F443447

General Info

Members Datasets Scaffolds Average Seq Length
435 261 870 479

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054920844|8054927439
Length 537
Sequence ARGRVVAAVDQGTTGTTVCLLDRDGRIAGRGYTEIHPRFPRPGWVEQDPEELWRSVVDTVAAALADADLRPTDLAALGITNQRETTVVWERSSSTPVSPAIVWQDRRTAAHCERLTAGGHAAAVGDRTGLVLDPYFSATKIGWILDRDPALRRRAGRGEIAFGTVDSWLVWKLTGGAVHVTDVTNASRTLLLDLATAAWAPDMLDLFGVPAEVLPEVVPSSRVYAETDPAAFLGVRIPVAAAVGDQQAALFAQGCVEPGQAKNTYGTGSFVLVNTGPTVPPPQSSLLRTVAYQLDGEPVHYALEGAILSTGAAVGWLRDSLGIIRDAAETAQLAASLPGNDGVYFVPALTGLGAPHWDPRARGTLLGITRGTGRAHLARAVLEGIAYRTRDVVEAMAGAGFAVRELRADGGAARNPWLMQFQADILGVGVDVPDNIETTALGSAYLAGLAIGFFTDPTALAAHRRSERRYHPAMPPAQRDRAYRRWLSAVDRARAWADDTDDSNTDGSNTDDRGIEIDADRTGTGTGTGTGTGEGTS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
233 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 8054920844 Frankia tisae Agncl-8 Isolate Nodule
240 2508501039 Frankia saprophytica CN3 Isolate Nodule
241 2517572101 Frankia sp. DC12 Isolate Nodule
242 2527291627 Frankia casuarinae Thr Isolate Nodule
243 2527291629 Frankia sp. BMG5.23 Isolate Nodule
244 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
245 2576861822 Frankia sp. CeD Isolate Nodule
246 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
247 2619618881 Frankia sp. ACN1ag Isolate Unclassified
248 2619619003 Frankia sp. CpI1-P Isolate Nodule
249 2626541554 Frankia sp. AvcI.1 Isolate Nodule
250 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
251 2684623036 Frankia sp. CgIM4 Isolate Nodule
252 2687453737 Frankia sp. BMG5.36 Isolate Nodule
253 2710264753 Frankia sp. KB5 Isolate Nodule
254 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
255 2773857924 Frankia sp. CgIS1 Isolate Nodule
256 637000116 Frankia casuarinae CcI3 Isolate Nodule
257 8002775197 Frankia nepalensis CN7 Isolate Nodule
258 8002784119 Frankia sp. AgB1.9 Isolate Nodule
259 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
260 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
261 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 0
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 4.37
Rhizoplane 10.34
Rhizosphere 79.08
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000556 3300001977 Bacteria 5618
2 JGI24740J21852_10014564 3300001979 Bacteria 2895
3 JGI25406J46586_10010959 3300003203 Bacteria 3990
4 JGI25407J50210_10002544 3300003373 Bacteria 4309
5 Ga0070683_100019100 3300005329 Bacteria 6081
6 Ga0070677_10000020 3300005333 Bacteria 48941
7 Ga0070682_100000032 3300005337 Bacteria 155141
8 Ga0070682_100160987 3300005337 Bacteria 1550
9 Ga0070660_100055891 3300005339 Bacteria 3052
10 Ga0070691_10000348 3300005341 Bacteria 16483
11 Ga0070661_100000032 3300005344 Bacteria 112964
12 Ga0070668_100025930 3300005347 Bacteria 4445
13 Ga0070668_100026572 3300005347 Bacteria 4394
14 Ga0070675_100000022 3300005354 Bacteria 146580
15 Ga0070674_100000021 3300005356 Bacteria 87134
16 Ga0070674_100102782 3300005356 Bacteria 2085
17 Ga0070673_100008528 3300005364 Bacteria 6819
18 Ga0070688_100000031 3300005365 Bacteria 65288
19 Ga0070688_100000194 3300005365 Bacteria 32209
20 Ga0070659_100002039 3300005366 Bacteria 14442
21 Ga0070713_100000516 3300005436 Bacteria 24506
22 Ga0070700_100048295 3300005441 Bacteria 2638
23 Ga0070681_10010128 3300005458 Bacteria 9293
24 Ga0070681_10263680 3300005458 Bacteria 1635
25 Ga0068867_100024210 3300005459 Bacteria 4350
26 Ga0070685_10000058 3300005466 Bacteria 64666
27 Ga0070685_10000263 3300005466 Bacteria 33715
28 Ga0070706_100016202 3300005467 Bacteria 6885
29 Ga0070679_100006708 3300005530 Bacteria 10737
30 Ga0070672_100000258 3300005543 Bacteria 30020
31 Ga0070665_100001623 3300005548 Bacteria 25894
32 Ga0070664_100049242 3300005564 Bacteria 3563
33 Ga0070664_100141804 3300005564 Bacteria 2116
34 Ga0068854_100000133 3300005578 Bacteria 51376
35 Ga0068856_100000369 3300005614 Bacteria 49419
36 Ga0068852_100000024 3300005616 Bacteria 120479
37 Ga0068859_100000119 3300005617 Bacteria 74778
38 Ga0068859_100036988 3300005617 Bacteria 4900
39 Ga0068866_10000007 3300005718 Bacteria 121729
40 Ga0068851_10004054 3300005834 Bacteria 6576
41 Ga0068863_100006314 3300005841 Bacteria 11634
42 Ga0068863_100018006 3300005841 Bacteria 6762
43 Ga0068858_100182826 3300005842 Bacteria 1980
44 Ga0068860_100011273 3300005843 Bacteria 8809
45 Ga0068862_100000166 3300005844 Bacteria 72987
46 Ga0068862_100004171 3300005844 Bacteria 12237
47 Ga0081455_10002113 3300005937 Bacteria 23655
48 Ga0081455_10005786 3300005937 Bacteria 13472
49 Ga0081455_10040573 3300005937 Bacteria 4102
50 Ga0081455_10052451 3300005937 Bacteria 3491
51 Ga0081538_10001329 3300005981 Bacteria 25435
52 Ga0081538_10001392 3300005981 Bacteria 24810
