F443443

General Info

Members Datasets Scaffolds Average Seq Length
435 287 870 268

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2984514374|2984517662
Length 292
Sequence DIGANLTHDSFDRDRDAVLARARDAGVVQMVLTGASREHSPMALDLARQHPGFLYATAGVHPHHAVEYTDECDAEMRALHAHAEVVAVGECGLDYFRDFAPRPAQHRAFERQLQLASEVRAAAGQRKPLFLHQRDAHADFMAQMKNFDGRIGAAVVHCFTGERQELFDYLDQDWYIGITGWLCDERRGAHLRELVKHIPAERLMIETDAPYLLPRSLKPMPKDRRNEPMFLAHIVEELARGPRRGCGADRSERHRSDAHVLPPARRALTRPCRVAALVGSHPDRPPIPMGRP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
123 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
152 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
153 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
192 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
218 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
234 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
235 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
236 2643221559 Lysobacter sp. Root559 Isolate Unclassified
237 2643221573 Lysobacter sp. Root604 Isolate Unclassified
238 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
239 2643221586 Lysobacter sp. Root667 Isolate Unclassified
240 2643221593 Lysobacter sp. Root690 Isolate Unclassified
241 2643221612 Lysobacter sp. Root76 Isolate Unclassified
242 2643221695 Lysobacter sp. Root494 Isolate Unclassified
243 2643221720 Lysobacter sp. Root916 Isolate Unclassified
244 2643221727 Lysobacter sp. Root96 Isolate Unclassified
245 2643221728 Lysobacter sp. Root983 Isolate Unclassified
246 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
247 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
248 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
249 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
250 2818991457 Xanthomonas translucens 569 Isolate Unclassified
251 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
252 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
253 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
254 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
255 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
256 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
257 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
258 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
259 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
260 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
261 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
262 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
263 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
264 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
265 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
266 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
267 2919513703 Luteimonas sp. 3794 Isolate Unclassified
268 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
269 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
270 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
271 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
272 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
273 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
274 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
275 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
276 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
277 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
278 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
279 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
280 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
281 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
282 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
283 8004592986 Serratia sp. S119 Isolate Unclassified
284 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
285 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
286 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
287 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.36
Metatranscriptomes 0
Isolates 12.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 10.8
Nodule 0.23
Rhizoplane 2.07
Rhizosphere 68.74
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2618184 2162886007 Bacteria 2735
2 Ga0055526_1001691 3300003771 Bacteria 15416
3 Ga0055537_1001178 3300003773 Bacteria 11171
4 Ga0055524_1004528 3300003775 Bacteria 6401
5 Ga0055524_1018755 3300003775 Bacteria 2391
6 Ga0055536_1004855 3300003781 Bacteria 6714
