F443447
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 261 | 870 | 479 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8054920844|8054927439 |
| Length | 537 |
| Sequence | ARGRVVAAVDQGTTGTTVCLLDRDGRIAGRGYTEIHPRFPRPGWVEQDPEELWRSVVDTVAAALADADLRPTDLAALGITNQRETTVVWERSSSTPVSPAIVWQDRRTAAHCERLTAGGHAAAVGDRTGLVLDPYFSATKIGWILDRDPALRRRAGRGEIAFGTVDSWLVWKLTGGAVHVTDVTNASRTLLLDLATAAWAPDMLDLFGVPAEVLPEVVPSSRVYAETDPAAFLGVRIPVAAAVGDQQAALFAQGCVEPGQAKNTYGTGSFVLVNTGPTVPPPQSSLLRTVAYQLDGEPVHYALEGAILSTGAAVGWLRDSLGIIRDAAETAQLAASLPGNDGVYFVPALTGLGAPHWDPRARGTLLGITRGTGRAHLARAVLEGIAYRTRDVVEAMAGAGFAVRELRADGGAARNPWLMQFQADILGVGVDVPDNIETTALGSAYLAGLAIGFFTDPTALAAHRRSERRYHPAMPPAQRDRAYRRWLSAVDRARAWADDTDDSNTDGSNTDDRGIEIDADRTGTGTGTGTGTGEGTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 121 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 134 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 178 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 181 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 182 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 183 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 186 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 191 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 192 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 218 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 229 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 233 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 234 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 236 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 239 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 240 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 241 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 242 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 243 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 244 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 245 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 246 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 247 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 248 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 249 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 250 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 251 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 252 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 253 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 254 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 255 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 256 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 257 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 258 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 259 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 260 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 261 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.71 |
| Metatranscriptomes | 0 |
| Isolates | 5.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.22 |
| Nodule | 4.37 |
| Rhizoplane | 10.34 |
| Rhizosphere | 79.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000556 | 3300001977 | Bacteria | 5618 |
| 2 | JGI24740J21852_10014564 | 3300001979 | Bacteria | 2895 |
| 3 | JGI25406J46586_10010959 | 3300003203 | Bacteria | 3990 |
| 4 | JGI25407J50210_10002544 | 3300003373 | Bacteria | 4309 |
| 5 | Ga0070683_100019100 | 3300005329 | Bacteria | 6081 |
| 6 | Ga0070677_10000020 | 3300005333 | Bacteria | 48941 |
| 7 | Ga0070682_100000032 | 3300005337 | Bacteria | 155141 |
| 8 | Ga0070682_100160987 | 3300005337 | Bacteria | 1550 |
| 9 | Ga0070660_100055891 | 3300005339 | Bacteria | 3052 |
| 10 | Ga0070691_10000348 | 3300005341 | Bacteria | 16483 |
| 11 | Ga0070661_100000032 | 3300005344 | Bacteria | 112964 |
| 12 | Ga0070668_100025930 | 3300005347 | Bacteria | 4445 |
| 13 | Ga0070668_100026572 | 3300005347 | Bacteria | 4394 |
| 14 | Ga0070675_100000022 | 3300005354 | Bacteria | 146580 |
| 15 | Ga0070674_100000021 | 3300005356 | Bacteria | 87134 |
| 16 | Ga0070674_100102782 | 3300005356 | Bacteria | 2085 |
| 17 | Ga0070673_100008528 | 3300005364 | Bacteria | 6819 |
| 18 | Ga0070688_100000031 | 3300005365 | Bacteria | 65288 |
| 19 | Ga0070688_100000194 | 3300005365 | Bacteria | 32209 |
| 20 | Ga0070659_100002039 | 3300005366 | Bacteria | 14442 |
| 21 | Ga0070713_100000516 | 3300005436 | Bacteria | 24506 |
| 22 | Ga0070700_100048295 | 3300005441 | Bacteria | 2638 |
| 23 | Ga0070681_10010128 | 3300005458 | Bacteria | 9293 |
| 24 | Ga0070681_10263680 | 3300005458 | Bacteria | 1635 |
| 25 | Ga0068867_100024210 | 3300005459 | Bacteria | 4350 |
| 26 | Ga0070685_10000058 | 3300005466 | Bacteria | 64666 |
| 27 | Ga0070685_10000263 | 3300005466 | Bacteria | 33715 |
| 28 | Ga0070706_100016202 | 3300005467 | Bacteria | 6885 |
| 29 | Ga0070679_100006708 | 3300005530 | Bacteria | 10737 |
| 30 | Ga0070672_100000258 | 3300005543 | Bacteria | 30020 |
| 31 | Ga0070665_100001623 | 3300005548 | Bacteria | 25894 |
| 32 | Ga0070664_100049242 | 3300005564 | Bacteria | 3563 |
| 33 | Ga0070664_100141804 | 3300005564 | Bacteria | 2116 |
| 34 | Ga0068854_100000133 | 3300005578 | Bacteria | 51376 |
| 35 | Ga0068856_100000369 | 3300005614 | Bacteria | 49419 |
| 36 | Ga0068852_100000024 | 3300005616 | Bacteria | 120479 |
| 37 | Ga0068859_100000119 | 3300005617 | Bacteria | 74778 |
| 38 | Ga0068859_100036988 | 3300005617 | Bacteria | 4900 |
| 39 | Ga0068866_10000007 | 3300005718 | Bacteria | 121729 |
| 40 | Ga0068851_10004054 | 3300005834 | Bacteria | 6576 |
| 41 | Ga0068863_100006314 | 3300005841 | Bacteria | 11634 |
| 42 | Ga0068863_100018006 | 3300005841 | Bacteria | 6762 |