53 Ga0081538_10015234 3300005981 Bacteria 5964
54 Ga0081538_10037759 3300005981 Bacteria 3126
55 Ga0081540_1001588 3300005983 Bacteria 19426
56 Ga0081540_1003348 3300005983 Bacteria 12707
57 Ga0081539_10002064 3300005985 Bacteria 30098
58 Ga0075365_10000999 3300006038 Bacteria 12085
59 Ga0075365_10009534 3300006038 Bacteria 5590
60 Ga0075365_10009888 3300006038 Bacteria 5521
61 Ga0075364_10067023 3300006051 Bacteria 2359
62 Ga0070715_10000003 3300006163 Bacteria 345282
63 Ga0075428_100015593 3300006844 Bacteria 8425
64 Ga0075428_100053324 3300006844 Bacteria 4430
65 Ga0075428_100098489 3300006844 Bacteria 3188
66 Ga0075428_100105624 3300006844 Bacteria 3071
67 Ga0075430_100003154 3300006846 Bacteria 13797
68 Ga0075430_100011191 3300006846 Bacteria 7607
69 Ga0075430_100016090 3300006846 Bacteria 6368
70 Ga0075430_100101058 3300006846 Bacteria 2408
71 Ga0075430_100169455 3300006846 Bacteria 1816
72 Ga0075431_100004797 3300006847 Bacteria 13306
73 Ga0075431_100022636 3300006847 Bacteria 6424
74 Ga0075431_100028280 3300006847 Bacteria 5758
75 Ga0075431_100047559 3300006847 Bacteria 4423
76 Ga0075431_100132489 3300006847 Bacteria 2570
77 Ga0075433_10000383 3300006852 Bacteria 28020
78 Ga0075433_10002915 3300006852 Bacteria 13125
79 Ga0075434_100004945 3300006871 Bacteria 12085
80 Ga0075429_100002028 3300006880 Bacteria 16853
81 Ga0075429_100023710 3300006880 Bacteria 5325
82 Ga0075429_100025056 3300006880 Bacteria 5178
83 Ga0075429_100025254 3300006880 Bacteria 5157
84 Ga0068865_100000024 3300006881 Bacteria 94969
85 Ga0068865_100064135 3300006881 Bacteria 2585
86 Ga0097620_100000119 3300006931 Bacteria 74778
87 Ga0097620_100036988 3300006931 Bacteria 4900
88 Ga0075435_100024838 3300007076 Bacteria 4657
89 Ga0111539_10001058 3300009094 Bacteria 36236
90 Ga0111539_10050315 3300009094 Bacteria 4963
91 Ga0111539_10066145 3300009094 Bacteria 4269
92 Ga0105245_10000022 3300009098 Bacteria 181225
93 Ga0105245_10001178 3300009098 Bacteria 23683
94 Ga0105245_10007818 3300009098 Bacteria 9365
95 Ga0105245_10008000 3300009098 Bacteria 9247
96 Ga0105245_10010101 3300009098 Bacteria 8223
97 Ga0105245_10245338 3300009098 Bacteria 1738
98 Ga0105247_10000049 3300009101 Bacteria 150328
99 Ga0105247_10000064 3300009101 Bacteria 123994
100 Ga0114129_10004594 3300009147 Bacteria 19486
101 Ga0114129_10007585 3300009147 Bacteria 15448
102 Ga0114129_10102241 3300009147 Bacteria 3963
103 Ga0114129_10121454 3300009147 Bacteria 3595
104 Ga0114129_10312763 3300009147 Bacteria 2090
105 Ga0105243_10012040 3300009148 Bacteria 6541
106 Ga0105242_10000123 3300009176 Bacteria 56900
107 Ga0105248_10000017 3300009177 Bacteria 298089
108 Ga0105248_10000473 3300009177 Bacteria 45835
109 Ga0105249_10000181 3300009553 Bacteria 73946
110 Ga0105239_10242209 3300010375 Bacteria 2024
111 Ga0157371_10001783 3300013102 Bacteria 21764
112 Ga0157369_10000068 3300013105 Bacteria 144274
113 Ga0157378_10002103 3300013297 Bacteria 17744
114 Ga0157372_10001135 3300013307 Bacteria 28936
115 Ga0157375_10175485 3300013308 Bacteria 2292
116 Ga0163163_10003549 3300014325 Bacteria 13246
117 Ga0157380_10000328 3300014326 Bacteria 28745
118 Ga0157380_10000403 3300014326 Bacteria 26163
119 Ga0157379_10031333 3300014968 Bacteria 4736
120 Ga0157379_10220486 3300014968 Bacteria 1718
121 Ga0157376_10018824 3300014969 Bacteria 5307
122 Ga0163161_10063434 3300017792 Bacteria 2693
123 Ga0163161_10088768 3300017792 Bacteria 2285
124 Ga0213876_10044336 3300021384 Bacteria 2351
125 Ga0207656_10000274 3300025321 Bacteria 17852
126 Ga0207682_10000050 3300025893 Bacteria 49908
127 Ga0207642_10000008 3300025899 Bacteria 132651
128 Ga0207710_10000073 3300025900 Bacteria 150308
129 Ga0207710_10000165 3300025900 Bacteria 69714
130 Ga0207685_10000003 3300025905 Bacteria 344527
131 Ga0207707_10036138 3300025912 Bacteria 4320
132 Ga0207693_10007617 3300025915 Bacteria 8892
133 Ga0207657_10150478 3300025919 Bacteria 1896
134 Ga0207649_10000166 3300025920 Bacteria 53758
135 Ga0207652_10001510 3300025921 Bacteria 20534
136 Ga0207659_10000030 3300025926 Bacteria 124433
137 Ga0207687_10000025 3300025927 Bacteria 175177
138 Ga0207687_10000039 3300025927 Bacteria 114303
139 Ga0207687_10006005 3300025927 Bacteria 8035
140 Ga0207687_10033400 3300025927 Bacteria 3490
141 Ga0207687_10084469 3300025927 Bacteria 2301
142 Ga0207700_10000019 3300025928 Bacteria 183117
143 Ga0207690_10008591 3300025932 Bacteria 6059
144 Ga0207690_10015961 3300025932 Bacteria 4562
145 Ga0207706_10002691 3300025933 Bacteria 17323
146 Ga0207686_10000066 3300025934 Bacteria 95095
147 Ga0207709_10014890 3300025935 Bacteria 4302
148 Ga0207669_10000032 3300025937 Bacteria 82757
149 Ga0207704_10000054 3300025938 Bacteria 79155
150 Ga0207691_10000871 3300025940 Bacteria 30024
