F443500

General Info

Members Datasets Scaffolds Average Seq Length
436 299 872 268

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100109909|Ga0070696_1001099094
Length 315
Sequence MAGNFARVMRRGPFYVNPARTAKPLMVSVSGSFRTQGLKIANHRNGRLEPLMRDRKNKHVGSRNRPWEKRELRRERDRDGPALIYGWHAVQAALENPKRKIRRILVTPNGARRLEELGIKPKVTPEIVRPNEIDRRLSPDAVHQGVLAEADPLPSPELEDISPDGLVLVLDQITDPHNFGAITRSAAAFAVSAIVTTARHSPEATGVLAKSASGGLEYVPVVLVQNLARSLTELKSRGFLLVGLDEDGAIDLSAAPLRAPLALVMGAEGKGLRQLTRETCDLLARLEMPGKIKSLNVSNAAALALYVASRAVGRS

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
293 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
299 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.82
Nodule 0
Rhizoplane 5.5
Rhizosphere 87.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100109909 3300005546 Bacteria 1984
2 ARcpr5oldR_c004807 3300000041 Bacteria 1166
3 ARSoilOldRDRAFT_c000677 3300000044 Bacteria 3574
4 ARCol0yngRDRAFT_1000797 3300000652 Bacteria 2946
5 JGI24752J21851_1007707 3300001976 Bacteria 1404
6 JGI24746J21847_1011131 3300001977 Bacteria 1325
7 JGI24739J22299_10051257 3300001989 Bacteria 1332
8 JGI24737J22298_10005171 3300001990 Bacteria 4517
9 JGI24737J22298_10012886 3300001990 Bacteria 2725
10 JGI24750J21931_1007237 3300002070 Bacteria 1393
11 JGI24745J21846_1004839 3300002073 Bacteria 1452
12 JGI24738J21930_10002162 3300002075 Bacteria 5232
13 JGI24738J21930_10002843 3300002075 Bacteria 4435
14 JGI24749J21850_1010946 3300002076 Bacteria 1273
15 JGI24035J26624_1000649 3300002126 Bacteria 3214
16 JGI24742J22300_10009815 3300002244 Bacteria 1581
17 JGI24751J29686_10009592 3300002459 Bacteria 1993
18 Ga0065712_10274265 3300005290 Bacteria 909
19 Ga0065715_10089811 3300005293 Bacteria 8451
20 Ga0070676_10000815 3300005328 Bacteria 15399
21 Ga0070683_100063206 3300005329 Bacteria 3443
22 Ga0070690_100008506 3300005330 Bacteria 5915
23 Ga0070690_100081235 3300005330 Bacteria 2121
24 Ga0068869_100003878 3300005334 Bacteria 9228
25 Ga0070666_10035734 3300005335 Bacteria 3296
26 Ga0070680_100024778 3300005336 Bacteria 4795
27 Ga0070682_100007443 3300005337 Bacteria 6175
28 Ga0070682_100052004 3300005337 Bacteria 2562
29 Ga0068868_100002152 3300005338 Bacteria 13611
30 Ga0070660_100006535 3300005339 Bacteria 8086
31 Ga0070691_10017100 3300005341 Bacteria 3337
32 Ga0070661_100004456 3300005344 Bacteria 9656
33 Ga0070661_100442092 3300005344 Bacteria 1034
34 Ga0070692_10002286 3300005345 Bacteria 7367
35 Ga0070668_100010034 3300005347 Bacteria 7018
36 Ga0070668_100184364 3300005347 Bacteria 1706
37 Ga0070675_100025947 3300005354 Bacteria 4700
38 Ga0070671_100007679 3300005355 Bacteria 8621
39 Ga0070674_100022804 3300005356 Bacteria 4040
40 Ga0070673_100078780 3300005364 Bacteria 2666
41 Ga0070688_100001118 3300005365 Bacteria 13410
42 Ga0070688_100297371 3300005365 Bacteria 1166
43 Ga0070688_100415687 3300005365 Bacteria 998
44 Ga0070659_100001585 3300005366 Bacteria 16390
45 Ga0070659_100019303 3300005366 Bacteria 5163