| 43 | Ga0068858_100182826 | 3300005842 | Bacteria | 1980 |
| 44 | Ga0068860_100011273 | 3300005843 | Bacteria | 8809 |
| 45 | Ga0068862_100000166 | 3300005844 | Bacteria | 72987 |
| 46 | Ga0068862_100004171 | 3300005844 | Bacteria | 12237 |
| 47 | Ga0081455_10002113 | 3300005937 | Bacteria | 23655 |
| 48 | Ga0081455_10005786 | 3300005937 | Bacteria | 13472 |
| 49 | Ga0081455_10040573 | 3300005937 | Bacteria | 4102 |
| 50 | Ga0081455_10052451 | 3300005937 | Bacteria | 3491 |
| 51 | Ga0081538_10001329 | 3300005981 | Bacteria | 25435 |
| 52 | Ga0081538_10001392 | 3300005981 | Bacteria | 24810 |
| 53 | Ga0081538_10015234 | 3300005981 | Bacteria | 5964 |
| 54 | Ga0081538_10037759 | 3300005981 | Bacteria | 3126 |
| 55 | Ga0081540_1001588 | 3300005983 | Bacteria | 19426 |
| 56 | Ga0081540_1003348 | 3300005983 | Bacteria | 12707 |
| 57 | Ga0081539_10002064 | 3300005985 | Bacteria | 30098 |
| 58 | Ga0075365_10000999 | 3300006038 | Bacteria | 12085 |
| 59 | Ga0075365_10009534 | 3300006038 | Bacteria | 5590 |
| 60 | Ga0075365_10009888 | 3300006038 | Bacteria | 5521 |
| 61 | Ga0075364_10067023 | 3300006051 | Bacteria | 2359 |
| 62 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 63 | Ga0075428_100015593 | 3300006844 | Bacteria | 8425 |
| 64 | Ga0075428_100053324 | 3300006844 | Bacteria | 4430 |
| 65 | Ga0075428_100098489 | 3300006844 | Bacteria | 3188 |
| 66 | Ga0075428_100105624 | 3300006844 | Bacteria | 3071 |
| 67 | Ga0075430_100003154 | 3300006846 | Bacteria | 13797 |
| 68 | Ga0075430_100011191 | 3300006846 | Bacteria | 7607 |
| 69 | Ga0075430_100016090 | 3300006846 | Bacteria | 6368 |
| 70 | Ga0075430_100101058 | 3300006846 | Bacteria | 2408 |
| 71 | Ga0075430_100169455 | 3300006846 | Bacteria | 1816 |
| 72 | Ga0075431_100004797 | 3300006847 | Bacteria | 13306 |
| 73 | Ga0075431_100022636 | 3300006847 | Bacteria | 6424 |
| 74 | Ga0075431_100028280 | 3300006847 | Bacteria | 5758 |
| 75 | Ga0075431_100047559 | 3300006847 | Bacteria | 4423 |
| 76 | Ga0075431_100132489 | 3300006847 | Bacteria | 2570 |
| 77 | Ga0075433_10000383 | 3300006852 | Bacteria | 28020 |
| 78 | Ga0075433_10002915 | 3300006852 | Bacteria | 13125 |
| 79 | Ga0075434_100004945 | 3300006871 | Bacteria | 12085 |
| 80 | Ga0075429_100002028 | 3300006880 | Bacteria | 16853 |
| 81 | Ga0075429_100023710 | 3300006880 | Bacteria | 5325 |
| 82 | Ga0075429_100025056 | 3300006880 | Bacteria | 5178 |
| 83 | Ga0075429_100025254 | 3300006880 | Bacteria | 5157 |
| 84 | Ga0068865_100000024 | 3300006881 | Bacteria | 94969 |
| 85 | Ga0068865_100064135 | 3300006881 | Bacteria | 2585 |
| 86 | Ga0097620_100000119 | 3300006931 | Bacteria | 74778 |
| 87 | Ga0097620_100036988 | 3300006931 | Bacteria | 4900 |
| 88 | Ga0075435_100024838 | 3300007076 | Bacteria | 4657 |
| 89 | Ga0111539_10001058 | 3300009094 | Bacteria | 36236 |
| 90 | Ga0111539_10050315 | 3300009094 | Bacteria | 4963 |
| 91 | Ga0111539_10066145 | 3300009094 | Bacteria | 4269 |
| 92 | Ga0105245_10000022 | 3300009098 | Bacteria | 181225 |
| 93 | Ga0105245_10001178 | 3300009098 | Bacteria | 23683 |
| 94 | Ga0105245_10007818 | 3300009098 | Bacteria | 9365 |
| 95 | Ga0105245_10008000 | 3300009098 | Bacteria | 9247 |
| 96 | Ga0105245_10010101 | 3300009098 | Bacteria | 8223 |
| 97 | Ga0105245_10245338 | 3300009098 | Bacteria | 1738 |
| 98 | Ga0105247_10000049 | 3300009101 | Bacteria | 150328 |
| 99 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 100 | Ga0114129_10004594 | 3300009147 | Bacteria | 19486 |
| 101 | Ga0114129_10007585 | 3300009147 | Bacteria | 15448 |
| 102 | Ga0114129_10102241 | 3300009147 | Bacteria | 3963 |
| 103 | Ga0114129_10121454 | 3300009147 | Bacteria | 3595 |
| 104 | Ga0114129_10312763 | 3300009147 | Bacteria | 2090 |
| 105 | Ga0105243_10012040 | 3300009148 | Bacteria | 6541 |
| 106 | Ga0105242_10000123 | 3300009176 | Bacteria | 56900 |
| 107 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 108 | Ga0105248_10000473 | 3300009177 | Bacteria | 45835 |
| 109 | Ga0105249_10000181 | 3300009553 | Bacteria | 73946 |
| 110 | Ga0105239_10242209 | 3300010375 | Bacteria | 2024 |
| 111 | Ga0157371_10001783 | 3300013102 | Bacteria | 21764 |
| 112 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 113 | Ga0157378_10002103 | 3300013297 | Bacteria | 17744 |
| 114 | Ga0157372_10001135 | 3300013307 | Bacteria | 28936 |
| 115 | Ga0157375_10175485 | 3300013308 | Bacteria | 2292 |
| 116 | Ga0163163_10003549 | 3300014325 | Bacteria | 13246 |
| 117 | Ga0157380_10000328 | 3300014326 | Bacteria | 28745 |
| 118 | Ga0157380_10000403 | 3300014326 | Bacteria | 26163 |
| 119 | Ga0157379_10031333 | 3300014968 | Bacteria | 4736 |
| 120 | Ga0157379_10220486 | 3300014968 | Bacteria | 1718 |
| 121 | Ga0157376_10018824 | 3300014969 | Bacteria | 5307 |
| 122 | Ga0163161_10063434 | 3300017792 | Bacteria | 2693 |
| 123 | Ga0163161_10088768 | 3300017792 | Bacteria | 2285 |
| 124 | Ga0213876_10044336 | 3300021384 | Bacteria | 2351 |
| 125 | Ga0207656_10000274 | 3300025321 | Bacteria | 17852 |
| 126 | Ga0207682_10000050 | 3300025893 | Bacteria | 49908 |
| 127 | Ga0207642_10000008 | 3300025899 | Bacteria | 132651 |
| 128 | Ga0207710_10000073 | 3300025900 | Bacteria | 150308 |
| 129 | Ga0207710_10000165 | 3300025900 | Bacteria | 69714 |
| 130 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 131 | Ga0207707_10036138 | 3300025912 | Bacteria | 4320 |
| 132 | Ga0207693_10007617 | 3300025915 | Bacteria | 8892 |
| 133 | Ga0207657_10150478 | 3300025919 | Bacteria | 1896 |
| 134 | Ga0207649_10000166 | 3300025920 | Bacteria | 53758 |
| 135 | Ga0207652_10001510 | 3300025921 | Bacteria | 20534 |