151 Ga0207711_10000011 3300025941 Bacteria 518817
152 Ga0207711_10000400 3300025941 Bacteria 45796
153 Ga0207661_10002638 3300025944 Bacteria 12343
154 Ga0207661_10004497 3300025944 Bacteria 9777
155 Ga0207661_10102929 3300025944 Bacteria 2402
156 Ga0207679_10038529 3300025945 Bacteria 3406
157 Ga0207667_10146153 3300025949 Bacteria 2434
158 Ga0207651_10000951 3300025960 Bacteria 12786
159 Ga0207712_10000067 3300025961 Bacteria 130079
160 Ga0207712_10018581 3300025961 Bacteria 4530
161 Ga0207668_10064882 3300025972 Bacteria 2583
162 Ga0207640_10000147 3300025981 Bacteria 51462
163 Ga0207639_10123935 3300026041 Bacteria 2128
164 Ga0207678_10003461 3300026067 Bacteria 14214
165 Ga0207708_10015019 3300026075 Bacteria 5803
166 Ga0207708_10035831 3300026075 Bacteria 3775
167 Ga0207708_10055477 3300026075 Bacteria 3021
168 Ga0207702_10000557 3300026078 Bacteria 41471
169 Ga0207641_10011786 3300026088 Bacteria 7178
170 Ga0207641_10019506 3300026088 Bacteria 5566
171 Ga0207648_10072488 3300026089 Bacteria 3001
172 Ga0207648_10115227 3300026089 Bacteria 2362
173 Ga0207674_10007759 3300026116 Bacteria 12487
174 Ga0207675_100006375 3300026118 Bacteria 11187
175 Ga0207675_100045353 3300026118 Bacteria 4107
176 Ga0207698_10000014 3300026142 Bacteria 240703
177 Ga0207428_10075315 3300027907 Bacteria 2645
178 Ga0268266_10004229 3300028379 Bacteria 13823
179 Ga0268266_10026023 3300028379 Bacteria 4977
180 Ga0268266_10035520 3300028379 Bacteria 4240
181 Ga0268265_10000069 3300028380 Bacteria 141036
182 Ga0268265_10005246 3300028380 Bacteria 8866
183 Ga0268264_10007756 3300028381 Bacteria 8936
184 Ga0265319_1000030 3300028563 Bacteria 129742
185 Ga0265338_10000156 3300028800 Bacteria 125065
186 Ga0265338_10045946 3300028800 Bacteria 4009
187 Ga0265325_10044261 3300031241 Bacteria 2319
188 Ga0265331_10022620 3300031250 Bacteria 3206
189 Ga0265327_10003360 3300031251 Bacteria 15417
190 Ga0307408_100079730 3300031548 Bacteria 2444
191 Ga0307408_100214078 3300031548 Bacteria 1568
192 Ga0316579_10061344 3300031691 Bacteria 1770
193 Ga0316576_10111302 3300031727 Bacteria 2052
194 Ga0307405_10072703 3300031731 Bacteria 2218
195 Ga0316577_10026922 3300031733 Bacteria 3204
196 Ga0307410_10027331 3300031852 Bacteria 3605
197 Ga0307410_10047445 3300031852 Bacteria 2870
198 Ga0307406_10036918 3300031901 Bacteria 3013
199 Ga0307406_10130163 3300031901 Bacteria 1765
200 Ga0307407_10051414 3300031903 Bacteria 2362
201 Ga0307409_100005847 3300031995 Bacteria 7142
202 Ga0307409_100006726 3300031995 Bacteria 6800
203 Ga0307409_100037833 3300031995 Bacteria 3561
204 Ga0307409_100125471 3300031995 Bacteria 2182
205 Ga0307414_10102841 3300032004 Bacteria 2154
206 Ga0307411_10057483 3300032005 Bacteria 2570
207 Ga0307415_100017636 3300032126 Bacteria 4285
208 Ga0307415_100151804 3300032126 Bacteria 1784
209 Ga0373955_0029354 3300035172 Bacteria 2860
210 Ga0373961_0010000 3300035241 Bacteria 2332
211 Ga0316574_0100136 3300035398 Bacteria 1854
212 Ga0373931_0000225 3300035691 Bacteria 24016
213 Ga0316584_0007831 3300036712 Bacteria 7329
214 Ga0395898_0138629 3300037466 Bacteria 2329
215 Ga0395901_0038351 3300038443 Bacteria 4956
216 Ga0395901_0122341 3300038443 Bacteria 2735
217 Ga0395901_0335408 3300038443 Bacteria 1563
218 Ga0436365_0145151 3300039437 Bacteria 6592
219 Ga0466957_0000193 3300044842 Bacteria 28057
220 Ga0466967_0000849 3300045976 Bacteria 16201
221 Ga0466967_0011288 3300045976 Bacteria 6755
222 Ga0495629_0001145 3300046459 Bacteria 20950
223 Ga0495629_0106898 3300046459 Bacteria 1952
224 Ga0495641_0000010 3300046461 Bacteria 158798
225 Ga0495641_0012812 3300046461 Bacteria 4655
226 Ga0495651_0007628 3300046462 Bacteria 8272
227 Ga0495639_0038823 3300046475 Bacteria 2139
228 Ga0495662_0007409 3300046476 Bacteria 5423
229 Ga0495608_0000042 3300046511 Bacteria 115906
230 Ga0495608_0013606 3300046511 Bacteria 5643
231 Ga0495608_0038156 3300046511 Bacteria 3228
232 Ga0495620_0000731 3300046515 Bacteria 20250
233 Ga0495628_0000265 3300046516 Bacteria 46703
234 Ga0495628_0011404 3300046516 Bacteria 7519
235 Ga0495628_0033384 3300046516 Bacteria 4149
236 Ga0495628_0037405 3300046516 Bacteria 3892
237 Ga0495630_0000027 3300046517 Bacteria 146589
238 Ga0495630_0073394 3300046517 Bacteria 2577
239 Ga0495644_0004691 3300046523 Bacteria 5372
240 Ga0495644_0040868 3300046523 Bacteria 1748
241 Ga0495652_0000009 3300046529 Bacteria 311000
242 Ga0495652_0010474 3300046529 Bacteria 8402
243 Ga0495645_0037717 3300046543 Bacteria 3524
244 Ga0495622_0000069 3300046557 Bacteria 89759
245 Ga0495635_0000006 3300046663 Bacteria 301820
246 Ga0495635_0127622 3300046663 Bacteria 1734
247 Ga0495588_0000565 3300046674 Bacteria 17689
