7979 347
375 3300046559 Ga0495667_0039675 Ga0495667_0039675_889_1968 347
376 3300046678 Ga0495599_0001241 Ga0495599_0001241_4148_5221 347
377 3300046679 Ga0495623_0000396 Ga0495623_0000396_22376_23446 347
378 3300046679 Ga0495623_0001967 Ga0495623_0001967_8881_9954 347
379 3300046679 Ga0495623_0024229 Ga0495623_0024229_1600_2673 347
380 3300046680 Ga0495646_0000341 Ga0495646_0000341_19136_20206 347
381 3300046680 Ga0495646_0086281 Ga0495646_0086281_596_1675 347
382 3300046794 Ga0495589_0004967 Ga0495589_0004967_2660_3739 347
383 3300046809 Ga0495600_0024857 Ga0495600_0024857_960_2108 347
384 3300046809 Ga0495600_0037420 Ga0495600_0037420_1609_2688 347
385 3300047315 Ga0495581_0002241 Ga0495581_0002241_2893_3972 347
386 3300047317 Ga0495604_0000098 Ga0495604_0000098_14185_15258 347
387 3300047317 Ga0495604_0000779 Ga0495604_0000779_23472_24542 347
388 3300047317 Ga0495604_0006984 Ga0495604_0006984_2186_3334 347
389 3300047319 Ga0495674_0001278 Ga0495674_0001278_13257_14327 347
390 3300047320 Ga0495672_0016031 Ga0495672_0016031_1479_2627 347
391 3300047322 Ga0495680_0003509 Ga0495680_0003509_399_1469 347
392 3300047322 Ga0495680_0153117 Ga0495680_0153117_75_1223 347
393 3300047444 Ga0495675_0002056 Ga0495675_0002056_196_1266 347
394 3300047444 Ga0495675_0032269 Ga0495675_0032269_1588_2661 347
395 3300047470 Ga0495681_0025440 Ga0495681_0025440_633_1712 347
396 3300047471 Ga0495684_0016375 Ga0495684_0016375_3826_4974 347
397 3300047472 Ga0495686_0000110 Ga0495686_0000110_116007_117056 347
398 3300047673 Ga0495593_0000396 Ga0495593_0000396_18974_20044 347
399 3300047673 Ga0495593_0000716 Ga0495593_0000716_15825_16973 347
400 3300048088 Ga0495602_0003815 Ga0495602_0003815_12851_13924 347
401 3300048089 Ga0495614_0008406 Ga0495614_0008406_3291_4370 347
402 3300048904 Ga0496101_0006830 Ga0496101_0006830_1458_2537 347
403 3300049460 Ga0495682_0000174 Ga0495682_0000174_15922_16995 347
404 3300002739 JGI25158J39367_1000490 JGI25158J39367_10004903 348
405 3300002987 JGI25159J45721_1000197 JGI25159J45721_100019721 348
406 3300003187 JGI25151J46595_10007654 JGI25151J46595_100076542 348
407 3300003354 JGI25160J50197_1001852 JGI25160J50197_10018524 348
408 3300003374 JGI25161J50226_1000897 JGI25161J50226_10008975 348
409 3300003775 Ga0055524_1003017 Ga0055524_10030175 348
410 3300003781 Ga0055536_1001205 Ga0055536_100120510 348
411 3300003794 Ga0055531_10003279 Ga0055531_100032798 348
412 3300004625 Ga0055543_1000558 Ga0055543_100055815 348
413 3300005262 Ga0065165_1003455 Ga0065165_10034554 348
414 3300013249 Ga0171463_1012 Ga0171463_1012112 348
415 3300015684 Ga0183365_10414 Ga0183365_104142 348
416 3300015690 Ga0183363_1083 Ga0183363_108314 348
417 3300025208 Ga0209436_100849 Ga0209436_10084913 348
418 3300025263 Ga0209565_1019260 Ga0209565_10192602 348
419 3300025284 Ga0209130_1000242 Ga0209130_100024217 348
420 3300025292 Ga0209676_1002608 Ga0209676_10026085 348
421 3300025294 Ga0209025_1003466 Ga0209025_10034668 348
422 3300025295 Ga0209564_1000338 Ga0209564_100033892 348
423 3300025298 Ga0209050_1005855 Ga0209050_10058552 348
424 3300025299 Ga0209256_1004020 Ga0209256_10040203 348
425 3300025299 Ga0209256_1005992 Ga0209256_10059924 348
426 3300025302 Ga0207426_1000483 Ga0207426_100048363 348
427 3300025303 Ga0209051_1015845 Ga0209051_10158452 348
428 3300025304 Ga0209257_1004449 Ga0209257_10044498 348
429 3300047319 Ga0495674_0016966 Ga0495674_0016966_4501_5577 348
430 3300048919 Ga0496116_0000309 Ga0496116_0000309_2445_3491 348
431 3300048925 Ga0496122_0000072 Ga0496122_0000072_121515_122561 348
432 3300048926 Ga0496123_0000035 Ga0496123_0000035_166367_167413 348
433 3300048927 Ga0496124_0032089 Ga0496124_0032089_1379_2425 348
434 3300048928 Ga0496125_0009321 Ga0496125_0009321_8086_9186 348
435 3300048929 Ga0496126_0000243 Ga0496126_0000243_114383_115483 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19112

VanA_C

Vanillate O-demethylase oxygenase C-terminal domain

167

361

0.95

PF00355

Rieske

Rieske [2Fe-2S] domain

31

123

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gke-assembly1.cif.gz_A crystal structure of dicamba monooxygenase 0.9183 2 339
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9166 6 111
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9131 7 111
3gke-assembly1.cif.gz_A crystal structure of dicamba monooxygenase 0.908 2 339
3gl2-assembly1.cif.gz_B crystal structure of dicamba monooxygenase bound to dicamba 0.8935 2 339
ID Description Score Start End Superfamily
3gobA01 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9619 1 123 2.102.10.10
af_Q6K689_84_212_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9364 4 125 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9132 7 111 2.102.10.10
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9057 6 108 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9043 6 108 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A7X4DG27-F1-model_v4 deleted 0.9929 1 81
AF-A0A160FI23-F1-model_v4 Rieske domain-containing protein 0.9917 5 102 GO:0004497
GO:0016705
GO:0046872
GO:0051537
AF-A0A2T6CH64-F1-model_v4 Vanillate O-demethylase monooxygenase subunit 0.9899 1 345 GO:0004497
GO:0008168
GO:0009056
GO:0016705
GO:0032259
GO:0046872
GO:0051537
AF-A0A3D3ZYH0-F1-model_v4 (2Fe-2S)-binding protein 0.9897 1 345 GO:0004497
GO:0009056
GO:0016705
GO:0046872
GO:0051537
AF-A0A537C9H5-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9872 1 118 GO:0004497
GO:0016705
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
93.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map