7 Ga0055536_1039561 3300003781 Bacteria 1131
8 Ga0055534_1000209 3300003784 Bacteria 43174
9 Ga0055528_1000205 3300003790 Bacteria 50027
10 Ga0055530_10000466 3300003791 Bacteria 35440
11 Ga0055530_10000918 3300003791 Bacteria 24170
12 Ga0055531_10003214 3300003794 Bacteria 10489
13 Ga0058692_1000004 3300003856 Bacteria 431119
14 Ga0065704_10000910 3300005289 Bacteria 11133
15 Ga0065704_10083162 3300005289 Bacteria 3500
16 Ga0065704_10226434 3300005289 Bacteria 1057
17 Ga0065715_10105119 3300005293 Bacteria 2914
18 Ga0070676_10032125 3300005328 Bacteria 3005
19 Ga0070690_100088489 3300005330 Bacteria 2036
20 Ga0070670_100000521 3300005331 Bacteria 30818
21 Ga0070670_100226863 3300005331 Bacteria 1625
22 Ga0070666_10063885 3300005335 Unclassified 2496
23 Ga0070680_100054879 3300005336 Bacteria 3255
24 Ga0070661_100037920 3300005344 Bacteria 3507
25 Ga0070668_100126104 3300005347 Bacteria 2051
26 Ga0070671_100000643 3300005355 Bacteria 25018
27 Ga0070671_100016581 3300005355 Bacteria 5955
28 Ga0070671_100115682 3300005355 Bacteria 2255
29 Ga0070659_100319844 3300005366 Bacteria 1297
30 Ga0070700_100024036 3300005441 Bacteria 3573
31 Ga0070694_100154940 3300005444 Bacteria 1676
32 Ga0070678_100067242 3300005456 Bacteria 2666
33 Ga0070662_100207812 3300005457 Bacteria 1556
34 Ga0068853_100008620 3300005539 Bacteria 8198
35 Ga0068853_100353738 3300005539 Bacteria 1367
36 Ga0070672_100012079 3300005543 Bacteria 6044
37 Ga0070696_100444191 3300005546 Unclassified 1022
38 Ga0070665_100045918 3300005548 Bacteria 4387
39 Ga0070665_100157502 3300005548 Bacteria 2273
40 Ga0070665_100425987 3300005548 Bacteria 1336
41 Ga0070704_100004579 3300005549 Bacteria 7994
42 Ga0068855_100016857 3300005563 Bacteria 8787
43 Ga0068854_100015747 3300005578 Bacteria 5020
44 Ga0068854_100127911 3300005578 Bacteria 1937
45 Ga0068856_100005100 3300005614 Bacteria 12981
46 Ga0068856_100084078 3300005614 Bacteria 3161
47 Ga0068852_100035790 3300005616 Bacteria 4145
48 Ga0068852_100095327 3300005616 Bacteria 2672
49 Ga0068859_100033012 3300005617 Bacteria 5199
50 Ga0068859_100394569 3300005617 Bacteria 1479
51 Ga0068861_100034912 3300005719 Bacteria 3721
52 Ga0068870_10023040 3300005840 Bacteria 3066
53 Ga0068863_100155199 3300005841 Bacteria 2191
54 Ga0068858_100126514 3300005842 Bacteria 2393
55 Ga0068862_100020321 3300005844 Bacteria 5546
56 Ga0075365_10232296 3300006038 Bacteria 1295
57 Ga0075363_100088709 3300006048 Bacteria 1700
58 Ga0075364_10005832 3300006051 Bacteria 7189
59 Ga0075364_10213926 3300006051 Bacteria 1307
60 Ga0097621_100042831 3300006237 Bacteria 3647
61 Ga0068871_100055339 3300006358 Bacteria 3221
62 Ga0075428_100002661 3300006844 Bacteria 19398
63 Ga0075428_100041153 3300006844 Bacteria 5083
64 Ga0075431_100028730 3300006847 Bacteria 5718
65 Ga0075431_100112298 3300006847 Bacteria 2812
66 Ga0075431_100211370 3300006847 Bacteria 1981
67 Ga0075431_100373287 3300006847 Bacteria 1431
68 Ga0075429_100000358 3300006880 Bacteria 33554
69 Ga0097620_100033012 3300006931 Bacteria 5199
70 Ga0097620_100394560 3300006931 Bacteria 1479
71 Ga0105251_10000017 3300009011 Bacteria 145921
72 Ga0105251_10004152 3300009011 Bacteria 10085
73 Ga0105244_10012689 3300009036 Bacteria 4968
74 Ga0105240_10020191 3300009093 Bacteria 8892
75 Ga0111539_10389912 3300009094 Bacteria 1622
76 Ga0105247_10004858 3300009101 Bacteria 8550
77 Ga0114129_10067170 3300009147 Bacteria 5001
78 Ga0114129_10779943 3300009147 Bacteria 1221
79 Ga0105243_10001543 3300009148 Bacteria 20124
80 Ga0105241_10039806 3300009174 Bacteria 3546
81 Ga0105241_10217131 3300009174 Bacteria 1605
82 Ga0105242_10118820 3300009176 Bacteria 2265
83 Ga0105248_10085737 3300009177 Bacteria 3544
84 Ga0105248_10266070 3300009177 Bacteria 1930
85 Ga0105248_10779939 3300009177 Bacteria 1079
86 Ga0105237_10130902 3300009545 Bacteria 2503
87 Ga0105238_10000893 3300009551 Bacteria 30700
88 Ga0105238_10013033 3300009551 Bacteria 8390
89 Ga0105249_10055368 3300009553 Unclassified 3628
90 Ga0105249_10222890 3300009553 Bacteria 1856
91 Ga0105239_10002208 3300010375 Bacteria 24996
92 Ga0105239_10019743 3300010375 Bacteria 7438
93 Ga0105239_10035996 3300010375 Bacteria 5434
94 Ga0105239_10144256 3300010375 Bacteria 2654
95 Ga0105239_10448016 3300010375 Bacteria 1464
96 Ga0105246_10226322 3300011119 Bacteria 1470
97 Ga0105246_10253272 3300011119 Bacteria 1398
98 Ga0157373_10036271 3300013100 Bacteria 3540