248 Ga0495657_0000040 3300046675 Bacteria 115899
249 Ga0495623_0014357 3300046679 Bacteria 5127
250 Ga0495647_0001037 3300046681 Bacteria 8461
251 Ga0495669_0000132 3300046684 Bacteria 47843
252 Ga0495613_0000287 3300046689 Bacteria 46716
253 Ga0495624_0001686 3300046690 Bacteria 16921
254 Ga0495649_0001290 3300046694 Bacteria 19153
255 Ga0495600_0001252 3300046809 Bacteria 13978
256 Ga0495581_0136262 3300047315 Bacteria 1431
257 Ga0495604_0001593 3300047317 Bacteria 18689
258 Ga0495604_0057538 3300047317 Bacteria 2989
259 Ga0495604_0131749 3300047317 Bacteria 1796
260 Ga0495676_0000624 3300047321 Bacteria 29322
261 Ga0495676_0002889 3300047321 Bacteria 15495
262 Ga0495680_0009699 3300047322 Bacteria 8642
263 Ga0495675_0000051 3300047444 Bacteria 80375
264 Ga0495602_0000038 3300048088 Bacteria 130758
265 Ga0495602_0002031 3300048088 Bacteria 20359
266 Ga0495602_0083806 3300048088 Bacteria 2669
267 Ga0496100_0000006 3300048903 Bacteria 297429
268 Ga0496100_0000028 3300048903 Bacteria 113912
269 Ga0496100_0003544 3300048903 Bacteria 8151
270 Ga0496101_0000005 3300048904 Bacteria 331455
271 Ga0496101_0000009 3300048904 Bacteria 297429
272 Ga0496102_0000002 3300048905 Bacteria 814588
273 Ga0496102_0000021 3300048905 Bacteria 246920
274 Ga0496102_0020309 3300048905 Bacteria 5870
275 Ga0496102_0039468 3300048905 Bacteria 4266
276 Ga0496103_0000001 3300048906 Bacteria 643471
277 Ga0496103_0000017 3300048906 Bacteria 244768
278 Ga0496103_0027757 3300048906 Bacteria 3433
279 Ga0496104_0000008 3300048907 Bacteria 516976
280 Ga0496104_0000029 3300048907 Bacteria 202968
281 Ga0496104_0016048 3300048907 Bacteria 6799
282 Ga0496105_0000002 3300048908 Bacteria 753215
283 Ga0496105_0000003 3300048908 Bacteria 713251
284 Ga0496105_0011546 3300048908 Bacteria 6982
285 Ga0496106_0000070 3300048909 Bacteria 82770
286 Ga0496106_0000090 3300048909 Bacteria 72270
287 Ga0496106_0000101 3300048909 Bacteria 65644
288 Ga0496107_0000004 3300048910 Bacteria 297680
289 Ga0496107_0000015 3300048910 Bacteria 173644
290 Ga0496108_0000004 3300048911 Bacteria 545055
291 Ga0496108_0000042 3300048911 Bacteria 146397
292 Ga0496109_0000034 3300048912 Bacteria 160397
293 Ga0496109_0000036 3300048912 Bacteria 153972
294 Ga0496109_0000391 3300048912 Bacteria 39830
295 Ga0496110_0000122 3300048913 Bacteria 43513
296 Ga0496110_0068466 3300048913 Bacteria 3142
297 Ga0496110_0076647 3300048913 Bacteria 2973
298 Ga0496111_0000037 3300048914 Bacteria 52978
299 Ga0496111_0029760 3300048914 Bacteria 3879
300 Ga0496112_0000002 3300048915 Bacteria 782039
301 Ga0496113_0000002 3300048916 Bacteria 220193
302 Ga0496113_0043828 3300048916 Bacteria 3313
303 Ga0496114_0000159 3300048917 Bacteria 47728
304 Ga0496114_0005005 3300048917 Bacteria 10338
305 Ga0496114_0082759 3300048917 Bacteria 2714
306 Ga0496114_0103893 3300048917 Bacteria 2429
307 Ga0496115_0000005 3300048918 Bacteria 290756
308 Ga0496115_0000257 3300048918 Bacteria 47123
309 Ga0496115_0012449 3300048918 Bacteria 6404
310 Ga0496115_0038792 3300048918 Bacteria 3782
311 Ga0496116_0000292 3300048919 Bacteria 85239
312 Ga0496117_0016509 3300048920 Bacteria 6229
313 Ga0496118_0001671 3300048921 Bacteria 32518
314 Ga0496118_0004040 3300048921 Bacteria 17827
315 Ga0496119_0000556 3300048922 Bacteria 50537
316 Ga0496119_0002934 3300048922 Bacteria 18152
317 Ga0496120_0000120 3300048923 Bacteria 131625
318 Ga0496125_0028985 3300048928 Bacteria 4985
319 Ga0501033_0003171 3300049570 Bacteria 13647
320 Ga0501036_0023446 3300049572 Bacteria 5200
321 Ga0501036_0153260 3300049572 Bacteria 1944
322 Ga0501037_0087320 3300049573 Bacteria 2257
323 Ga0501038_0020128 3300049574 Bacteria 6004
324 Ga0501039_0132321 3300049575 Bacteria 1957
325 Ga0501040_0017629 3300049576 Bacteria 4740
326 Ga0501041_0007827 3300049577 Bacteria 6278
327 Ga0501041_0090763 3300049577 Bacteria 1886
328 Ga0501042_0008027 3300049578 Bacteria 6946
329 Ga0501042_0042035 3300049578 Bacteria 3252
330 Ga0501043_0048213 3300049579 Bacteria 3349
331 Ga0501043_0093284 3300049579 Bacteria 2367
332 Ga0501046_0019123 3300049580 Bacteria 5682
333 Ga0501046_0020820 3300049580 Bacteria 5417
334 Ga0501046_0023305 3300049580 Bacteria 5094
335 Ga0501048_0077057 3300049582 Bacteria 2353
336 Ga0501067_0065104 3300049583 Bacteria 2018
337 Ga0501068_0021315 3300049584 Bacteria 3784
338 Ga0501068_0026136 3300049584 Bacteria 3438
339 Ga0501070_0007976 3300049586 Bacteria 8970
340 Ga0501071_0013714 3300049587 Bacteria 5528
341 Ga0501071_0059263 3300049587 Bacteria 2770
342 Ga0501072_0023423 3300049588 Bacteria 4796
343 Ga0501072_0037013 3300049588 Bacteria 3828
344 Ga0501072_0047320 3300049588 Bacteria 3387
345 Ga0501074_0023011 3300049590 Bacteria 4532
346 Ga0501074_0116843 3300049590 Bacteria 1908