46 Ga0070667_100011021 3300005367 Bacteria 7476
47 Ga0070709_10016133 3300005434 Bacteria 4258
48 Ga0070714_100072344 3300005435 Bacteria 2984
49 Ga0070714_100076665 3300005435 Bacteria 2903
50 Ga0070713_100038607 3300005436 Bacteria 3870
51 Ga0070713_100283077 3300005436 Bacteria 1522
52 Ga0070710_10019305 3300005437 Bacteria 3520
53 Ga0070711_100004033 3300005439 Bacteria 8636
54 Ga0070705_100004294 3300005440 Bacteria 6947
55 Ga0070694_100003318 3300005444 Bacteria 9629
56 Ga0070694_100103789 3300005444 Bacteria 2015
57 Ga0070663_100013533 3300005455 Bacteria 5207
58 Ga0070663_100020258 3300005455 Bacteria 4400
59 Ga0070663_100226687 3300005455 Bacteria 1469
60 Ga0070678_100082143 3300005456 Bacteria 2445
61 Ga0070681_10008398 3300005458 Bacteria 10112
62 Ga0070681_10056887 3300005458 Bacteria 3891
63 Ga0070681_10136223 3300005458 Bacteria 2386
64 Ga0070698_100165590 3300005471 Bacteria 2154
65 Ga0070698_100554068 3300005471 Bacteria 1089
66 Ga0070699_100002213 3300005518 Bacteria 17581
67 Ga0070679_100007296 3300005530 Bacteria 10324
68 Ga0070679_100120912 3300005530 Bacteria 2603
69 Ga0070684_100004511 3300005535 Bacteria 10603
70 Ga0068853_100015719 3300005539 Bacteria 6216
71 Ga0068853_100122156 3300005539 Bacteria 2324
72 Ga0068853_100363480 3300005539 Bacteria 1349
73 Ga0070672_100001360 3300005543 Bacteria 15082
74 Ga0070686_100003025 3300005544 Bacteria 9218
75 Ga0070695_100028434 3300005545 Bacteria 3469
76 Ga0070695_100064400 3300005545 Bacteria 2385
77 Ga0070696_100030574 3300005546 Bacteria 3688
78 Ga0070696_100114059 3300005546 Bacteria 1949
79 Ga0070693_100011627 3300005547 Bacteria 4437
80 Ga0070693_100045377 3300005547 Bacteria 2491
81 Ga0070665_100399693 3300005548 Bacteria 1382
82 Ga0070665_100770964 3300005548 Bacteria 975
83 Ga0070704_100001466 3300005549 Bacteria 12657
84 Ga0070704_100078077 3300005549 Bacteria 2427
85 Ga0068855_100054285 3300005563 Bacteria 4709
86 Ga0070664_100020979 3300005564 Bacteria 5382
87 Ga0070664_100211163 3300005564 Bacteria 1735
88 Ga0068857_100005536 3300005577 Bacteria 10776
89 Ga0068854_100002249 3300005578 Bacteria 11871
90 Ga0068856_100010337 3300005614 Bacteria 9067
91 Ga0068859_100011396 3300005617 Bacteria 8939
92 Ga0068864_100003267 3300005618 Bacteria 13395
93 Ga0068866_10005568 3300005718 Bacteria 5207
94 Ga0068861_100000864 3300005719 Bacteria 18313
95 Ga0068863_100004580 3300005841 Bacteria 13636
96 Ga0068858_100023582 3300005842 Bacteria 5732
97 Ga0068860_100029880 3300005843 Bacteria 5242
98 Ga0068860_100076187 3300005843 Bacteria 3190
99 Ga0068862_100084756 3300005844 Bacteria 2753
100 Ga0081455_10011460 3300005937 Bacteria 8906
101 Ga0081455_10021313 3300005937 Bacteria 6081
102 Ga0081455_10064361 3300005937 Bacteria 3070
103 Ga0081540_1007780 3300005983 Bacteria 7584
104 Ga0070717_10132295 3300006028 Bacteria 2146
105 Ga0070717_10237362 3300006028 Bacteria 1607
106 Ga0075365_10095909 3300006038 Bacteria 2026
107 Ga0075368_10004155 3300006042 Bacteria 4880