99 Ga0157373_10060440 3300013100 Bacteria 2685
100 Ga0157373_10066857 3300013100 Bacteria 2542
101 Ga0157373_10067455 3300013100 Bacteria 2530
102 Ga0157371_10000158 3300013102 Bacteria 99529
103 Ga0157371_10009111 3300013102 Bacteria 7842
104 Ga0157371_10051932 3300013102 Bacteria 2912
105 Ga0157371_10232344 3300013102 Bacteria 1326
106 Ga0157370_10019904 3300013104 Bacteria 6714
107 Ga0157370_10022280 3300013104 Bacteria 6305
108 Ga0157369_10068091 3300013105 Bacteria 3825
109 Ga0157374_10005738 3300013296 Bacteria 10474
110 Ga0157374_10108010 3300013296 Bacteria 2674
111 Ga0157374_10467125 3300013296 Bacteria 1264
112 Ga0157378_10082436 3300013297 Bacteria 2908
113 Ga0157372_10011925 3300013307 Bacteria 9261
114 Ga0157372_10952928 3300013307 Bacteria 995
115 Ga0163163_10015307 3300014325 Bacteria 7088
116 Ga0182008_10000063 3300014497 Bacteria 89315
117 Ga0157376_10005297 3300014969 Bacteria 9010
118 Ga0157376_10229373 3300014969 Bacteria 1724
119 Ga0182006_1007487 3300015261 Bacteria 4994
120 Ga0163161_10019733 3300017792 Bacteria 4729
121 Ga0163161_10078221 3300017792 Bacteria 2431
122 Ga0163161_10093543 3300017792 Bacteria 2227
123 Ga0163161_10116826 3300017792 Bacteria 2000
124 Ga0209565_1000051 3300025263 Bacteria 212284
125 Ga0209673_1000581 3300025273 Bacteria 57816
126 Ga0209130_1001972 3300025284 Bacteria 11320
127 Ga0209130_1010817 3300025284 Bacteria 2485
128 Ga0209675_1000007 3300025291 Bacteria 683430
129 Ga0209676_1000018 3300025292 Bacteria 631385
130 Ga0209676_1000143 3300025292 Bacteria 175267
131 Ga0209676_1007271 3300025292 Bacteria 5249
132 Ga0209676_1007366 3300025292 Bacteria 5181
133 Ga0209676_1032083 3300025292 Bacteria 1584
134 Ga0209025_1007372 3300025294 Bacteria 8229
135 Ga0209564_1016997 3300025295 Bacteria 2862
136 Ga0209050_1000109 3300025298 Bacteria 219706
137 Ga0209050_1000448 3300025298 Bacteria 74673
138 Ga0209050_1004386 3300025298 Bacteria 9576
139 Ga0209050_1049746 3300025298 Bacteria 1071
140 Ga0209256_1004587 3300025299 Bacteria 8555
141 Ga0209256_1006264 3300025299 Bacteria 6388
142 Ga0209051_1001121 3300025303 Bacteria 24474
143 Ga0209051_1013026 3300025303 Bacteria 3980
144 Ga0209257_1000035 3300025304 Bacteria 631463
145 Ga0209257_1000291 3300025304 Bacteria 110720
146 Ga0209257_1001986 3300025304 Bacteria 22000
147 Ga0209257_1003791 3300025304 Bacteria 12453
148 Ga0207713_1000350 3300025735 Bacteria 50507
149 Ga0207713_1017020 3300025735 Bacteria 3665
150 Ga0207710_10025471 3300025900 Bacteria 2552
151 Ga0207645_10002504 3300025907 Bacteria 14412
152 Ga0207643_10016449 3300025908 Bacteria 4035
153 Ga0207671_10303982 3300025914 Bacteria 1260
154 Ga0207649_10007406 3300025920 Bacteria 5972
155 Ga0207646_10145712 3300025922 Bacteria 2134
156 Ga0207694_10021458 3300025924 Bacteria 4895
157 Ga0207650_10001772 3300025925 Bacteria 15273
158 Ga0207644_10254366 3300025931 Bacteria 1402
159 Ga0207709_10001736 3300025935 Bacteria 14677
160 Ga0207669_10091461 3300025937 Bacteria 1982
161 Ga0207711_10054252 3300025941 Bacteria 3439
162 Ga0207667_10003198 3300025949 Bacteria 20239
163 Ga0207712_10173619 3300025961 Bacteria 1687
164 Ga0207668_10035178 3300025972 Bacteria 3333
165 Ga0207658_10116342 3300025986 Bacteria 2123
166 Ga0207703_10000852 3300026035 Bacteria 29895
167 Ga0207639_10001558 3300026041 Bacteria 15368
168 Ga0207702_10003381 3300026078 Bacteria 14620
169 Ga0207702_10034544 3300026078 Bacteria 4228
170 Ga0207641_10063693 3300026088 Bacteria 3150
171 Ga0207648_10004463 3300026089 Bacteria 14353
172 Ga0207675_100001367 3300026118 Bacteria 24451
173 Ga0207675_100272432 3300026118 Bacteria 1643
174 Ga0207683_10092576 3300026121 Bacteria 2693
175 Ga0207698_10046707 3300026142 Bacteria 3273
176 Ga0209371_1000018 3300027312 Bacteria 614700
177 Ga0209969_1019162 3300027360 Bacteria 1014
178 Ga0209999_1029229 3300027543 Bacteria 1023
179 Ga0210002_1000349 3300027617 Bacteria 6303
180 Ga0209983_1007359 3300027665 Bacteria 2256
181 Ga0209971_1001920 3300027682 Bacteria 5079
182 Ga0209971_1003131 3300027682 Bacteria 3949
183 Ga0209998_10008362 3300027717 Bacteria 2144
184 Ga0209974_10001592 3300027876 Bacteria 8214
185 Ga0268265_10203592 3300028380 Bacteria 1719
186 Ga0268256_1000016 3300030500 Bacteria 614700
187 Ga0314311_1054717 3300030733 Bacteria 3231
188 Ga0307408_100315369 3300031548 Bacteria 1315
189 Ga0316575_10006497 3300031665 Bacteria 4208
190 Ga0307413_10000205 3300031824 Bacteria 17234