347 Ga0501075_0004446 3300049591 Bacteria 9488
348 Ga0501075_0042386 3300049591 Bacteria 3412
349 Ga0501075_0088395 3300049591 Bacteria 2349
350 Ga0501076_0015263 3300049592 Bacteria 5803
351 Ga0501076_0017275 3300049592 Bacteria 5480
352 Ga0501076_0026332 3300049592 Bacteria 4504
353 Ga0501077_0001189 3300049593 Bacteria 15712
354 Ga0501077_0005255 3300049593 Bacteria 7867
355 Ga0501077_0024661 3300049593 Bacteria 3819
356 Ga0501079_0021783 3300049741 Bacteria 4906
357 Ga0501079_0102698 3300049741 Bacteria 2217
358 Ga0501079_0105279 3300049741 Unclassified 2189
359 Ga0501081_0079729 3300049743 Bacteria 2290
360 Ga0501081_0094985 3300049743 Unclassified 2101
361 Ga0501035_0053898 3300049822 Bacteria 3595
362 Ga0501044_0207556 3300049823 Bacteria 1915
363 Ga0501045_0013990 3300049824 Bacteria 5679
364 Ga0501045_0033340 3300049824 Bacteria 3733
365 nmdc:mga00v17_42312_c1 3300050491 Bacteria 2739
366 nmdc:mga0yw44_33308_c1 3300050492 Bacteria 3009
367 nmdc:mga0yw44_396_c1 3300050492 Bacteria 15231
368 nmdc:mga0yw44_422_c1 3300050492 Bacteria 14815
369 nmdc:mga05p37_129040_c1 3300050507 Bacteria 3104
370 nmdc:mga05p37_2231_c1 3300050507 Bacteria 22570
371 nmdc:mga05p37_99378_c1 3300050507 Bacteria 3584
372 nmdc:mga09592_229425_c1 3300050508 Bacteria 1609
373 nmdc:mga09592_25911_c1 3300050508 Bacteria 4857
374 nmdc:mga09592_5346_c1 3300050508 Bacteria 10436
375 nmdc:mga0qj67_104583_c1 3300050509 Bacteria 2284
376 nmdc:mga0qj67_15883_c1 3300050509 Bacteria 5702
377 nmdc:mga0qj67_16839_c1 3300050509 Bacteria 5551
378 nmdc:mga0qj67_3009_c1 3300050509 Bacteria 12108
379 nmdc:mga06r32_140906_c1 3300050510 Bacteria 2387
380 nmdc:mga06r32_22762_c1 3300050510 Bacteria 5796
381 nmdc:mga06r32_7289_c1 3300050510 Bacteria 9962
382 nmdc:mga08y16_127703_c1 3300050511 Bacteria 2645
383 nmdc:mga08y16_171432_c1 3300050511 Bacteria 2254
384 nmdc:mga08y16_26775_c1 3300050511 Bacteria 6076
385 nmdc:mga0n895_210092_c1 3300050512 Bacteria 1977
386 nmdc:mga0a205_3790_c1 3300050515 Bacteria 13540
387 nmdc:mga0a205_6505_c1 3300050515 Bacteria 10564
388 Ga0495601_0000019 3300053077 Bacteria 161673
389 Ga0495601_0000059 3300053077 Bacteria 60752
390 Ga0495612_0001133 3300053078 Bacteria 10927
391 Ga0495612_0001929 3300053078 Bacteria 8537
392 Ga0500635_0016490 3300053080 Bacteria 2198
393 Ga0495655_0000008 3300053083 Bacteria 153535
394 Ga0495595_0000009 3300053084 Bacteria 193039
395 Ga0495595_0001807 3300053084 Bacteria 8340
396 Ga0495595_0025947 3300053084 Bacteria 2599
397 Ga0495619_0000069 3300053085 Bacteria 82755
398 Ga0495619_0005611 3300053085 Bacteria 7959
399 Ga0495619_0146602 3300053085 Bacteria 1627
400 Ga0500614_001114 3300053123 Bacteria 6627
401 Ga0500628_000043 3300053129 Bacteria 45301
402 Ga0500568_0000015 3300053139 Bacteria 219403
403 Ga0500616_0001580 3300053153 Bacteria 21272
404 Ga0500616_0002757 3300053153 Bacteria 14190
405 Ga0501084_0014912 3300054114 Bacteria 6445
406 Ga0501084_0035056 3300054114 Bacteria 4194
407 Ga0501082_0025856 3300060353 Bacteria 5060
408 Ga0501082_0028676 3300060353 Bacteria 4795
409 Ga0501082_0132935 3300060353 Bacteria 2159
410 Ga0530510_0018530 3300061734 Bacteria 4935
411 Ga0530510_0025106 3300061734 Bacteria 4261
412 Ga0530510_0045649 3300061734 Bacteria 3165
413 8054927439 8054920844 Bacteria 7068637
414 2508677680 2508501039 Bacteria 9978592
415 2517759307 2517572101 Bacteria 6884336
416 2528205444 2527291627 Bacteria 5309833
417 2528215205 2527291629 Bacteria 5267418
418 2546950441 2546825537 Bacteria 5389291
419 2579748154 2576861822 Bacteria 5004595
420 2579854140 2579778521 Bacteria 7624758
421 2619856200 2619618881 Bacteria 7521104
422 2620350063 2619619003 Bacteria 7619552
423 2626638258 2626541554 Bacteria 7741902
424 2676199638 2675902999 Bacteria 9438463
425 2686540951 2684623036 Bacteria 5199090
426 2689956465 2687453737 Bacteria 11203906
427 2710602743 2710264753 Bacteria 5455564
428 2774844216 2773857921 Bacteria 9435764
429 2774863818 2773857924 Bacteria 5256821
430 637878995 637000116 Bacteria 5433628
431 8002777897 8002775197 Bacteria 10728764
432 8002790721 8002784119 Bacteria 9788632
433 8054915000 8054913762 Bacteria 7713009
434 8055158049 8055157932 Bacteria 6429399
435 8056065908 8056060235 Bacteria 7259403
436 JGI24746J21847_1000556
437 JGI24740J21852_10014564
438 JGI25406J46586_10010959
439 JGI25407J50210_10002544
440 Ga0070683_100019100
441 Ga0070677_10000020
442 Ga0070682_100000032
443 Ga0070682_100160987
444 Ga0070660_100055891
445 Ga0070691_10000348
446 Ga0070661_100000032
447 Ga0070668_100025930
448 Ga0070668_100026572
449 Ga0070675_100000022
450 Ga0070674_100000021
451 Ga0070674_100102782
452 Ga0070673_100008528
453 Ga0070688_100000031
454 Ga0070688_100000194