108 Ga0075364_10122952 3300006051 Bacteria 1738
109 Ga0075364_10152939 3300006051 Bacteria 1555
110 Ga0070715_10019056 3300006163 Bacteria 2626
111 Ga0070716_100014610 3300006173 Bacteria 4024
112 Ga0070716_100104890 3300006173 Bacteria 1741
113 Ga0070712_100077826 3300006175 Bacteria 2392
114 Ga0075369_10166439 3300006186 Bacteria 1011
115 Ga0097621_100001680 3300006237 Bacteria 15132
116 Ga0075370_10007876 3300006353 Bacteria 5452
117 Ga0068871_100001520 3300006358 Bacteria 15539
118 Ga0075430_100000020 3300006846 Bacteria 85255
119 Ga0075431_100401610 3300006847 Bacteria 1371
120 Ga0075433_10012818 3300006852 Bacteria 6791
121 Ga0075434_100024676 3300006871 Bacteria 5880
122 Ga0075429_100130338 3300006880 Bacteria 2199
123 Ga0068865_100189388 3300006881 Bacteria 1590
124 Ga0075436_100199246 3300006914 Bacteria 1418
125 Ga0075436_100306042 3300006914 Bacteria 1140
126 Ga0097620_100011397 3300006931 Bacteria 8939
127 Ga0111539_10005194 3300009094 Bacteria 16866
128 Ga0111539_10079742 3300009094 Bacteria 3851
129 Ga0111539_10187630 3300009094 Bacteria 2414
130 Ga0105245_10013663 3300009098 Bacteria 7073
131 Ga0114129_10119473 3300009147 Bacteria 3630
132 Ga0114129_10289392 3300009147 Bacteria 2187
133 Ga0114129_10782478 3300009147 Bacteria 1219
134 Ga0105243_10014592 3300009148 Bacteria 5944
135 Ga0105241_10110940 3300009174 Bacteria 2195
136 Ga0105241_10245486 3300009174 Bacteria 1516
137 Ga0105242_10044279 3300009176 Bacteria 3604
138 Ga0105242_10247769 3300009176 Bacteria 1604
139 Ga0105248_10026506 3300009177 Bacteria 6447
140 Ga0105237_10220327 3300009545 Bacteria 1898
141 Ga0105249_10018114 3300009553 Bacteria 6259
142 Ga0105249_10108423 3300009553 Bacteria 2622
143 Ga0105249_10286268 3300009553 Bacteria 1648
144 Ga0105239_10057095 3300010375 Bacteria 4281
145 Ga0105246_10008851 3300011119 Bacteria 6195
146 Ga0105246_10114572 3300011119 Bacteria 1986
147 Ga0105246_10166563 3300011119 Bacteria 1684
148 Ga0157324_1001023 3300012506 Bacteria 1453
149 Ga0157373_10082850 3300013100 Bacteria 2261
150 Ga0157370_10045810 3300013104 Bacteria 4196
151 Ga0157374_10003448 3300013296 Bacteria 13291
152 Ga0157374_10209939 3300013296 Bacteria 1909
153 Ga0157378_10362534 3300013297 Bacteria 1419
154 Ga0157378_10442550 3300013297 Bacteria 1288
155 Ga0163162_10012119 3300013306 Bacteria 8415
156 Ga0157372_10043257 3300013307 Bacteria 4986
157 Ga0157375_10001004 3300013308 Bacteria 24381
158 Ga0163163_10280380 3300014325 Bacteria 1718
159 Ga0157380_10080882 3300014326 Bacteria 2656
160 Ga0157380_10377703 3300014326 Bacteria 1336
161 Ga0157377_10004048 3300014745 Bacteria 6688
162 Ga0157379_10018331 3300014968 Bacteria 6170
163 Ga0157376_10002571 3300014969 Bacteria 12308
164 Ga0163161_10008317 3300017792 Bacteria 7184
165 Ga0213872_10089435 3300021361 Bacteria 1379
166 Ga0213876_10001582 3300021384 Bacteria 13986
167 Ga0213876_10035935 3300021384 Bacteria 2613
168 Ga0213876_10232485 3300021384 Bacteria 980
169 Ga0207666_1000228 3300025271 Bacteria 8220