191 Ga0307413_10219567 3300031824 Bacteria 1387
192 Ga0307406_10139487 3300031901 Bacteria 1714
193 Ga0307412_10001110 3300031911 Bacteria 15423
194 Ga0307412_10147767 3300031911 Bacteria 1730
195 Ga0307409_100131472 3300031995 Bacteria 2140
196 Ga0307414_10000556 3300032004 Bacteria 19466
197 Ga0307414_10006401 3300032004 Bacteria 6564
198 Ga0307414_10010764 3300032004 Bacteria 5330
199 Ga0307414_10022331 3300032004 Bacteria 3989
200 Ga0307414_10040755 3300032004 Bacteria 3139
201 Ga0307414_10293598 3300032004 Bacteria 1371
202 Ga0373939_0059716 3300035114 Bacteria 1210
203 Ga0373937_0067824 3300036401 Bacteria 3288
204 Ga0395898_0048957 3300037466 Bacteria 4143
205 Ga0395905_0051934 3300037471 Bacteria 3839
206 Ga0395905_0590780 3300037471 Bacteria 1012
207 Ga0395901_0166612 3300038443 Bacteria 2313
208 Ga0237819_01754 3300038705 Bacteria 5115
209 Ga0237819_04077 3300038705 Bacteria 2465
210 Ga0439436_0006539 3300041404 Bacteria 3579
211 Ga0439436_0008728 3300041404 Bacteria 3115
212 Ga0439436_0021598 3300041404 Bacteria 1911
213 Ga0439436_0034218 3300041404 Bacteria 1469
214 Ga0439439_0000944 3300041406 Bacteria 5408
215 Ga0439465_0004426 3300041413 Bacteria 4547
216 Ga0439465_0005064 3300041413 Bacteria 4229
217 Ga0439465_0041324 3300041413 Bacteria 1492
218 Ga0451791_1621637 3300041451 Bacteria 1132
219 Ga0451793_1076600 3300041452 Bacteria 2576
220 Ga0451800_1474571 3300041459 Bacteria 2447
221 Ga0451802_0471752 3300041460 Bacteria 1157
222 Ga0451807_2030523 3300041486 Bacteria 1450
223 Ga0451837_1838787 3300041494 Bacteria 1181
224 Ga0451841_0637662 3300041498 Bacteria 1080
225 Ga0439433_0021231 3300041999 Bacteria 1452
226 Ga0439445_0010327 3300042004 Bacteria 2208
227 Ga0439432_005649 3300042006 Bacteria 4498
228 Ga0439432_026015 3300042006 Bacteria 1916
229 Ga0439449_0000128 3300042007 Bacteria 25525
230 Ga0439449_0002865 3300042007 Bacteria 6705
231 Ga0439449_0004770 3300042007 Bacteria 5234
232 Ga0439449_0058314 3300042007 Bacteria 1425
233 Ga0439449_0069690 3300042007 Bacteria 1296
234 Ga0439452_052680 3300042010 Bacteria 928
235 Ga0450911_000408 3300042115 Bacteria 14198
236 Ga0450901_002848 3300042533 Bacteria 1835
237 Ga0451577_0007606 3300042876 Bacteria 10627
238 Ga0451576_0140619 3300045051 Bacteria 2517
239 Ga0466967_0466908 3300045976 Bacteria 1235
240 Ga0495627_018906 3300046453 Bacteria 2316
241 Ga0495638_0001147 3300046460 Bacteria 25579
242 Ga0495638_0153079 3300046460 Bacteria 1336
243 Ga0495607_0106625 3300046501 Bacteria 1491
244 Ga0495610_0006633 3300046512 Bacteria 7902
245 Ga0495610_0048259 3300046512 Bacteria 2091
246 Ga0495616_0031063 3300046513 Bacteria 2801
247 Ga0495616_0071175 3300046513 Bacteria 1682
248 Ga0495631_0001424 3300046518 Bacteria 14532
249 Ga0495632_0010431 3300046519 Bacteria 5505
250 Ga0495643_0000431 3300046522 Bacteria 54537
251 Ga0495663_0001401 3300046525 Bacteria 7605
252 Ga0495663_0001814 3300046525 Bacteria 6599
253 Ga0495663_0005192 3300046525 Bacteria 3625
254 Ga0495586_0232459 3300046535 Bacteria 1049
255 Ga0495633_0000416 3300046558 Bacteria 44195
256 Ga0495634_0229840 3300046642 Bacteria 1142
257 Ga0495658_0151681 3300046683 Unclassified 1424
258 Ga0495660_0031599 3300046810 Bacteria 2976
259 Ga0495672_0000069 3300047320 Bacteria 189627
260 Ga0495672_0035178 3300047320 Bacteria 3087
261 Ga0495687_046808 3300047443 Bacteria 1865
262 Ga0495681_0039474 3300047470 Bacteria 2305
263 Ga0495686_0004593 3300047472 Bacteria 11262
264 Ga0495686_0009193 3300047472 Bacteria 7153
265 Ga0496105_0053467 3300048908 Bacteria 3335
266 Ga0496112_0094595 3300048915 Bacteria 2958
267 Ga0496113_0097149 3300048916 Bacteria 2278
268 Ga0496115_0000037 3300048918 Bacteria 126108
269 Ga0496116_0001076 3300048919 Bacteria 32848
270 Ga0496117_0000176 3300048920 Bacteria 131822
271 Ga0496117_0002092 3300048920 Bacteria 26276
272 Ga0496117_0002761 3300048920 Bacteria 21506
273 Ga0496117_0004497 3300048920 Bacteria 15331
274 Ga0496117_0004512 3300048920 Bacteria 15295
275 Ga0496118_0000108 3300048921 Bacteria 153902
276 Ga0496118_0003829 3300048921 Bacteria 18513
277 Ga0496118_0004971 3300048921 Bacteria 15379
278 Ga0496118_0007513 3300048921 Bacteria 11525
279 Ga0496118_0050809 3300048921 Bacteria 3177
280 Ga0496118_0098281 3300048921 Bacteria 1988
281 Ga0496118_0151425 3300048921 Bacteria 1451
282 Ga0496119_0008943 3300048922 Bacteria 8698
283 Ga0496119_0014100 3300048922 Bacteria 6289