455 Ga0070659_100002039
456 Ga0070713_100000516
457 Ga0070700_100048295
458 Ga0070681_10010128
459 Ga0070681_10263680
460 Ga0068867_100024210
461 Ga0070685_10000058
462 Ga0070685_10000263
463 Ga0070706_100016202
464 Ga0070679_100006708
465 Ga0070672_100000258
466 Ga0070665_100001623
467 Ga0070664_100049242
468 Ga0070664_100141804
469 Ga0068854_100000133
470 Ga0068856_100000369
471 Ga0068852_100000024
472 Ga0068859_100000119
473 Ga0068859_100036988
474 Ga0068866_10000007
475 Ga0068851_10004054
476 Ga0068863_100006314
477 Ga0068863_100018006
478 Ga0068858_100182826
479 Ga0068860_100011273
480 Ga0068862_100000166
481 Ga0068862_100004171
482 Ga0081455_10002113
483 Ga0081455_10005786
484 Ga0081455_10040573
485 Ga0081455_10052451
486 Ga0081538_10001329
487 Ga0081538_10001392
488 Ga0081538_10015234
489 Ga0081538_10037759
490 Ga0081540_1001588
491 Ga0081540_1003348
492 Ga0081539_10002064
493 Ga0075365_10000999
494 Ga0075365_10009534
495 Ga0075365_10009888
496 Ga0075364_10067023
497 Ga0070715_10000003
498 Ga0075428_100015593
499 Ga0075428_100053324
500 Ga0075428_100098489
501 Ga0075428_100105624
502 Ga0075430_100003154
503 Ga0075430_100011191
504 Ga0075430_100016090
505 Ga0075430_100101058
506 Ga0075430_100169455
507 Ga0075431_100004797
508 Ga0075431_100022636
509 Ga0075431_100028280
510 Ga0075431_100047559
511 Ga0075431_100132489
512 Ga0075433_10000383
513 Ga0075433_10002915
514 Ga0075434_100004945
515 Ga0075429_100002028
516 Ga0075429_100023710
517 Ga0075429_100025056
518 Ga0075429_100025254
519 Ga0068865_100000024
520 Ga0068865_100064135
521 Ga0097620_100000119
522 Ga0097620_100036988
523 Ga0075435_100024838
524 Ga0111539_10001058
525 Ga0111539_10050315
526 Ga0111539_10066145
527 Ga0105245_10000022
528 Ga0105245_10001178
529 Ga0105245_10007818
530 Ga0105245_10008000
531 Ga0105245_10010101
532 Ga0105245_10245338
533 Ga0105247_10000049
534 Ga0105247_10000064
535 Ga0114129_10004594
536 Ga0114129_10007585
537 Ga0114129_10102241
538 Ga0114129_10121454
539 Ga0114129_10312763
540 Ga0105243_10012040
541 Ga0105242_10000123
542 Ga0105248_10000017
543 Ga0105248_10000473
544 Ga0105249_10000181
545 Ga0105239_10242209
546 Ga0157371_10001783
547 Ga0157369_10000068
548 Ga0157378_10002103
549 Ga0157372_10001135
550 Ga0157375_10175485
551 Ga0163163_10003549
552 Ga0157380_10000328
553 Ga0157380_10000403
554 Ga0157379_10031333
555 Ga0157379_10220486
556 Ga0157376_10018824
557 Ga0163161_10063434
558 Ga0163161_10088768
559 Ga0213876_10044336
560 Ga0207656_10000274
561 Ga0207682_10000050
562 Ga0207642_10000008
563 Ga0207710_10000073
564 Ga0207710_10000165
565 Ga0207685_10000003
566 Ga0207707_10036138
567 Ga0207693_10007617
568 Ga0207657_10150478
569 Ga0207649_10000166
570 Ga0207652_10001510
571 Ga0207659_10000030
572 Ga0207687_10000025
573 Ga0207687_10000039
574 Ga0207687_10006005
575 Ga0207687_10033400
576 Ga0207687_10084469
577 Ga0207700_10000019
578 Ga0207690_10008591
579 Ga0207690_10015961
580 Ga0207706_10002691
581 Ga0207686_10000066
582 Ga0207709_10014890
583 Ga0207669_10000032
584 Ga0207704_10000054
585 Ga0207691_10000871
586 Ga0207711_10000011
587 Ga0207711_10000400
588 Ga0207661_10002638
589 Ga0207661_10004497
590 Ga0207661_10102929
591 Ga0207679_10038529
592 Ga0207667_10146153
593 Ga0207651_10000951
594 Ga0207712_10000067
595 Ga0207712_10018581
596 Ga0207668_10064882
597 Ga0207640_10000147
598 Ga0207639_10123935
599 Ga0207678_10003461
600 Ga0207708_10015019
601 Ga0207708_10035831
602 Ga0207708_10055477
603 Ga0207702_10000557
604 Ga0207641_10011786
605 Ga0207641_10019506
606 Ga0207648_10072488
607 Ga0207648_10115227
608 Ga0207674_10007759
609 Ga0207675_100006375
610 Ga0207675_100045353
611 Ga0207698_10000014
612 Ga0207428_10075315
613 Ga0268266_10004229
614 Ga0268266_10026023
615 Ga0268266_10035520
616 Ga0268265_10000069
617 Ga0268265_10005246
618 Ga0268264_10007756
619 Ga0265319_1000030
620 Ga0265338_10000156
621 Ga0265338_10045946
622 Ga0265325_10044261
623 Ga0265331_10022620
624 Ga0265327_10003360
625 Ga0307408_100079730
626 Ga0307408_100214078
627 Ga0316579_10061344
628 Ga0316576_10111302
629 Ga0307405_10072703
630 Ga0316577_10026922
631 Ga0307410_10027331
632 Ga0307410_10047445
633 Ga0307406_10036918
634 Ga0307406_10130163
635 Ga0307407_10051414
636 Ga0307409_100005847
637 Ga0307409_100006726
638 Ga0307409_100037833
639 Ga0307409_100125471
640 Ga0307414_10102841
641 Ga0307411_10057483
642 Ga0307415_100017636
643 Ga0307415_100151804
644 Ga0373955_0029354
645 Ga0373961_0010000
646 Ga0316574_0100136
647 Ga0373931_0000225
648 Ga0316584_0007831
649 Ga0395898_0138629
650 Ga0395901_0038351
651 Ga0395901_0122341
652 Ga0395901_0335408
653 Ga0436365_0145151
654 Ga0466957_0000193
655 Ga0466967_0000849
656 Ga0466967_0011288
657 Ga0495629_0001145