170 Ga0207673_1000503 3300025290 Bacteria 4131
171 Ga0207653_10076385 3300025885 Bacteria 1153
172 Ga0207682_10000458 3300025893 Bacteria 18836
173 Ga0207692_10008086 3300025898 Bacteria 4341
174 Ga0207642_10089136 3300025899 Bacteria 1519
175 Ga0207688_10000649 3300025901 Bacteria 17177
176 Ga0207647_10074872 3300025904 Bacteria 2038
177 Ga0207699_10001512 3300025906 Bacteria 11031
178 Ga0207645_10002032 3300025907 Bacteria 16248
179 Ga0207645_10167119 3300025907 Bacteria 1441
180 Ga0207645_10233210 3300025907 Bacteria 1215
181 Ga0207643_10001494 3300025908 Bacteria 13386
182 Ga0207654_10090170 3300025911 Bacteria 1867
183 Ga0207654_10139951 3300025911 Bacteria 1542
184 Ga0207707_10020523 3300025912 Bacteria 5770
185 Ga0207707_10060921 3300025912 Bacteria 3283
186 Ga0207671_10092755 3300025914 Bacteria 2277
187 Ga0207693_10071305 3300025915 Bacteria 2719
188 Ga0207693_10197930 3300025915 Bacteria 1580
189 Ga0207663_10013762 3300025916 Bacteria 4408
190 Ga0207663_10281167 3300025916 Bacteria 1236
191 Ga0207660_10059416 3300025917 Bacteria 2745
192 Ga0207660_10326202 3300025917 Bacteria 1227
193 Ga0207657_10009414 3300025919 Bacteria 9818
194 Ga0207649_10002570 3300025920 Bacteria 10096
195 Ga0207652_10067059 3300025921 Bacteria 3111
196 Ga0207652_10076587 3300025921 Bacteria 2918
197 Ga0207652_10107832 3300025921 Bacteria 2467
198 Ga0207652_10322443 3300025921 Bacteria 1395
199 Ga0207659_10000873 3300025926 Bacteria 17919
200 Ga0207687_10021382 3300025927 Bacteria 4298
201 Ga0207700_10041908 3300025928 Bacteria 3353
202 Ga0207700_10414972 3300025928 Bacteria 1181
203 Ga0207664_10013685 3300025929 Bacteria 5833
204 Ga0207664_10070982 3300025929 Bacteria 2804
205 Ga0207644_10084293 3300025931 Bacteria 2355
206 Ga0207706_10005856 3300025933 Bacteria 11433
207 Ga0207706_10353908 3300025933 Bacteria 1277
208 Ga0207686_10016576 3300025934 Bacteria 4136
209 Ga0207709_10019240 3300025935 Bacteria 3835
210 Ga0207709_10033337 3300025935 Bacteria 3023
211 Ga0207669_10014329 3300025937 Bacteria 3970
212 Ga0207704_10041111 3300025938 Bacteria 2708
213 Ga0207665_10016327 3300025939 Bacteria 4875
214 Ga0207691_10018798 3300025940 Bacteria 6546
215 Ga0207711_10014857 3300025941 Bacteria 6469
216 Ga0207689_10002205 3300025942 Bacteria 18268
217 Ga0207661_10005396 3300025944 Bacteria 9003
218 Ga0207679_10000949 3300025945 Bacteria 18578
219 Ga0207651_10016709 3300025960 Bacteria 4309
220 Ga0207651_10173760 3300025960 Bacteria 1702
221 Ga0207712_10010967 3300025961 Bacteria 5766
222 Ga0207712_10216401 3300025961 Bacteria 1529
223 Ga0207712_10386524 3300025961 Bacteria 1173
224 Ga0207640_10023642 3300025981 Bacteria 3696
225 Ga0207658_10317992 3300025986 Bacteria 1346
226 Ga0207677_10559888 3300026023 Bacteria 998
227 Ga0207677_10603302 3300026023 Bacteria 963
228 Ga0207703_10011046 3300026035 Bacteria 7037
229 Ga0207639_10008371 3300026041 Bacteria 7090
230 Ga0207678_10002965 3300026067 Bacteria 15374