| 136 | Ga0207659_10000030 | 3300025926 | Bacteria | 124433 |
| 137 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 138 | Ga0207687_10000039 | 3300025927 | Bacteria | 114303 |
| 139 | Ga0207687_10006005 | 3300025927 | Bacteria | 8035 |
| 140 | Ga0207687_10033400 | 3300025927 | Bacteria | 3490 |
| 141 | Ga0207687_10084469 | 3300025927 | Bacteria | 2301 |
| 142 | Ga0207700_10000019 | 3300025928 | Bacteria | 183117 |
| 143 | Ga0207690_10008591 | 3300025932 | Bacteria | 6059 |
| 144 | Ga0207690_10015961 | 3300025932 | Bacteria | 4562 |
| 145 | Ga0207706_10002691 | 3300025933 | Bacteria | 17323 |
| 146 | Ga0207686_10000066 | 3300025934 | Bacteria | 95095 |
| 147 | Ga0207709_10014890 | 3300025935 | Bacteria | 4302 |
| 148 | Ga0207669_10000032 | 3300025937 | Bacteria | 82757 |
| 149 | Ga0207704_10000054 | 3300025938 | Bacteria | 79155 |
| 150 | Ga0207691_10000871 | 3300025940 | Bacteria | 30024 |
| 151 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 152 | Ga0207711_10000400 | 3300025941 | Bacteria | 45796 |
| 153 | Ga0207661_10002638 | 3300025944 | Bacteria | 12343 |
| 154 | Ga0207661_10004497 | 3300025944 | Bacteria | 9777 |
| 155 | Ga0207661_10102929 | 3300025944 | Bacteria | 2402 |
| 156 | Ga0207679_10038529 | 3300025945 | Bacteria | 3406 |
| 157 | Ga0207667_10146153 | 3300025949 | Bacteria | 2434 |
| 158 | Ga0207651_10000951 | 3300025960 | Bacteria | 12786 |
| 159 | Ga0207712_10000067 | 3300025961 | Bacteria | 130079 |
| 160 | Ga0207712_10018581 | 3300025961 | Bacteria | 4530 |
| 161 | Ga0207668_10064882 | 3300025972 | Bacteria | 2583 |
| 162 | Ga0207640_10000147 | 3300025981 | Bacteria | 51462 |
| 163 | Ga0207639_10123935 | 3300026041 | Bacteria | 2128 |
| 164 | Ga0207678_10003461 | 3300026067 | Bacteria | 14214 |
| 165 | Ga0207708_10015019 | 3300026075 | Bacteria | 5803 |
| 166 | Ga0207708_10035831 | 3300026075 | Bacteria | 3775 |
| 167 | Ga0207708_10055477 | 3300026075 | Bacteria | 3021 |
| 168 | Ga0207702_10000557 | 3300026078 | Bacteria | 41471 |
| 169 | Ga0207641_10011786 | 3300026088 | Bacteria | 7178 |
| 170 | Ga0207641_10019506 | 3300026088 | Bacteria | 5566 |
| 171 | Ga0207648_10072488 | 3300026089 | Bacteria | 3001 |
| 172 | Ga0207648_10115227 | 3300026089 | Bacteria | 2362 |
| 173 | Ga0207674_10007759 | 3300026116 | Bacteria | 12487 |
| 174 | Ga0207675_100006375 | 3300026118 | Bacteria | 11187 |
| 175 | Ga0207675_100045353 | 3300026118 | Bacteria | 4107 |
| 176 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 177 | Ga0207428_10075315 | 3300027907 | Bacteria | 2645 |
| 178 | Ga0268266_10004229 | 3300028379 | Bacteria | 13823 |
| 179 | Ga0268266_10026023 | 3300028379 | Bacteria | 4977 |
| 180 | Ga0268266_10035520 | 3300028379 | Bacteria | 4240 |
| 181 | Ga0268265_10000069 | 3300028380 | Bacteria | 141036 |
| 182 | Ga0268265_10005246 | 3300028380 | Bacteria | 8866 |
| 183 | Ga0268264_10007756 | 3300028381 | Bacteria | 8936 |
| 184 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 185 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 186 | Ga0265338_10045946 | 3300028800 | Bacteria | 4009 |
| 187 | Ga0265325_10044261 | 3300031241 | Bacteria | 2319 |
| 188 | Ga0265331_10022620 | 3300031250 | Bacteria | 3206 |
| 189 | Ga0265327_10003360 | 3300031251 | Bacteria | 15417 |
| 190 | Ga0307408_100079730 | 3300031548 | Bacteria | 2444 |
| 191 | Ga0307408_100214078 | 3300031548 | Bacteria | 1568 |
| 192 | Ga0316579_10061344 | 3300031691 | Bacteria | 1770 |
| 193 | Ga0316576_10111302 | 3300031727 | Bacteria | 2052 |
| 194 | Ga0307405_10072703 | 3300031731 | Bacteria | 2218 |
| 195 | Ga0316577_10026922 | 3300031733 | Bacteria | 3204 |
| 196 | Ga0307410_10027331 | 3300031852 | Bacteria | 3605 |
| 197 | Ga0307410_10047445 | 3300031852 | Bacteria | 2870 |
| 198 | Ga0307406_10036918 | 3300031901 | Bacteria | 3013 |
| 199 | Ga0307406_10130163 | 3300031901 | Bacteria | 1765 |
| 200 | Ga0307407_10051414 | 3300031903 | Bacteria | 2362 |
| 201 | Ga0307409_100005847 | 3300031995 | Bacteria | 7142 |
| 202 | Ga0307409_100006726 | 3300031995 | Bacteria | 6800 |
| 203 | Ga0307409_100037833 | 3300031995 | Bacteria | 3561 |
| 204 | Ga0307409_100125471 | 3300031995 | Bacteria | 2182 |
| 205 | Ga0307414_10102841 | 3300032004 | Bacteria | 2154 |
| 206 | Ga0307411_10057483 | 3300032005 | Bacteria | 2570 |
| 207 | Ga0307415_100017636 | 3300032126 | Bacteria | 4285 |
| 208 | Ga0307415_100151804 | 3300032126 | Bacteria | 1784 |
| 209 | Ga0373955_0029354 | 3300035172 | Bacteria | 2860 |
| 210 | Ga0373961_0010000 | 3300035241 | Bacteria | 2332 |
| 211 | Ga0316574_0100136 | 3300035398 | Bacteria | 1854 |
| 212 | Ga0373931_0000225 | 3300035691 | Bacteria | 24016 |
| 213 | Ga0316584_0007831 | 3300036712 | Bacteria | 7329 |
| 214 | Ga0395898_0138629 | 3300037466 | Bacteria | 2329 |
| 215 | Ga0395901_0038351 | 3300038443 | Bacteria | 4956 |
| 216 | Ga0395901_0122341 | 3300038443 | Bacteria | 2735 |
| 217 | Ga0395901_0335408 | 3300038443 | Bacteria | 1563 |
| 218 | Ga0436365_0145151 | 3300039437 | Bacteria | 6592 |
| 219 | Ga0466957_0000193 | 3300044842 | Bacteria | 28057 |
| 220 | Ga0466967_0000849 | 3300045976 | Bacteria | 16201 |
| 221 | Ga0466967_0011288 | 3300045976 | Bacteria | 6755 |
| 222 | Ga0495629_0001145 | 3300046459 | Bacteria | 20950 |
| 223 | Ga0495629_0106898 | 3300046459 | Bacteria | 1952 |
| 224 | Ga0495641_0000010 | 3300046461 | Bacteria | 158798 |
| 225 | Ga0495641_0012812 | 3300046461 | Bacteria | 4655 |
| 226 | Ga0495651_0007628 | 3300046462 | Bacteria | 8272 |
| 227 | Ga0495639_0038823 | 3300046475 | Bacteria | 2139 |
| 228 | Ga0495662_0007409 | 3300046476 | Bacteria | 5423 |
| 229 | Ga0495608_0000042 | 3300046511 | Bacteria | 115906 |