658 Ga0495629_0106898
659 Ga0495641_0000010
660 Ga0495641_0012812
661 Ga0495651_0007628
662 Ga0495639_0038823
663 Ga0495662_0007409
664 Ga0495608_0000042
665 Ga0495608_0013606
666 Ga0495608_0038156
667 Ga0495620_0000731
668 Ga0495628_0000265
669 Ga0495628_0011404
670 Ga0495628_0033384
671 Ga0495628_0037405
672 Ga0495630_0000027
673 Ga0495630_0073394
674 Ga0495644_0004691
675 Ga0495644_0040868
676 Ga0495652_0000009
677 Ga0495652_0010474
678 Ga0495645_0037717
679 Ga0495622_0000069
680 Ga0495635_0000006
681 Ga0495635_0127622
682 Ga0495588_0000565
683 Ga0495657_0000040
684 Ga0495623_0014357
685 Ga0495647_0001037
686 Ga0495669_0000132
687 Ga0495613_0000287
688 Ga0495624_0001686
689 Ga0495649_0001290
690 Ga0495600_0001252
691 Ga0495581_0136262
692 Ga0495604_0001593
693 Ga0495604_0057538
694 Ga0495604_0131749
695 Ga0495676_0000624
696 Ga0495676_0002889
697 Ga0495680_0009699
698 Ga0495675_0000051
699 Ga0495602_0000038
700 Ga0495602_0002031
701 Ga0495602_0083806
702 Ga0496100_0000006
703 Ga0496100_0000028
704 Ga0496100_0003544
705 Ga0496101_0000005
706 Ga0496101_0000009
707 Ga0496102_0000002
708 Ga0496102_0000021
709 Ga0496102_0020309
710 Ga0496102_0039468
711 Ga0496103_0000001
712 Ga0496103_0000017
713 Ga0496103_0027757
714 Ga0496104_0000008
715 Ga0496104_0000029
716 Ga0496104_0016048
717 Ga0496105_0000002
718 Ga0496105_0000003
719 Ga0496105_0011546
720 Ga0496106_0000070
721 Ga0496106_0000090
722 Ga0496106_0000101
723 Ga0496107_0000004
724 Ga0496107_0000015
725 Ga0496108_0000004
726 Ga0496108_0000042
727 Ga0496109_0000034
728 Ga0496109_0000036
729 Ga0496109_0000391
730 Ga0496110_0000122
731 Ga0496110_0068466
732 Ga0496110_0076647
733 Ga0496111_0000037
734 Ga0496111_0029760
735 Ga0496112_0000002
736 Ga0496113_0000002
737 Ga0496113_0043828
738 Ga0496114_0000159
739 Ga0496114_0005005
740 Ga0496114_0082759
741 Ga0496114_0103893
742 Ga0496115_0000005
743 Ga0496115_0000257
744 Ga0496115_0012449
745 Ga0496115_0038792
746 Ga0496116_0000292
747 Ga0496117_0016509
748 Ga0496118_0001671
749 Ga0496118_0004040
750 Ga0496119_0000556
751 Ga0496119_0002934
752 Ga0496120_0000120
753 Ga0496125_0028985
754 Ga0501033_0003171
755 Ga0501036_0023446
756 Ga0501036_0153260
757 Ga0501037_0087320
758 Ga0501038_0020128
759 Ga0501039_0132321
760 Ga0501040_0017629
761 Ga0501041_0007827
762 Ga0501041_0090763
763 Ga0501042_0008027
764 Ga0501042_0042035
765 Ga0501043_0048213
766 Ga0501043_0093284
767 Ga0501046_0019123
768 Ga0501046_0020820
769 Ga0501046_0023305
770 Ga0501048_0077057
771 Ga0501067_0065104
772 Ga0501068_0021315
773 Ga0501068_0026136
774 Ga0501070_0007976
775 Ga0501071_0013714
776 Ga0501071_0059263
777 Ga0501072_0023423
778 Ga0501072_0037013
779 Ga0501072_0047320
780 Ga0501074_0023011
781 Ga0501074_0116843
782 Ga0501075_0004446
783 Ga0501075_0042386
784 Ga0501075_0088395
785 Ga0501076_0015263
786 Ga0501076_0017275
787 Ga0501076_0026332
788 Ga0501077_0001189
789 Ga0501077_0005255
790 Ga0501077_0024661
791 Ga0501079_0021783
792 Ga0501079_0102698
793 Ga0501079_0105279
794 Ga0501081_0079729
795 Ga0501081_0094985
796 Ga0501035_0053898
797 Ga0501044_0207556
798 Ga0501045_0013990
799 Ga0501045_0033340
800 nmdc:mga00v17_42312_c1
801 nmdc:mga0yw44_33308_c1
802 nmdc:mga0yw44_396_c1
803 nmdc:mga0yw44_422_c1
804 nmdc:mga05p37_129040_c1
805 nmdc:mga05p37_2231_c1
806 nmdc:mga05p37_99378_c1
807 nmdc:mga09592_229425_c1
808 nmdc:mga09592_25911_c1
809 nmdc:mga09592_5346_c1
810 nmdc:mga0qj67_104583_c1
811 nmdc:mga0qj67_15883_c1
812 nmdc:mga0qj67_16839_c1
813 nmdc:mga0qj67_3009_c1
814 nmdc:mga06r32_140906_c1
815 nmdc:mga06r32_22762_c1
816 nmdc:mga06r32_7289_c1
817 nmdc:mga08y16_127703_c1
818 nmdc:mga08y16_171432_c1
819 nmdc:mga08y16_26775_c1
820 nmdc:mga0n895_210092_c1
821 nmdc:mga0a205_3790_c1
822 nmdc:mga0a205_6505_c1
823 Ga0495601_0000019
824 Ga0495601_0000059
825 Ga0495612_0001133
826 Ga0495612_0001929
827 Ga0500635_0016490
828 Ga0495655_0000008
829 Ga0495595_0000009
830 Ga0495595_0001807
831 Ga0495595_0025947
832 Ga0495619_0000069
833 Ga0495619_0005611
834 Ga0495619_0146602
835 Ga0500614_001114
836 Ga0500628_000043
837 Ga0500568_0000015
838 Ga0500616_0001580
839 Ga0500616_0002757
840 Ga0501084_0014912
841 Ga0501084_0035056
842 Ga0501082_0025856
843 Ga0501082_0028676
844 Ga0501082_0132935
845 Ga0530510_0018530
846 Ga0530510_0025106
847 Ga0530510_0045649
848 8054927439
849 2508677680
850 2517759307
851 2528205444
852 2528215205
853 2546950441
854 2579748154
855 2579854140
856 2619856200
857 2620350063
858 2626638258
859 2676199638
860 2686540951
861 2689956465
862 2710602743
863 2774844216
864 2774863818
865 637878995
866 8002777897
867 8002790721
868 8054915000
869 8055158049
870 8056065908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00370