231 Ga0207678_10062778 3300026067 Bacteria 3193
232 Ga0207708_10006918 3300026075 Bacteria 8391
233 Ga0207702_10019683 3300026078 Bacteria 5588
234 Ga0207702_10145544 3300026078 Bacteria 2150
235 Ga0207641_10017611 3300026088 Bacteria 5849
236 Ga0207676_10278146 3300026095 Bacteria 1518
237 Ga0207674_10002264 3300026116 Bacteria 24389
238 Ga0207675_100027409 3300026118 Bacteria 5306
239 Ga0207683_10019250 3300026121 Bacteria 5829
240 Ga0209966_1043053 3300027695 Bacteria 945
241 Ga0209813_10003616 3300027866 Bacteria 3634
242 Ga0209813_10019033 3300027866 Bacteria 1904
243 Ga0209974_10029754 3300027876 Bacteria 1810
244 Ga0207428_10000256 3300027907 Bacteria 72918
245 Ga0268266_10038511 3300028379 Bacteria 4070
246 Ga0268264_10006266 3300028381 Bacteria 10036
247 Ga0265325_10004400 3300031241 Bacteria 8904
248 Ga0265325_10014159 3300031241 Bacteria 4516
249 Ga0265314_10032067 3300031711 Bacteria 3870
250 Ga0307416_100855189 3300032002 Bacteria 1008
251 Ga0373959_0003517 3300034820 Bacteria 2499
252 Ga0373926_0018506 3300035083 Bacteria 2397
253 Ga0373929_0011046 3300035085 Bacteria 1695
254 Ga0373944_0009576 3300035089 Bacteria 2630
255 Ga0373944_0104813 3300035089 Bacteria 959
256 Ga0373939_0006383 3300035114 Bacteria 2838
257 Ga0373943_0003365 3300035170 Bacteria 7267
258 Ga0373943_0019317 3300035170 Bacteria 3133
259 Ga0373946_0005201 3300035171 Bacteria 4691
260 Ga0373946_0038340 3300035171 Bacteria 1951
261 Ga0373955_0043721 3300035172 Bacteria 2411
262 Ga0373962_0005068 3300035242 Bacteria 3182
263 Ga0373962_0015812 3300035242 Bacteria 1939
264 Ga0373931_0000570 3300035691 Bacteria 15209
265 Ga0373931_0023118 3300035691 Bacteria 3136
266 Ga0373935_0008142 3300035692 Bacteria 6285
267 Ga0373935_0287318 3300035692 Bacteria 1159
268 Ga0373927_0016016 3300035695 Bacteria 4948
269 Ga0373947_0109140 3300035725 Bacteria 1746
270 Ga0373937_0023880 3300036401 Bacteria 5513
271 Ga0316582_0216248 3300036647 Bacteria 1310
272 Ga0373925_0010159 3300037068 Bacteria 6834
273 Ga0373925_0054942 3300037068 Bacteria 2979
274 Ga0395899_0099034 3300037312 Bacteria 2106
275 Ga0395900_0009072 3300037418 Bacteria 10196
276 Ga0395900_0014282 3300037418 Bacteria 8106
277 Ga0395898_0008034 3300037466 Bacteria 11184
278 Ga0395898_0084923 3300037466 Bacteria 3051
279 Ga0395901_0030628 3300038443 Bacteria 5544
280 Ga0395901_0068625 3300038443 Bacteria 3693
281 Ga0436365_1376240 3300039437 Bacteria 22084
282 Ga0436361_0776264 3300039447 Bacteria 2580
283 Ga0436363_1382380 3300039450 Bacteria 1602
284 Ga0436362_0882590 3300039453 Bacteria 2085
285 Ga0439443_027680 3300042003 Bacteria 922
286 Ga0439448_0021118 3300042005 Bacteria 2018
287 Ga0466966_0262177 3300044684 Bacteria 1040
288 Ga0466961_0326076 3300044693 Bacteria 936
289 Ga0466963_0264989 3300044694 Bacteria 1207
290 Ga0466957_0002311 3300044842 Bacteria 10211
291 Ga0466957_0339888 3300044842 Bacteria 1016
292 Ga0466959_0039649 3300045049 Bacteria 3481
293 Ga0466959_0249214 3300045049 Bacteria 1225