| 230 | Ga0495608_0013606 | 3300046511 | Bacteria | 5643 |
| 231 | Ga0495608_0038156 | 3300046511 | Bacteria | 3228 |
| 232 | Ga0495620_0000731 | 3300046515 | Bacteria | 20250 |
| 233 | Ga0495628_0000265 | 3300046516 | Bacteria | 46703 |
| 234 | Ga0495628_0011404 | 3300046516 | Bacteria | 7519 |
| 235 | Ga0495628_0033384 | 3300046516 | Bacteria | 4149 |
| 236 | Ga0495628_0037405 | 3300046516 | Bacteria | 3892 |
| 237 | Ga0495630_0000027 | 3300046517 | Bacteria | 146589 |
| 238 | Ga0495630_0073394 | 3300046517 | Bacteria | 2577 |
| 239 | Ga0495644_0004691 | 3300046523 | Bacteria | 5372 |
| 240 | Ga0495644_0040868 | 3300046523 | Bacteria | 1748 |
| 241 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 242 | Ga0495652_0010474 | 3300046529 | Bacteria | 8402 |
| 243 | Ga0495645_0037717 | 3300046543 | Bacteria | 3524 |
| 244 | Ga0495622_0000069 | 3300046557 | Bacteria | 89759 |
| 245 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 246 | Ga0495635_0127622 | 3300046663 | Bacteria | 1734 |
| 247 | Ga0495588_0000565 | 3300046674 | Bacteria | 17689 |
| 248 | Ga0495657_0000040 | 3300046675 | Bacteria | 115899 |
| 249 | Ga0495623_0014357 | 3300046679 | Bacteria | 5127 |
| 250 | Ga0495647_0001037 | 3300046681 | Bacteria | 8461 |
| 251 | Ga0495669_0000132 | 3300046684 | Bacteria | 47843 |
| 252 | Ga0495613_0000287 | 3300046689 | Bacteria | 46716 |
| 253 | Ga0495624_0001686 | 3300046690 | Bacteria | 16921 |
| 254 | Ga0495649_0001290 | 3300046694 | Bacteria | 19153 |
| 255 | Ga0495600_0001252 | 3300046809 | Bacteria | 13978 |
| 256 | Ga0495581_0136262 | 3300047315 | Bacteria | 1431 |
| 257 | Ga0495604_0001593 | 3300047317 | Bacteria | 18689 |
| 258 | Ga0495604_0057538 | 3300047317 | Bacteria | 2989 |
| 259 | Ga0495604_0131749 | 3300047317 | Bacteria | 1796 |
| 260 | Ga0495676_0000624 | 3300047321 | Bacteria | 29322 |
| 261 | Ga0495676_0002889 | 3300047321 | Bacteria | 15495 |
| 262 | Ga0495680_0009699 | 3300047322 | Bacteria | 8642 |
| 263 | Ga0495675_0000051 | 3300047444 | Bacteria | 80375 |
| 264 | Ga0495602_0000038 | 3300048088 | Bacteria | 130758 |
| 265 | Ga0495602_0002031 | 3300048088 | Bacteria | 20359 |
| 266 | Ga0495602_0083806 | 3300048088 | Bacteria | 2669 |
| 267 | Ga0496100_0000006 | 3300048903 | Bacteria | 297429 |
| 268 | Ga0496100_0000028 | 3300048903 | Bacteria | 113912 |
| 269 | Ga0496100_0003544 | 3300048903 | Bacteria | 8151 |
| 270 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 271 | Ga0496101_0000009 | 3300048904 | Bacteria | 297429 |
| 272 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 273 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 274 | Ga0496102_0020309 | 3300048905 | Bacteria | 5870 |
| 275 | Ga0496102_0039468 | 3300048905 | Bacteria | 4266 |
| 276 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 277 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 278 | Ga0496103_0027757 | 3300048906 | Bacteria | 3433 |
| 279 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 280 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 281 | Ga0496104_0016048 | 3300048907 | Bacteria | 6799 |
| 282 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 283 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 284 | Ga0496105_0011546 | 3300048908 | Bacteria | 6982 |
| 285 | Ga0496106_0000070 | 3300048909 | Bacteria | 82770 |
| 286 | Ga0496106_0000090 | 3300048909 | Bacteria | 72270 |
| 287 | Ga0496106_0000101 | 3300048909 | Bacteria | 65644 |
| 288 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 289 | Ga0496107_0000015 | 3300048910 | Bacteria | 173644 |
| 290 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 291 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 292 | Ga0496109_0000034 | 3300048912 | Bacteria | 160397 |
| 293 | Ga0496109_0000036 | 3300048912 | Bacteria | 153972 |
| 294 | Ga0496109_0000391 | 3300048912 | Bacteria | 39830 |
| 295 | Ga0496110_0000122 | 3300048913 | Bacteria | 43513 |
| 296 | Ga0496110_0068466 | 3300048913 | Bacteria | 3142 |
| 297 | Ga0496110_0076647 | 3300048913 | Bacteria | 2973 |
| 298 | Ga0496111_0000037 | 3300048914 | Bacteria | 52978 |
| 299 | Ga0496111_0029760 | 3300048914 | Bacteria | 3879 |
| 300 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 301 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 302 | Ga0496113_0043828 | 3300048916 | Bacteria | 3313 |
| 303 | Ga0496114_0000159 | 3300048917 | Bacteria | 47728 |
| 304 | Ga0496114_0005005 | 3300048917 | Bacteria | 10338 |
| 305 | Ga0496114_0082759 | 3300048917 | Bacteria | 2714 |
| 306 | Ga0496114_0103893 | 3300048917 | Bacteria | 2429 |
| 307 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 308 | Ga0496115_0000257 | 3300048918 | Bacteria | 47123 |
| 309 | Ga0496115_0012449 | 3300048918 | Bacteria | 6404 |
| 310 | Ga0496115_0038792 | 3300048918 | Bacteria | 3782 |
| 311 | Ga0496116_0000292 | 3300048919 | Bacteria | 85239 |
| 312 | Ga0496117_0016509 | 3300048920 | Bacteria | 6229 |
| 313 | Ga0496118_0001671 | 3300048921 | Bacteria | 32518 |
| 314 | Ga0496118_0004040 | 3300048921 | Bacteria | 17827 |
| 315 | Ga0496119_0000556 | 3300048922 | Bacteria | 50537 |
| 316 | Ga0496119_0002934 | 3300048922 | Bacteria | 18152 |
| 317 | Ga0496120_0000120 | 3300048923 | Bacteria | 131625 |
| 318 | Ga0496125_0028985 | 3300048928 | Bacteria | 4985 |
| 319 | Ga0501033_0003171 | 3300049570 | Bacteria | 13647 |
| 320 | Ga0501036_0023446 | 3300049572 | Bacteria | 5200 |
| 321 | Ga0501036_0153260 | 3300049572 | Bacteria | 1944 |
| 322 | Ga0501037_0087320 | 3300049573 | Bacteria | 2257 |
| 323 | Ga0501038_0020128 | 3300049574 | Bacteria | 6004 |
| 324 | Ga0501039_0132321 | 3300049575 | Bacteria | 1957 |