284 Ga0496120_0000758 3300048923 Bacteria 46757
285 Ga0496120_0001206 3300048923 Bacteria 32741
286 Ga0496120_0002793 3300048923 Bacteria 16925
287 Ga0496121_0003767 3300048924 Bacteria 21194
288 Ga0496121_0004576 3300048924 Bacteria 18444
289 Ga0496121_0057908 3300048924 Bacteria 3208
290 Ga0496121_0311622 3300048924 Bacteria 1063
291 Ga0496122_0000081 3300048925 Bacteria 211119
292 Ga0496122_0017195 3300048925 Bacteria 6777
293 Ga0496122_0022475 3300048925 Bacteria 5604
294 Ga0496123_0001058 3300048926 Bacteria 41642
295 Ga0496123_0007499 3300048926 Bacteria 10250
296 Ga0496123_0009088 3300048926 Bacteria 8998
297 Ga0496124_0000022 3300048927 Bacteria 421020
298 Ga0496124_0000304 3300048927 Bacteria 90806
299 Ga0496124_0000486 3300048927 Bacteria 68189
300 Ga0496124_0004337 3300048927 Bacteria 16621
301 Ga0496124_0005022 3300048927 Bacteria 15128
302 Ga0496124_0018340 3300048927 Bacteria 6554
303 Ga0496124_0031528 3300048927 Bacteria 4691
304 Ga0496124_0038138 3300048927 Bacteria 4173
305 Ga0496125_0000854 3300048928 Bacteria 48916
306 Ga0496125_0017587 3300048928 Bacteria 6811
307 Ga0496125_0063442 3300048928 Bacteria 2946
308 Ga0496125_0082438 3300048928 Bacteria 2451
309 Ga0496125_0143729 3300048928 Bacteria 1653
310 Ga0496126_0000112 3300048929 Bacteria 192755
311 Ga0496126_0001975 3300048929 Bacteria 29049
312 Ga0496126_0223866 3300048929 Bacteria 1579
313 Ga0495678_076094 3300049459 Bacteria 1217
314 Ga0501290_001093 3300049513 Bacteria 3856
315 Ga0501300_001540 3300049523 Bacteria 3460
316 Ga0501031_0000495 3300049568 Bacteria 22983
317 Ga0501033_0032965 3300049570 Bacteria 3889
318 Ga0501034_0008645 3300049571 Bacteria 10740
319 Ga0501034_0026742 3300049571 Bacteria 5871
320 Ga0501036_0018411 3300049572 Bacteria 5851
321 Ga0501037_0036547 3300049573 Bacteria 3620
322 Ga0501037_0071221 3300049573 Bacteria 2529
323 Ga0501038_0003363 3300049574 Bacteria 14915
324 Ga0501038_0011515 3300049574 Bacteria 8071
325 Ga0501039_0004389 3300049575 Bacteria 10633
326 Ga0501039_0081669 3300049575 Bacteria 2516
327 Ga0501040_0001655 3300049576 Bacteria 14238
328 Ga0501040_0026776 3300049576 Bacteria 3878
329 Ga0501040_0210051 3300049576 Bacteria 1384
330 Ga0501041_0194129 3300049577 Bacteria 1272
331 Ga0501042_0001772 3300049578 Bacteria 12908
332 Ga0501042_0021120 3300049578 Bacteria 4533
333 Ga0501043_0005077 3300049579 Bacteria 10651
334 Ga0501047_0138380 3300049581 Bacteria 2314
335 Ga0501068_0003032 3300049584 Bacteria 8966
336 Ga0501071_0000474 3300049587 Bacteria 20299
337 Ga0501071_0014050 3300049587 Bacteria 5471
338 Ga0501072_0000801 3300049588 Bacteria 23154
339 Ga0501072_0004520 3300049588 Bacteria 10577
340 Ga0501074_0015457 3300049590 Bacteria 5549
341 Ga0501074_0076670 3300049590 Bacteria 2399
342 Ga0501075_0019728 3300049591 Bacteria 4894
343 Ga0501076_0002157 3300049592 Bacteria 13487
344 Ga0501076_0003370 3300049592 Bacteria 11215
345 Ga0501077_0002929 3300049593 Bacteria 10243
346 Ga0501206_038031 3300049653 Bacteria 735
347 Ga0501225_0005020 3300049705 Bacteria 3909
348 Ga0501079_0000141 3300049741 Bacteria 39561
349 Ga0501079_0088167 3300049741 Bacteria 2402
350 Ga0501080_0001589 3300049742 Bacteria 19270
351 Ga0501080_0012651 3300049742 Bacteria 7738
352 Ga0501081_0001707 3300049743 Bacteria 13637
353 Ga0501081_0008426 3300049743 Bacteria 6696
354 Ga0501265_001371 3300049762 Bacteria 2756
355 Ga0501275_000394 3300049772 Bacteria 4989
356 Ga0501035_0013629 3300049822 Bacteria 7500
357 Ga0501035_0083460 3300049822 Bacteria 2819
358 Ga0501045_0001076 3300049824 Bacteria 18044
359 Ga0501045_0003938 3300049824 Bacteria 10227
360 nmdc:mga03n38_85842_c1 3300050490 Bacteria 1488
361 nmdc:mga00v17_148_c1 3300050491 Bacteria 40605
362 nmdc:mga00v17_56981_c1 3300050491 Bacteria 2390
363 nmdc:mga00v17_8299_c1 3300050491 Bacteria 5587
364 nmdc:mga05p37_421_c1 3300050507 Bacteria 45929
365 nmdc:mga05p37_663455_c1 3300050507 Bacteria 1165
366 nmdc:mga09592_224615_c1 3300050508 Bacteria 1627
367 nmdc:mga09592_44_c1 3300050508 Bacteria 69981
368 nmdc:mga06r32_203033_c1 3300050510 Bacteria 1970
369 nmdc:mga06r32_208711_c1 3300050510 Bacteria 1941
370 nmdc:mga06r32_34824_c1 3300050510 Bacteria 4750
371 Ga0500651_0000358 3300053093 Bacteria 25307
372 Ga0500626_009348 3300053128 Bacteria 4074
373 Ga0500622_0142786 3300053156 Bacteria 1140
374 Ga0500634_0000299 3300053161 Bacteria 15725
375 Ga0501084_0001657 3300054114 Bacteria 17724