294 Ga0466958_0021725 3300045836 Bacteria 3753
295 Ga0466958_0202187 3300045836 Bacteria 1264
296 Ga0495603_0086686 3300046455 Bacteria 1832
297 Ga0495603_0088355 3300046455 Bacteria 1813
298 Ga0495638_0051270 3300046460 Bacteria 2574
299 Ga0495641_0075204 3300046461 Bacteria 1514
300 Ga0495651_0197027 3300046462 Bacteria 1413
301 Ga0495580_0067940 3300046472 Bacteria 2493
302 Ga0495582_0049208 3300046473 Bacteria 2321
303 Ga0495662_0017435 3300046476 Bacteria 3475
304 Ga0495594_0056596 3300046499 Bacteria 2164
305 Ga0495594_0115987 3300046499 Bacteria 1512
306 Ga0495637_0084613 3300046520 Bacteria 1260
307 Ga0495666_0076258 3300046526 Bacteria 1589
308 Ga0495666_0164953 3300046526 Bacteria 1026
309 Ga0495667_0057199 3300046559 Bacteria 2564
310 Ga0495588_0027282 3300046674 Bacteria 2854
311 Ga0495647_0026063 3300046681 Bacteria 2139
312 Ga0495613_0090584 3300046689 Bacteria 2215
313 Ga0495624_0011653 3300046690 Bacteria 6039
314 Ga0495680_0311986 3300047322 Bacteria 1102
315 Ga0495593_0055087 3300047673 Bacteria 2094
316 Ga0495614_0097696 3300048089 Bacteria 1281
317 Ga0496100_0013267 3300048903 Bacteria 4746
318 Ga0496101_0009638 3300048904 Bacteria 6354
319 Ga0496102_0001249 3300048905 Bacteria 22940
320 Ga0496102_0063346 3300048905 Bacteria 3385
321 Ga0496103_0003877 3300048906 Bacteria 9100
322 Ga0496104_0002110 3300048907 Bacteria 17267
323 Ga0496105_0065871 3300048908 Bacteria 2990
324 Ga0496106_0359551 3300048909 Bacteria 1169
325 Ga0496107_0003955 3300048910 Bacteria 9970
326 Ga0496107_0051750 3300048910 Bacteria 2963
327 Ga0496107_0070233 3300048910 Bacteria 2542
328 Ga0496108_0051296 3300048911 Bacteria 3456
329 Ga0496108_0053161 3300048911 Bacteria 3396
330 Ga0496108_0160992 3300048911 Bacteria 1940
331 Ga0496109_0015864 3300048912 Bacteria 6577
332 Ga0496109_0227977 3300048912 Bacteria 1752
333 Ga0496109_0407967 3300048912 Bacteria 1284
334 Ga0496110_0135925 3300048913 Bacteria 2221
335 Ga0496111_0035547 3300048914 Bacteria 3562
336 Ga0496111_0110022 3300048914 Bacteria 2029
337 Ga0496112_0023502 3300048915 Bacteria 5890
338 Ga0496112_0028954 3300048915 Bacteria 5353
339 Ga0496114_0139076 3300048917 Bacteria 2101
340 Ga0496114_0140686 3300048917 Bacteria 2089
341 Ga0496121_0001055 3300048924 Bacteria 48857
342 Ga0496122_0032655 3300048925 Bacteria 4299
343 Ga0496123_0007961 3300048926 Bacteria 9833
344 Ga0496126_0010120 3300048929 Bacteria 9936
345 Ga0501032_0043168 3300049569 Bacteria 3055
346 Ga0501032_0155691 3300049569 Bacteria 1501
347 Ga0501033_0045978 3300049570 Bacteria 3247
348 Ga0501033_0289213 3300049570 Bacteria 1156
349 Ga0501034_0002812 3300049571 Bacteria 20356
350 Ga0501034_0010203 3300049571 Bacteria 9797
351 Ga0501034_0027823 3300049571 Bacteria 5749
352 Ga0501034_0062882 3300049571 Bacteria 3726
353 Ga0501034_0475370 3300049571 Bacteria 1165
354 Ga0501034_0540422 3300049571 Bacteria 1075
355 Ga0501036_0006158 3300049572 Bacteria 9730
356 Ga0501036_0092895 3300049572 Bacteria 2549