| 325 | Ga0501040_0017629 | 3300049576 | Bacteria | 4740 |
| 326 | Ga0501041_0007827 | 3300049577 | Bacteria | 6278 |
| 327 | Ga0501041_0090763 | 3300049577 | Bacteria | 1886 |
| 328 | Ga0501042_0008027 | 3300049578 | Bacteria | 6946 |
| 329 | Ga0501042_0042035 | 3300049578 | Bacteria | 3252 |
| 330 | Ga0501043_0048213 | 3300049579 | Bacteria | 3349 |
| 331 | Ga0501043_0093284 | 3300049579 | Bacteria | 2367 |
| 332 | Ga0501046_0019123 | 3300049580 | Bacteria | 5682 |
| 333 | Ga0501046_0020820 | 3300049580 | Bacteria | 5417 |
| 334 | Ga0501046_0023305 | 3300049580 | Bacteria | 5094 |
| 335 | Ga0501048_0077057 | 3300049582 | Bacteria | 2353 |
| 336 | Ga0501067_0065104 | 3300049583 | Bacteria | 2018 |
| 337 | Ga0501068_0021315 | 3300049584 | Bacteria | 3784 |
| 338 | Ga0501068_0026136 | 3300049584 | Bacteria | 3438 |
| 339 | Ga0501070_0007976 | 3300049586 | Bacteria | 8970 |
| 340 | Ga0501071_0013714 | 3300049587 | Bacteria | 5528 |
| 341 | Ga0501071_0059263 | 3300049587 | Bacteria | 2770 |
| 342 | Ga0501072_0023423 | 3300049588 | Bacteria | 4796 |
| 343 | Ga0501072_0037013 | 3300049588 | Bacteria | 3828 |
| 344 | Ga0501072_0047320 | 3300049588 | Bacteria | 3387 |
| 345 | Ga0501074_0023011 | 3300049590 | Bacteria | 4532 |
| 346 | Ga0501074_0116843 | 3300049590 | Bacteria | 1908 |
| 347 | Ga0501075_0004446 | 3300049591 | Bacteria | 9488 |
| 348 | Ga0501075_0042386 | 3300049591 | Bacteria | 3412 |
| 349 | Ga0501075_0088395 | 3300049591 | Bacteria | 2349 |
| 350 | Ga0501076_0015263 | 3300049592 | Bacteria | 5803 |
| 351 | Ga0501076_0017275 | 3300049592 | Bacteria | 5480 |
| 352 | Ga0501076_0026332 | 3300049592 | Bacteria | 4504 |
| 353 | Ga0501077_0001189 | 3300049593 | Bacteria | 15712 |
| 354 | Ga0501077_0005255 | 3300049593 | Bacteria | 7867 |
| 355 | Ga0501077_0024661 | 3300049593 | Bacteria | 3819 |
| 356 | Ga0501079_0021783 | 3300049741 | Bacteria | 4906 |
| 357 | Ga0501079_0102698 | 3300049741 | Bacteria | 2217 |
| 358 | Ga0501079_0105279 | 3300049741 | Unclassified | 2189 |
| 359 | Ga0501081_0079729 | 3300049743 | Bacteria | 2290 |
| 360 | Ga0501081_0094985 | 3300049743 | Unclassified | 2101 |
| 361 | Ga0501035_0053898 | 3300049822 | Bacteria | 3595 |
| 362 | Ga0501044_0207556 | 3300049823 | Bacteria | 1915 |
| 363 | Ga0501045_0013990 | 3300049824 | Bacteria | 5679 |
| 364 | Ga0501045_0033340 | 3300049824 | Bacteria | 3733 |
| 365 | nmdc:mga00v17_42312_c1 | 3300050491 | Bacteria | 2739 |
| 366 | nmdc:mga0yw44_33308_c1 | 3300050492 | Bacteria | 3009 |
| 367 | nmdc:mga0yw44_396_c1 | 3300050492 | Bacteria | 15231 |
| 368 | nmdc:mga0yw44_422_c1 | 3300050492 | Bacteria | 14815 |
| 369 | nmdc:mga05p37_129040_c1 | 3300050507 | Bacteria | 3104 |
| 370 | nmdc:mga05p37_2231_c1 | 3300050507 | Bacteria | 22570 |
| 371 | nmdc:mga05p37_99378_c1 | 3300050507 | Bacteria | 3584 |
| 372 | nmdc:mga09592_229425_c1 | 3300050508 | Bacteria | 1609 |
| 373 | nmdc:mga09592_25911_c1 | 3300050508 | Bacteria | 4857 |
| 374 | nmdc:mga09592_5346_c1 | 3300050508 | Bacteria | 10436 |
| 375 | nmdc:mga0qj67_104583_c1 | 3300050509 | Bacteria | 2284 |
| 376 | nmdc:mga0qj67_15883_c1 | 3300050509 | Bacteria | 5702 |
| 377 | nmdc:mga0qj67_16839_c1 | 3300050509 | Bacteria | 5551 |
| 378 | nmdc:mga0qj67_3009_c1 | 3300050509 | Bacteria | 12108 |
| 379 | nmdc:mga06r32_140906_c1 | 3300050510 | Bacteria | 2387 |
| 380 | nmdc:mga06r32_22762_c1 | 3300050510 | Bacteria | 5796 |
| 381 | nmdc:mga06r32_7289_c1 | 3300050510 | Bacteria | 9962 |
| 382 | nmdc:mga08y16_127703_c1 | 3300050511 | Bacteria | 2645 |
| 383 | nmdc:mga08y16_171432_c1 | 3300050511 | Bacteria | 2254 |
| 384 | nmdc:mga08y16_26775_c1 | 3300050511 | Bacteria | 6076 |
| 385 | nmdc:mga0n895_210092_c1 | 3300050512 | Bacteria | 1977 |
| 386 | nmdc:mga0a205_3790_c1 | 3300050515 | Bacteria | 13540 |
| 387 | nmdc:mga0a205_6505_c1 | 3300050515 | Bacteria | 10564 |
| 388 | Ga0495601_0000019 | 3300053077 | Bacteria | 161673 |
| 389 | Ga0495601_0000059 | 3300053077 | Bacteria | 60752 |
| 390 | Ga0495612_0001133 | 3300053078 | Bacteria | 10927 |
| 391 | Ga0495612_0001929 | 3300053078 | Bacteria | 8537 |
| 392 | Ga0500635_0016490 | 3300053080 | Bacteria | 2198 |
| 393 | Ga0495655_0000008 | 3300053083 | Bacteria | 153535 |
| 394 | Ga0495595_0000009 | 3300053084 | Bacteria | 193039 |
| 395 | Ga0495595_0001807 | 3300053084 | Bacteria | 8340 |
| 396 | Ga0495595_0025947 | 3300053084 | Bacteria | 2599 |
| 397 | Ga0495619_0000069 | 3300053085 | Bacteria | 82755 |
| 398 | Ga0495619_0005611 | 3300053085 | Bacteria | 7959 |
| 399 | Ga0495619_0146602 | 3300053085 | Bacteria | 1627 |
| 400 | Ga0500614_001114 | 3300053123 | Bacteria | 6627 |
| 401 | Ga0500628_000043 | 3300053129 | Bacteria | 45301 |
| 402 | Ga0500568_0000015 | 3300053139 | Bacteria | 219403 |
| 403 | Ga0500616_0001580 | 3300053153 | Bacteria | 21272 |
| 404 | Ga0500616_0002757 | 3300053153 | Bacteria | 14190 |
| 405 | Ga0501084_0014912 | 3300054114 | Bacteria | 6445 |
| 406 | Ga0501084_0035056 | 3300054114 | Bacteria | 4194 |
| 407 | Ga0501082_0025856 | 3300060353 | Bacteria | 5060 |
| 408 | Ga0501082_0028676 | 3300060353 | Bacteria | 4795 |
| 409 | Ga0501082_0132935 | 3300060353 | Bacteria | 2159 |
| 410 | Ga0530510_0018530 | 3300061734 | Bacteria | 4935 |
| 411 | Ga0530510_0025106 | 3300061734 | Bacteria | 4261 |
| 412 | Ga0530510_0045649 | 3300061734 | Bacteria | 3165 |
| 413 | 8054927439 | 8054920844 | Bacteria | 7068637 |
| 414 | 2508677680 | 2508501039 | Bacteria | 9978592 |
| 415 | 2517759307 | 2517572101 | Bacteria | 6884336 |
| 416 | 2528205444 | 2527291627 | Bacteria | 5309833 |
| 417 | 2528215205 | 2527291629 | Bacteria | 5267418 |