376 Ga0501084_0085720 3300054114 Bacteria 2644
377 Ga0501082_0047490 3300060353 Bacteria 3700
378 Ga0501082_0088135 3300060353 Bacteria 2678
379 Ga0501082_0124944 3300060353 Bacteria 2231
380 Ga0530510_0004190 3300061734 Bacteria 9963
381 2984517662 2984514374 Bacteria 4172479
382 2572255651 2571042365 Bacteria 3289345
383 2578456484 2576861471 Bacteria 4648976
384 2643817358 2643221559 Bacteria 4424915
385 2643879983 2643221573 Bacteria 4784121
386 2643907384 2643221579 Bacteria 4443405
387 2643938071 2643221586 Bacteria 4446529
388 2643974768 2643221593 Bacteria 6296053
389 2644078386 2643221612 Bacteria 4361984
390 2644530752 2643221695 Bacteria 3441323
391 2644662466 2643221720 Bacteria 4694283
392 2644696832 2643221727 Bacteria 4415595
393 2644701386 2643221728 Bacteria 4797149
394 2747947304 2747842428 Bacteria 4689383
395 2748018613 2747842501 Bacteria 5293829
396 2765581020 2765235840 Bacteria 4663337
397 2816517982 2816332141 Bacteria 4436036
398 2819663388 2818991457 Bacteria 5323295
399 2842394053 2842391507 Bacteria 4486072
400 2842761304 2842757796 Bacteria 3981385
401 2842784068 2842780639 Bacteria 4337790
402 2852651724 2852649853 Bacteria 4036942
403 2852689403 2852684882 Bacteria 5463342
404 2857444534 2857442823 Bacteria 4562550
405 2874223673 2874220319 Bacteria 4594709
406 2888366843 2888366609 Bacteria 5155009
407 2888375502 2888373701 Bacteria 5098052
408 2894418115 2894414249 Bacteria 4405451
409 2895503311 2895498888 Bacteria 5283788
410 2895513154 2895511927 Bacteria 6802080
411 2895523149 2895522137 Bacteria 3284416
412 2895527053 2895525241 Bacteria 3388457
413 2919089220 2919089067 Bacteria 4560942
414 2919136536 2919134579 Bacteria 4480386
415 2919513849 2919513703 Bacteria 3844312
416 2928499394 2928496128 Bacteria 4631123
417 2931382924 2931380184 Bacteria 4455911
418 2937613857 2937610967 Bacteria 4618818
419 2939590281 2939589442 Bacteria 4214238
420 2939623901 2939622612 Bacteria 4698046
421 2939628564 2939626828 Bacteria 4695272
422 2941479444 2941475908 Bacteria 4145589
423 2961050437 2961047084 Bacteria 4594415
424 2961064418 2961064222 Bacteria 4749990
425 2974307137 2974307012 Bacteria 4172388
426 2977247882 2977247770 Bacteria 4160543
427 2987606853 2987605356 Bacteria 4187822
428 2995954112 2995948881 Bacteria 6358104
429 8002870668 8002869464 Bacteria 3588529
430 8003017203 8003014200 Bacteria 4059994
431 8004593580 8004592986 Bacteria 5122074
432 8015398360 8015394850 Bacteria 5064660
433 8021626186 8021622325 Bacteria 4844743
434 8021628862 8021626552 Bacteria 4665214
435 8021651422 8021648035 Bacteria 4772378
436 SwRhRL2b_contig_2618184
437 Ga0055526_1001691
438 Ga0055537_1001178
439 Ga0055524_1004528
440 Ga0055524_1018755
441 Ga0055536_1004855
442 Ga0055536_1039561
443 Ga0055534_1000209
444 Ga0055528_1000205
445 Ga0055530_10000466
446 Ga0055530_10000918
447 Ga0055531_10003214
448 Ga0058692_1000004
449 Ga0065704_10000910
450 Ga0065704_10083162
451 Ga0065704_10226434
452 Ga0065715_10105119
453 Ga0070676_10032125
454 Ga0070690_100088489
455 Ga0070670_100000521
456 Ga0070670_100226863
457 Ga0070666_10063885
458 Ga0070680_100054879
459 Ga0070661_100037920
460 Ga0070668_100126104
461 Ga0070671_100000643
462 Ga0070671_100016581
463 Ga0070671_100115682
464 Ga0070659_100319844
465 Ga0070700_100024036
466 Ga0070694_100154940
467 Ga0070678_100067242
468 Ga0070662_100207812
469 Ga0068853_100008620
470 Ga0068853_100353738
471 Ga0070672_100012079
472 Ga0070696_100444191
473 Ga0070665_100045918
474 Ga0070665_100157502
475 Ga0070665_100425987
476 Ga0070704_100004579
477 Ga0068855_100016857
478 Ga0068854_100015747
479 Ga0068854_100127911
480 Ga0068856_100005100
481 Ga0068856_100084078
482 Ga0068852_100035790
483 Ga0068852_100095327
484 Ga0068859_100033012
485 Ga0068859_100394569
486 Ga0068861_100034912
487 Ga0068870_10023040
488 Ga0068863_100155199
489 Ga0068858_100126514
490 Ga0068862_100020321
491 Ga0075365_10232296
492 Ga0075363_100088709
493 Ga0075364_10005832
494 Ga0075364_10213926
495 Ga0097621_100042831
496 Ga0068871_100055339
497 Ga0075428_100002661
498 Ga0075428_100041153
499 Ga0075431_100028730
500 Ga0075431_100112298
501 Ga0075431_100211370
502 Ga0075431_100373287
503 Ga0075429_100000358
504 Ga0097620_100033012
505 Ga0097620_100394560
506 Ga0105251_10000017
507 Ga0105251_10004152
508 Ga0105244_10012689
509 Ga0105240_10020191
510 Ga0111539_10389912
511 Ga0105247_10004858