FGGY_N

FGGY family of carbohydrate kinases, N-terminal domain

5

252

0.98

PF02782

FGGY_C

FGGY family of carbohydrate kinases, C-terminal domain

261

451

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3flc-assembly1.cif.gz_X crystal structure of the his-tagged h232r mutant of glycerol kinase from enterococcus casseliflavus with glycerol 0.9846 2 476
3h45-assembly1.cif.gz_O glycerol kinase h232e with ethylene glycol 0.984 2 476
2dpn-assembly1.cif.gz_B crystal structure of the glycerol kinase from thermus thermophilus hb8 0.9838 1 476
3h3n-assembly1.cif.gz_X glycerol kinase h232r with glycerol 0.9834 2 476
3g25-assembly1.cif.gz_A 1.9 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with glycerol. 0.9833 2 473
ID Description Score Start End Superfamily
4e1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9814 2 238 3.30.420.40
af_Q21944_255_502_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9662 240 478 3.30.420.40
af_Q54XW5_391_636_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.963 240 476 3.30.420.40
af_Q14409_268_515_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.962 240 478 3.30.420.40
2w40B02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9614 242 473 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A538EYV6-F1-model_v4 Glycerol kinase 0.9976 1 139 GO:0004370
GO:0005829
GO:0019563
AF-A0A6P1DUW9-F1-model_v4 Carbohydrate kinase FGGY N-terminal domain-containing protein 0.9955 2 139 GO:0004370
GO:0005829
GO:0019563
AF-A0A352CJM4-F1-model_v4 Glycerol kinase 0.9942 2 136 GO:0004370
GO:0005829
GO:0019563
AF-A0A352CXX8-F1-model_v4 deleted 0.9927 2 140
AF-A0A0N0IQX3-F1-model_v4 Carbohydrate kinase FGGY N-terminal domain-containing protein 0.9925 2 115 GO:0004370
GO:0005829
GO:0019563

Map