| 418 | 2546950441 | 2546825537 | Bacteria | 5389291 |
| 419 | 2579748154 | 2576861822 | Bacteria | 5004595 |
| 420 | 2579854140 | 2579778521 | Bacteria | 7624758 |
| 421 | 2619856200 | 2619618881 | Bacteria | 7521104 |
| 422 | 2620350063 | 2619619003 | Bacteria | 7619552 |
| 423 | 2626638258 | 2626541554 | Bacteria | 7741902 |
| 424 | 2676199638 | 2675902999 | Bacteria | 9438463 |
| 425 | 2686540951 | 2684623036 | Bacteria | 5199090 |
| 426 | 2689956465 | 2687453737 | Bacteria | 11203906 |
| 427 | 2710602743 | 2710264753 | Bacteria | 5455564 |
| 428 | 2774844216 | 2773857921 | Bacteria | 9435764 |
| 429 | 2774863818 | 2773857924 | Bacteria | 5256821 |
| 430 | 637878995 | 637000116 | Bacteria | 5433628 |
| 431 | 8002777897 | 8002775197 | Bacteria | 10728764 |
| 432 | 8002790721 | 8002784119 | Bacteria | 9788632 |
| 433 | 8054915000 | 8054913762 | Bacteria | 7713009 |
| 434 | 8055158049 | 8055157932 | Bacteria | 6429399 |
| 435 | 8056065908 | 8056060235 | Bacteria | 7259403 |
| 436 | JGI24746J21847_1000556 | |||
| 437 | JGI24740J21852_10014564 | |||
| 438 | JGI25406J46586_10010959 | |||
| 439 | JGI25407J50210_10002544 | |||
| 440 | Ga0070683_100019100 | |||
| 441 | Ga0070677_10000020 | |||
| 442 | Ga0070682_100000032 | |||
| 443 | Ga0070682_100160987 | |||
| 444 | Ga0070660_100055891 | |||
| 445 | Ga0070691_10000348 | |||
| 446 | Ga0070661_100000032 | |||
| 447 | Ga0070668_100025930 | |||
| 448 | Ga0070668_100026572 | |||
| 449 | Ga0070675_100000022 | |||
| 450 | Ga0070674_100000021 | |||
| 451 | Ga0070674_100102782 | |||
| 452 | Ga0070673_100008528 | |||
| 453 | Ga0070688_100000031 | |||
| 454 | Ga0070688_100000194 | |||
| 455 | Ga0070659_100002039 | |||
| 456 | Ga0070713_100000516 | |||
| 457 | Ga0070700_100048295 | |||
| 458 | Ga0070681_10010128 | |||
| 459 | Ga0070681_10263680 | |||
| 460 | Ga0068867_100024210 | |||
| 461 | Ga0070685_10000058 | |||
| 462 | Ga0070685_10000263 | |||
| 463 | Ga0070706_100016202 | |||
| 464 | Ga0070679_100006708 | |||
| 465 | Ga0070672_100000258 | |||
| 466 | Ga0070665_100001623 | |||
| 467 | Ga0070664_100049242 | |||
| 468 | Ga0070664_100141804 | |||
| 469 | Ga0068854_100000133 | |||
| 470 | Ga0068856_100000369 | |||
| 471 | Ga0068852_100000024 | |||
| 472 | Ga0068859_100000119 | |||
| 473 | Ga0068859_100036988 | |||
| 474 | Ga0068866_10000007 | |||
| 475 | Ga0068851_10004054 | |||
| 476 | Ga0068863_100006314 | |||
| 477 | Ga0068863_100018006 | |||
| 478 | Ga0068858_100182826 | |||
| 479 | Ga0068860_100011273 | |||
| 480 | Ga0068862_100000166 | |||
| 481 | Ga0068862_100004171 | |||
| 482 | Ga0081455_10002113 | |||
| 483 | Ga0081455_10005786 | |||
| 484 | Ga0081455_10040573 | |||
| 485 | Ga0081455_10052451 | |||
| 486 | Ga0081538_10001329 | |||
| 487 | Ga0081538_10001392 | |||
| 488 | Ga0081538_10015234 | |||
| 489 | Ga0081538_10037759 | |||
| 490 | Ga0081540_1001588 | |||
| 491 | Ga0081540_1003348 | |||
| 492 | Ga0081539_10002064 | |||
| 493 | Ga0075365_10000999 | |||
| 494 | Ga0075365_10009534 | |||
| 495 | Ga0075365_10009888 | |||
| 496 | Ga0075364_10067023 | |||
| 497 | Ga0070715_10000003 | |||
| 498 | Ga0075428_100015593 | |||
| 499 | Ga0075428_100053324 | |||
| 500 | Ga0075428_100098489 | |||
| 501 | Ga0075428_100105624 | |||
| 502 | Ga0075430_100003154 | |||
| 503 | Ga0075430_100011191 | |||
| 504 | Ga0075430_100016090 | |||
| 505 | Ga0075430_100101058 | |||
| 506 | Ga0075430_100169455 | |||
| 507 | Ga0075431_100004797 | |||
| 508 | Ga0075431_100022636 | |||
| 509 | Ga0075431_100028280 | |||
| 510 | Ga0075431_100047559 | |||
| 511 | Ga0075431_100132489 | |||
| 512 | Ga0075433_10000383 | |||
| 513 | Ga0075433_10002915 | |||
| 514 | Ga0075434_100004945 | |||
| 515 | Ga0075429_100002028 | |||
| 516 | Ga0075429_100023710 | |||
| 517 | Ga0075429_100025056 | |||
| 518 | Ga0075429_100025254 | |||
| 519 | Ga0068865_100000024 | |||
| 520 | Ga0068865_100064135 | |||
| 521 | Ga0097620_100000119 | |||
| 522 | Ga0097620_100036988 | |||
| 523 | Ga0075435_100024838 | |||
| 524 | Ga0111539_10001058 | |||
| 525 | Ga0111539_10050315 | |||
| 526 | Ga0111539_10066145 | |||
| 527 | Ga0105245_10000022 | |||
| 528 | Ga0105245_10001178 | |||
| 529 | Ga0105245_10007818 | |||
| 530 | Ga0105245_10008000 | |||
| 531 | Ga0105245_10010101 | |||
| 532 | Ga0105245_10245338 | |||
| 533 | Ga0105247_10000049 | |||
| 534 | Ga0105247_10000064 | |||
| 535 | Ga0114129_10004594 | |||
| 536 | Ga0114129_10007585 | |||
| 537 | Ga0114129_10102241 | |||
| 538 | Ga0114129_10121454 | |||
| 539 | Ga0114129_10312763 | |||
| 540 | Ga0105243_10012040 | |||
| 541 | Ga0105242_10000123 | |||
| 542 | Ga0105248_10000017 | |||
| 543 | Ga0105248_10000473 | |||
| 544 | Ga0105249_10000181 | |||
| 545 | Ga0105239_10242209 | |||
| 546 | Ga0157371_10001783 | |||
| 547 | Ga0157369_10000068 | |||
| 548 | Ga0157378_10002103 | |||
| 549 | Ga0157372_10001135 | |||
| 550 | Ga0157375_10175485 | |||
| 551 | Ga0163163_10003549 | |||
| 552 | Ga0157380_10000328 | |||
| 553 | Ga0157380_10000403 | |||
| 554 | Ga0157379_10031333 | |||
| 555 | Ga0157379_10220486 | |||
| 556 | Ga0157376_10018824 | |||
| 557 | Ga0163161_10063434 | |||
| 558 | Ga0163161_10088768 | |||
| 559 | Ga0213876_10044336 | |||
| 560 | Ga0207656_10000274 | |||
| 561 | Ga0207682_10000050 | |||
| 562 | Ga0207642_10000008 | |||
| 563 | Ga0207710_10000073 | |||
| 564 | Ga0207710_10000165 | |||
| 565 | Ga0207685_10000003 | |||
| 566 | Ga0207707_10036138 | |||
| 567 | Ga0207693_10007617 | |||
| 568 | Ga0207657_10150478 | |||
| 569 | Ga0207649_10000166 | |||
| 570 | Ga0207652_10001510 | |||
| 571 | Ga0207659_10000030 | |||
| 572 | Ga0207687_10000025 | |||
| 573 | Ga0207687_10000039 | |||
| 574 | Ga0207687_10006005 | |||