512 Ga0114129_10067170
513 Ga0114129_10779943
514 Ga0105243_10001543
515 Ga0105241_10039806
516 Ga0105241_10217131
517 Ga0105242_10118820
518 Ga0105248_10085737
519 Ga0105248_10266070
520 Ga0105248_10779939
521 Ga0105237_10130902
522 Ga0105238_10000893
523 Ga0105238_10013033
524 Ga0105249_10055368
525 Ga0105249_10222890
526 Ga0105239_10002208
527 Ga0105239_10019743
528 Ga0105239_10035996
529 Ga0105239_10144256
530 Ga0105239_10448016
531 Ga0105246_10226322
532 Ga0105246_10253272
533 Ga0157373_10036271
534 Ga0157373_10060440
535 Ga0157373_10066857
536 Ga0157373_10067455
537 Ga0157371_10000158
538 Ga0157371_10009111
539 Ga0157371_10051932
540 Ga0157371_10232344
541 Ga0157370_10019904
542 Ga0157370_10022280
543 Ga0157369_10068091
544 Ga0157374_10005738
545 Ga0157374_10108010
546 Ga0157374_10467125
547 Ga0157378_10082436
548 Ga0157372_10011925
549 Ga0157372_10952928
550 Ga0163163_10015307
551 Ga0182008_10000063
552 Ga0157376_10005297
553 Ga0157376_10229373
554 Ga0182006_1007487
555 Ga0163161_10019733
556 Ga0163161_10078221
557 Ga0163161_10093543
558 Ga0163161_10116826
559 Ga0209565_1000051
560 Ga0209673_1000581
561 Ga0209130_1001972
562 Ga0209130_1010817
563 Ga0209675_1000007
564 Ga0209676_1000018
565 Ga0209676_1000143
566 Ga0209676_1007271
567 Ga0209676_1007366
568 Ga0209676_1032083
569 Ga0209025_1007372
570 Ga0209564_1016997
571 Ga0209050_1000109
572 Ga0209050_1000448
573 Ga0209050_1004386
574 Ga0209050_1049746
575 Ga0209256_1004587
576 Ga0209256_1006264
577 Ga0209051_1001121
578 Ga0209051_1013026
579 Ga0209257_1000035
580 Ga0209257_1000291
581 Ga0209257_1001986
582 Ga0209257_1003791
583 Ga0207713_1000350
584 Ga0207713_1017020
585 Ga0207710_10025471
586 Ga0207645_10002504
587 Ga0207643_10016449
588 Ga0207671_10303982
589 Ga0207649_10007406
590 Ga0207646_10145712
591 Ga0207694_10021458
592 Ga0207650_10001772
593 Ga0207644_10254366
594 Ga0207709_10001736
595 Ga0207669_10091461
596 Ga0207711_10054252
597 Ga0207667_10003198
598 Ga0207712_10173619
599 Ga0207668_10035178
600 Ga0207658_10116342
601 Ga0207703_10000852
602 Ga0207639_10001558
603 Ga0207702_10003381
604 Ga0207702_10034544
605 Ga0207641_10063693
606 Ga0207648_10004463
607 Ga0207675_100001367
608 Ga0207675_100272432
609 Ga0207683_10092576
610 Ga0207698_10046707
611 Ga0209371_1000018
612 Ga0209969_1019162
613 Ga0209999_1029229
614 Ga0210002_1000349
615 Ga0209983_1007359
616 Ga0209971_1001920
617 Ga0209971_1003131
618 Ga0209998_10008362
619 Ga0209974_10001592
620 Ga0268265_10203592
621 Ga0268256_1000016
622 Ga0314311_1054717
623 Ga0307408_100315369
624 Ga0316575_10006497
625 Ga0307413_10000205
626 Ga0307413_10219567
627 Ga0307406_10139487
628 Ga0307412_10001110
629 Ga0307412_10147767
630 Ga0307409_100131472
631 Ga0307414_10000556
632 Ga0307414_10006401
633 Ga0307414_10010764
634 Ga0307414_10022331
635 Ga0307414_10040755
636 Ga0307414_10293598
637 Ga0373939_0059716
638 Ga0373937_0067824
639 Ga0395898_0048957
640 Ga0395905_0051934
641 Ga0395905_0590780
642 Ga0395901_0166612
643 Ga0237819_01754
644 Ga0237819_04077
645 Ga0439436_0006539
646 Ga0439436_0008728
647 Ga0439436_0021598
648 Ga0439436_0034218
649 Ga0439439_0000944
650 Ga0439465_0004426
651 Ga0439465_0005064
652 Ga0439465_0041324
653 Ga0451791_1621637
654 Ga0451793_1076600
655 Ga0451800_1474571
656 Ga0451802_0471752
657 Ga0451807_2030523
658 Ga0451837_1838787
659 Ga0451841_0637662
660 Ga0439433_0021231
661 Ga0439445_0010327
662 Ga0439432_005649
663 Ga0439432_026015
664 Ga0439449_0000128
665 Ga0439449_0002865
666 Ga0439449_0004770
667 Ga0439449_0058314
668 Ga0439449_0069690
669 Ga0439452_052680
670 Ga0450911_000408
671 Ga0450901_002848
672 Ga0451577_0007606
673 Ga0451576_0140619
674 Ga0466967_0466908
675 Ga0495627_018906
676 Ga0495638_0001147
677 Ga0495638_0153079
678 Ga0495607_0106625
679 Ga0495610_0006633
680 Ga0495610_0048259
681 Ga0495616_0031063
682 Ga0495616_0071175
683 Ga0495631_0001424
684 Ga0495632_0010431
685 Ga0495643_0000431
686 Ga0495663_0001401
687 Ga0495663_0001814
688 Ga0495663_0005192
689 Ga0495586_0232459
690 Ga0495633_0000416
691 Ga0495634_0229840
692 Ga0495658_0151681
693 Ga0495660_0031599
694 Ga0495672_0000069
695 Ga0495672_0035178
696 Ga0495687_046808
697 Ga0495681_0039474
698 Ga0495686_0004593
699 Ga0495686_0009193
700 Ga0496105_0053467
701 Ga0496112_0094595
702 Ga0496113_0097149
703 Ga0496115_0000037
704 Ga0496116_0001076
705 Ga0496117_0000176
706 Ga0496117_0002092
707 Ga0496117_0002761