| 575 | Ga0207687_10033400 | |||
| 576 | Ga0207687_10084469 | |||
| 577 | Ga0207700_10000019 | |||
| 578 | Ga0207690_10008591 | |||
| 579 | Ga0207690_10015961 | |||
| 580 | Ga0207706_10002691 | |||
| 581 | Ga0207686_10000066 | |||
| 582 | Ga0207709_10014890 | |||
| 583 | Ga0207669_10000032 | |||
| 584 | Ga0207704_10000054 | |||
| 585 | Ga0207691_10000871 | |||
| 586 | Ga0207711_10000011 | |||
| 587 | Ga0207711_10000400 | |||
| 588 | Ga0207661_10002638 | |||
| 589 | Ga0207661_10004497 | |||
| 590 | Ga0207661_10102929 | |||
| 591 | Ga0207679_10038529 | |||
| 592 | Ga0207667_10146153 | |||
| 593 | Ga0207651_10000951 | |||
| 594 | Ga0207712_10000067 | |||
| 595 | Ga0207712_10018581 | |||
| 596 | Ga0207668_10064882 | |||
| 597 | Ga0207640_10000147 | |||
| 598 | Ga0207639_10123935 | |||
| 599 | Ga0207678_10003461 | |||
| 600 | Ga0207708_10015019 | |||
| 601 | Ga0207708_10035831 | |||
| 602 | Ga0207708_10055477 | |||
| 603 | Ga0207702_10000557 | |||
| 604 | Ga0207641_10011786 | |||
| 605 | Ga0207641_10019506 | |||
| 606 | Ga0207648_10072488 | |||
| 607 | Ga0207648_10115227 | |||
| 608 | Ga0207674_10007759 | |||
| 609 | Ga0207675_100006375 | |||
| 610 | Ga0207675_100045353 | |||
| 611 | Ga0207698_10000014 | |||
| 612 | Ga0207428_10075315 | |||
| 613 | Ga0268266_10004229 | |||
| 614 | Ga0268266_10026023 | |||
| 615 | Ga0268266_10035520 | |||
| 616 | Ga0268265_10000069 | |||
| 617 | Ga0268265_10005246 | |||
| 618 | Ga0268264_10007756 | |||
| 619 | Ga0265319_1000030 | |||
| 620 | Ga0265338_10000156 | |||
| 621 | Ga0265338_10045946 | |||
| 622 | Ga0265325_10044261 | |||
| 623 | Ga0265331_10022620 | |||
| 624 | Ga0265327_10003360 | |||
| 625 | Ga0307408_100079730 | |||
| 626 | Ga0307408_100214078 | |||
| 627 | Ga0316579_10061344 | |||
| 628 | Ga0316576_10111302 | |||
| 629 | Ga0307405_10072703 | |||
| 630 | Ga0316577_10026922 | |||
| 631 | Ga0307410_10027331 | |||
| 632 | Ga0307410_10047445 | |||
| 633 | Ga0307406_10036918 | |||
| 634 | Ga0307406_10130163 | |||
| 635 | Ga0307407_10051414 | |||
| 636 | Ga0307409_100005847 | |||
| 637 | Ga0307409_100006726 | |||
| 638 | Ga0307409_100037833 | |||
| 639 | Ga0307409_100125471 | |||
| 640 | Ga0307414_10102841 | |||
| 641 | Ga0307411_10057483 | |||
| 642 | Ga0307415_100017636 | |||
| 643 | Ga0307415_100151804 | |||
| 644 | Ga0373955_0029354 | |||
| 645 | Ga0373961_0010000 | |||
| 646 | Ga0316574_0100136 | |||
| 647 | Ga0373931_0000225 | |||
| 648 | Ga0316584_0007831 | |||
| 649 | Ga0395898_0138629 | |||
| 650 | Ga0395901_0038351 | |||
| 651 | Ga0395901_0122341 | |||
| 652 | Ga0395901_0335408 | |||
| 653 | Ga0436365_0145151 | |||
| 654 | Ga0466957_0000193 | |||
| 655 | Ga0466967_0000849 | |||
| 656 | Ga0466967_0011288 | |||
| 657 | Ga0495629_0001145 | |||
| 658 | Ga0495629_0106898 | |||
| 659 | Ga0495641_0000010 | |||
| 660 | Ga0495641_0012812 | |||
| 661 | Ga0495651_0007628 | |||
| 662 | Ga0495639_0038823 | |||
| 663 | Ga0495662_0007409 | |||
| 664 | Ga0495608_0000042 | |||
| 665 | Ga0495608_0013606 | |||
| 666 | Ga0495608_0038156 | |||
| 667 | Ga0495620_0000731 | |||
| 668 | Ga0495628_0000265 | |||
| 669 | Ga0495628_0011404 | |||
| 670 | Ga0495628_0033384 | |||
| 671 | Ga0495628_0037405 | |||
| 672 | Ga0495630_0000027 | |||
| 673 | Ga0495630_0073394 | |||
| 674 | Ga0495644_0004691 | |||
| 675 | Ga0495644_0040868 | |||
| 676 | Ga0495652_0000009 | |||
| 677 | Ga0495652_0010474 | |||
| 678 | Ga0495645_0037717 | |||
| 679 | Ga0495622_0000069 | |||
| 680 | Ga0495635_0000006 | |||
| 681 | Ga0495635_0127622 | |||
| 682 | Ga0495588_0000565 | |||
| 683 | Ga0495657_0000040 | |||
| 684 | Ga0495623_0014357 | |||
| 685 | Ga0495647_0001037 | |||
| 686 | Ga0495669_0000132 | |||
| 687 | Ga0495613_0000287 | |||
| 688 | Ga0495624_0001686 | |||
| 689 | Ga0495649_0001290 | |||
| 690 | Ga0495600_0001252 | |||
| 691 | Ga0495581_0136262 | |||
| 692 | Ga0495604_0001593 | |||
| 693 | Ga0495604_0057538 | |||
| 694 | Ga0495604_0131749 | |||
| 695 | Ga0495676_0000624 | |||
| 696 | Ga0495676_0002889 | |||
| 697 | Ga0495680_0009699 | |||
| 698 | Ga0495675_0000051 | |||
| 699 | Ga0495602_0000038 | |||
| 700 | Ga0495602_0002031 | |||
| 701 | Ga0495602_0083806 | |||
| 702 | Ga0496100_0000006 | |||
| 703 | Ga0496100_0000028 | |||
| 704 | Ga0496100_0003544 | |||
| 705 | Ga0496101_0000005 | |||
| 706 | Ga0496101_0000009 | |||
| 707 | Ga0496102_0000002 | |||
| 708 | Ga0496102_0000021 | |||
| 709 | Ga0496102_0020309 | |||
| 710 | Ga0496102_0039468 | |||
| 711 | Ga0496103_0000001 | |||
| 712 | Ga0496103_0000017 | |||
| 713 | Ga0496103_0027757 | |||
| 714 | Ga0496104_0000008 | |||
| 715 | Ga0496104_0000029 | |||
| 716 | Ga0496104_0016048 | |||
| 717 | Ga0496105_0000002 | |||
| 718 | Ga0496105_0000003 | |||
| 719 | Ga0496105_0011546 | |||
| 720 | Ga0496106_0000070 | |||
| 721 | Ga0496106_0000090 | |||
| 722 | Ga0496106_0000101 | |||
| 723 | Ga0496107_0000004 | |||
| 724 | Ga0496107_0000015 | |||
| 725 | Ga0496108_0000004 | |||
| 726 | Ga0496108_0000042 | |||
| 727 | Ga0496109_0000034 | |||
| 728 | Ga0496109_0000036 | |||
| 729 | Ga0496109_0000391 | |||
| 730 | Ga0496110_0000122 | |||
| 731 | Ga0496110_0068466 | |||
| 732 | Ga0496110_0076647 | |||
| 733 | Ga0496111_0000037 | |||
| 734 | Ga0496111_0029760 | |||
| 735 | Ga0496112_0000002 | |||
| 736 | Ga0496113_0000002 | |||
| 737 | Ga0496113_0043828 | |||
| 738 | Ga0496114_0000159 | |||
| 739 | Ga0496114_0005005 | |||
| 740 | Ga0496114_0082759 | |||
| 741 | Ga0496114_0103893 | |||
| 742 | Ga0496115_0000005 | |||
| 743 | Ga0496115_0000257 | |||
| 744 | Ga0496115_0012449 | |||
| 745 | Ga0496115_0038792 | |||
| 746 | Ga0496116_0000292 | |||
| 747 | Ga0496117_0016509 | |||
| 748 | Ga0496118_0001671 | |||
| 749 | Ga0496118_0004040 | |||
| 750 | Ga0496119_0000556 | |||
| 751 | Ga0496119_0002934 | |||
| 752 | Ga0496120_0000120 | |||
| 753 | Ga0496125_0028985 | |||
| 754 | Ga0501033_0003171 | |||
| 755 | Ga0501036_0023446 | |||
| 756 | Ga0501036_0153260 | |||
| 757 | Ga0501037_0087320 | |||
| 758 | Ga0501038_0020128 | |||
| 759 | Ga0501039_0132321 | |||
| 760 | Ga0501040_0017629 | |||
| 761 | Ga0501041_0007827 | |||
| 762 | Ga0501041_0090763 | |||
| 763 | Ga0501042_0008027 | |||
| 764 | Ga0501042_0042035 | |||
| 765 | Ga0501043_0048213 | |||
| 766 | Ga0501043_0093284 | |||
| 767 | Ga0501046_0019123 | |||
| 768 | Ga0501046_0020820 | |||
| 769 | Ga0501046_0023305 | |||
| 770 | Ga0501048_0077057 | |||
| 771 | Ga0501067_0065104 | |||
| 772 | Ga0501068_0021315 | |||
| 773 | Ga0501068_0026136 | |||
| 774 | Ga0501070_0007976 | |||
| 775 | Ga0501071_0013714 | |||
| 776 | Ga0501071_0059263 | |||
| 777 | Ga0501072_0023423 | |||
| 778 | Ga0501072_0037013 | |||
| 779 | Ga0501072_0047320 | |||
| 780 | Ga0501074_0023011 | |||
| 781 | Ga0501074_0116843 | |||
| 782 | Ga0501075_0004446 | |||
| 783 | Ga0501075_0042386 | |||
| 784 | Ga0501075_0088395 | |||
| 785 | Ga0501076_0015263 | |||
| 786 | Ga0501076_0017275 | |||
| 787 | Ga0501076_0026332 | |||
| 788 | Ga0501077_0001189 | |||
| 789 | Ga0501077_0005255 | |||
| 790 | Ga0501077_0024661 | |||
| 791 | Ga0501079_0021783 | |||
| 792 | Ga0501079_0102698 | |||
| 793 | Ga0501079_0105279 | |||
| 794 | Ga0501081_0079729 | |||
| 795 | Ga0501081_0094985 | |||
| 796 | Ga0501035_0053898 | |||
| 797 | Ga0501044_0207556 | |||
| 798 | Ga0501045_0013990 | |||
| 799 | Ga0501045_0033340 | |||
| 800 | nmdc:mga00v17_42312_c1 | |||
| 801 | nmdc:mga0yw44_33308_c1 | |||
| 802 | nmdc:mga0yw44_396_c1 | |||
| 803 | nmdc:mga0yw44_422_c1 | |||
| 804 | nmdc:mga05p37_129040_c1 | |||
| 805 | nmdc:mga05p37_2231_c1 | |||
| 806 | nmdc:mga05p37_99378_c1 | |||
| 807 | nmdc:mga09592_229425_c1 | |||
| 808 | nmdc:mga09592_25911_c1 | |||
| 809 | nmdc:mga09592_5346_c1 | |||
| 810 | nmdc:mga0qj67_104583_c1 | |||
| 811 | nmdc:mga0qj67_15883_c1 | |||
| 812 | nmdc:mga0qj67_16839_c1 | |||
| 813 | nmdc:mga0qj67_3009_c1 | |||
| 814 | nmdc:mga06r32_140906_c1 | |||
| 815 | nmdc:mga06r32_22762_c1 | |||
| 816 | nmdc:mga06r32_7289_c1 | |||
| 817 | nmdc:mga08y16_127703_c1 | |||
| 818 | nmdc:mga08y16_171432_c1 | |||
| 819 | nmdc:mga08y16_26775_c1 | |||
| 820 | nmdc:mga0n895_210092_c1 | |||
| 821 | nmdc:mga0a205_3790_c1 | |||
| 822 | nmdc:mga0a205_6505_c1 | |||
| 823 | Ga0495601_0000019 | |||
| 824 | Ga0495601_0000059 | |||
| 825 | Ga0495612_0001133 | |||
| 826 | Ga0495612_0001929 | |||
| 827 | Ga0500635_0016490 | |||
| 828 | Ga0495655_0000008 | |||
| 829 | Ga0495595_0000009 | |||
| 830 | Ga0495595_0001807 | |||
| 831 | Ga0495595_0025947 | |||
| 832 | Ga0495619_0000069 | |||
| 833 | Ga0495619_0005611 | |||
| 834 | Ga0495619_0146602 | |||
| 835 | Ga0500614_001114 | |||
| 836 | Ga0500628_000043 | |||
| 837 | Ga0500568_0000015 | |||
| 838 | Ga0500616_0001580 | |||
| 839 | Ga0500616_0002757 | |||
| 840 | Ga0501084_0014912 | |||
| 841 | Ga0501084_0035056 | |||
| 842 | Ga0501082_0025856 | |||
| 843 | Ga0501082_0028676 | |||
| 844 | Ga0501082_0132935 | |||
| 845 | Ga0530510_0018530 | |||
| 846 | Ga0530510_0025106 | |||
| 847 | Ga0530510_0045649 | |||
| 848 | 8054927439 | |||
| 849 | 2508677680 | |||
| 850 | 2517759307 | |||
| 851 | 2528205444 | |||
| 852 | 2528215205 | |||
| 853 | 2546950441 | |||
| 854 | 2579748154 | |||
| 855 | 2579854140 | |||
| 856 | 2619856200 | |||
| 857 | 2620350063 | |||
| 858 | 2626638258 | |||
| 859 | 2676199638 | |||
| 860 | 2686540951 | |||
| 861 | 2689956465 | |||
| 862 | 2710602743 | |||
| 863 | 2774844216 | |||
| 864 | 2774863818 | |||
| 865 | 637878995 | |||
| 866 | 8002777897 | |||
| 867 | 8002790721 | |||
| 868 | 8054915000 | |||
| 869 | 8055158049 | |||
| 870 | 8056065908 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3flc-assembly1.cif.gz_X | crystal structure of the his-tagged h232r mutant of glycerol kinase from enterococcus casseliflavus with glycerol | 0.9846 | 2 | 476 |
| 3h45-assembly1.cif.gz_O | glycerol kinase h232e with ethylene glycol | 0.984 | 2 | 476 |
| 2dpn-assembly1.cif.gz_B | crystal structure of the glycerol kinase from thermus thermophilus hb8 | 0.9838 | 1 | 476 |
| 3h3n-assembly1.cif.gz_X | glycerol kinase h232r with glycerol | 0.9834 | 2 | 476 |
| 3g25-assembly1.cif.gz_A | 1.9 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with glycerol. | 0.9833 | 2 | 473 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e1jB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9814 | 2 | 238 | 3.30.420.40 |
| af_Q21944_255_502_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9662 | 240 | 478 | 3.30.420.40 |
| af_Q54XW5_391_636_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.963 | 240 | 476 | 3.30.420.40 |
| af_Q14409_268_515_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.962 | 240 | 478 | 3.30.420.40 |
| 2w40B02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9614 | 242 | 473 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538EYV6-F1-model_v4 | Glycerol kinase | 0.9976 | 1 | 139 |
GO:0004370
GO:0005829 GO:0019563 |
| AF-A0A6P1DUW9-F1-model_v4 | Carbohydrate kinase FGGY N-terminal domain-containing protein | 0.9955 | 2 | 139 |
GO:0004370
GO:0005829 GO:0019563 |
| AF-A0A352CJM4-F1-model_v4 | Glycerol kinase | 0.9942 | 2 | 136 |
GO:0004370
GO:0005829 GO:0019563 |
| AF-A0A352CXX8-F1-model_v4 | deleted | 0.9927 | 2 | 140 |
|
| AF-A0A0N0IQX3-F1-model_v4 | Carbohydrate kinase FGGY N-terminal domain-containing protein | 0.9925 | 2 | 115 |
GO:0004370
GO:0005829 GO:0019563 |