708 Ga0496117_0004497
709 Ga0496117_0004512
710 Ga0496118_0000108
711 Ga0496118_0003829
712 Ga0496118_0004971
713 Ga0496118_0007513
714 Ga0496118_0050809
715 Ga0496118_0098281
716 Ga0496118_0151425
717 Ga0496119_0008943
718 Ga0496119_0014100
719 Ga0496120_0000758
720 Ga0496120_0001206
721 Ga0496120_0002793
722 Ga0496121_0003767
723 Ga0496121_0004576
724 Ga0496121_0057908
725 Ga0496121_0311622
726 Ga0496122_0000081
727 Ga0496122_0017195
728 Ga0496122_0022475
729 Ga0496123_0001058
730 Ga0496123_0007499
731 Ga0496123_0009088
732 Ga0496124_0000022
733 Ga0496124_0000304
734 Ga0496124_0000486
735 Ga0496124_0004337
736 Ga0496124_0005022
737 Ga0496124_0018340
738 Ga0496124_0031528
739 Ga0496124_0038138
740 Ga0496125_0000854
741 Ga0496125_0017587
742 Ga0496125_0063442
743 Ga0496125_0082438
744 Ga0496125_0143729
745 Ga0496126_0000112
746 Ga0496126_0001975
747 Ga0496126_0223866
748 Ga0495678_076094
749 Ga0501290_001093
750 Ga0501300_001540
751 Ga0501031_0000495
752 Ga0501033_0032965
753 Ga0501034_0008645
754 Ga0501034_0026742
755 Ga0501036_0018411
756 Ga0501037_0036547
757 Ga0501037_0071221
758 Ga0501038_0003363
759 Ga0501038_0011515
760 Ga0501039_0004389
761 Ga0501039_0081669
762 Ga0501040_0001655
763 Ga0501040_0026776
764 Ga0501040_0210051
765 Ga0501041_0194129
766 Ga0501042_0001772
767 Ga0501042_0021120
768 Ga0501043_0005077
769 Ga0501047_0138380
770 Ga0501068_0003032
771 Ga0501071_0000474
772 Ga0501071_0014050
773 Ga0501072_0000801
774 Ga0501072_0004520
775 Ga0501074_0015457
776 Ga0501074_0076670
777 Ga0501075_0019728
778 Ga0501076_0002157
779 Ga0501076_0003370
780 Ga0501077_0002929
781 Ga0501206_038031
782 Ga0501225_0005020
783 Ga0501079_0000141
784 Ga0501079_0088167
785 Ga0501080_0001589
786 Ga0501080_0012651
787 Ga0501081_0001707
788 Ga0501081_0008426
789 Ga0501265_001371
790 Ga0501275_000394
791 Ga0501035_0013629
792 Ga0501035_0083460
793 Ga0501045_0001076
794 Ga0501045_0003938
795 nmdc:mga03n38_85842_c1
796 nmdc:mga00v17_148_c1
797 nmdc:mga00v17_56981_c1
798 nmdc:mga00v17_8299_c1
799 nmdc:mga05p37_421_c1
800 nmdc:mga05p37_663455_c1
801 nmdc:mga09592_224615_c1
802 nmdc:mga09592_44_c1
803 nmdc:mga06r32_203033_c1
804 nmdc:mga06r32_208711_c1
805 nmdc:mga06r32_34824_c1
806 Ga0500651_0000358
807 Ga0500626_009348
808 Ga0500622_0142786
809 Ga0500634_0000299
810 Ga0501084_0001657
811 Ga0501084_0085720
812 Ga0501082_0047490
813 Ga0501082_0088135
814 Ga0501082_0124944
815 Ga0530510_0004190
816 2984517662
817 2572255651
818 2578456484
819 2643817358
820 2643879983
821 2643907384
822 2643938071
823 2643974768
824 2644078386
825 2644530752
826 2644662466
827 2644696832
828 2644701386
829 2747947304
830 2748018613
831 2765581020
832 2816517982
833 2819663388
834 2842394053
835 2842761304
836 2842784068
837 2852651724
838 2852689403
839 2857444534
840 2874223673
841 2888366843
842 2888375502
843 2894418115
844 2895503311
845 2895513154
846 2895523149
847 2895527053
848 2919089220
849 2919136536
850 2919513849
851 2928499394
852 2931382924
853 2937613857
854 2939590281
855 2939623901
856 2939628564
857 2941479444
858 2961050437
859 2961064418
860 2974307137
861 2977247882
862 2987606853
863 2995954112
864 8002870668
865 8003017203
866 8004593580
867 8015398360
868 8021626186
869 8021628862
870 8021651422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

1

248

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9855 1 263
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9745 1 263
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9717 3 262
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9644 3 262
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9501 2 259
ID Description Score Start End Superfamily
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9779 2 263 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9717 3 262 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9644 3 262 3.20.20.140
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9633 2 263 3.20.20.140
af_G5EG18_4_286_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9523 1 262 3.20.20.140
ID Description Score Start End GO Terms
AF-V7ZIP7-F1-model_v4 deleted 1 1 265
AF-A0A5C5U9F9-F1-model_v4 Hydrolase TatD 0.9999 1 262 GO:0004518
GO:0046872
AF-Q5GUL6-F1-model_v4 Type V secretory pathway protein 0.9995 1 265 GO:0004518
AF-A0A8B4XAG0-F1-model_v4 deleted 0.9994 1 265
AF-A0A108UAD0-F1-model_v4 Deoxyribonuclease TatD 0.9988 1 262 GO:0004518
GO:0046872

Map