357 Ga0501037_0029406 3300049573 Bacteria 4059
358 Ga0501037_0071504 3300049573 Bacteria 2523
359 Ga0501037_0132671 3300049573 Bacteria 1785
360 Ga0501038_0026905 3300049574 Bacteria 5121
361 Ga0501038_0050428 3300049574 Bacteria 3595
362 Ga0501038_0250707 3300049574 Bacteria 1402
363 Ga0501039_0078276 3300049575 Bacteria 2572
364 Ga0501043_0021236 3300049579 Bacteria 5089
365 Ga0501043_0024047 3300049579 Bacteria 4780
366 Ga0501043_0072978 3300049579 Bacteria 2695
367 Ga0501046_0031985 3300049580 Bacteria 4262
368 Ga0501046_0401833 3300049580 Bacteria 989
369 Ga0501047_0003372 3300049581 Bacteria 15120
370 Ga0501047_0032291 3300049581 Bacteria 5053
371 Ga0501047_0033920 3300049581 Bacteria 4927
372 Ga0501047_0041021 3300049581 Bacteria 4473
373 Ga0501047_0300604 3300049581 Bacteria 1447
374 Ga0501048_0003146 3300049582 Bacteria 12593
375 Ga0501068_0006821 3300049584 Bacteria 6313
376 Ga0501068_0054215 3300049584 Bacteria 2429
377 Ga0501069_0026811 3300049585 Bacteria 3157
378 Ga0501069_0037772 3300049585 Bacteria 2665
379 Ga0501070_0007204 3300049586 Bacteria 9439
380 Ga0501070_0009577 3300049586 Bacteria 8182
381 Ga0501070_0143515 3300049586 Bacteria 1971
382 Ga0501073_0048221 3300049589 Bacteria 2990
383 Ga0501073_0107424 3300049589 Bacteria 1936
384 Ga0501073_0162239 3300049589 Bacteria 1548
385 Ga0501073_0297486 3300049589 Bacteria 1113
386 Ga0501074_0050526 3300049590 Bacteria 3001
387 Ga0501074_0077693 3300049590 Bacteria 2382
388 Ga0501075_0262364 3300049591 Bacteria 1317
389 Ga0501075_0363522 3300049591 Bacteria 1103
390 Ga0501076_0158566 3300049592 Bacteria 1843
391 Ga0501077_0379623 3300049593 Bacteria 903
392 Ga0501079_0163082 3300049741 Bacteria 1738
393 Ga0501079_0406694 3300049741 Bacteria 1068
394 Ga0501080_0003500 3300049742 Bacteria 13828
395 Ga0501080_0166166 3300049742 Bacteria 2036
396 Ga0501083_0024850 3300049744 Bacteria 4149
397 Ga0501083_0043291 3300049744 Bacteria 3051
398 Ga0501035_0002937 3300049822 Bacteria 16404
399 Ga0501035_0021278 3300049822 Bacteria 5962
400 Ga0501035_0055114 3300049822 Bacteria 3550
401 Ga0501044_0010393 3300049823 Bacteria 10099
402 Ga0501044_0017066 3300049823 Bacteria 7790
403 Ga0501044_0024596 3300049823 Bacteria 6390
404 Ga0501044_0066114 3300049823 Bacteria 3687
405 nmdc:mga03n38_19823_c1 3300050490 Bacteria 2679
406 nmdc:mga06z11_28413_c1 3300050494 Bacteria 2683
407 nmdc:mga04h51_1735_c1 3300050495 Bacteria 5100
408 nmdc:mga07m45_52058_c1 3300050496 Bacteria 2311
409 nmdc:mga05p37_630702_c1 3300050507 Bacteria 1204
410 nmdc:mga05p37_96430_c1 3300050507 Bacteria 3644
411 nmdc:mga0qj67_40_c1 3300050509 Bacteria 90213
412 nmdc:mga0qj67_72257_c1 3300050509 Bacteria 2754
413 nmdc:mga08y16_33653_c1 3300050511 Bacteria 5382
414 nmdc:mga0n895_233466_c1 3300050512 Bacteria 1867
415 nmdc:mga0n895_30186_c1 3300050512 Bacteria 5178
416 nmdc:mga0rr50_150094_c1 3300050513 Bacteria 1882
417 nmdc:mga08x19_193551_c1 3300050514 Bacteria 1392
418 nmdc:mga0a205_102928_c1 3300050515 Bacteria 2754
419 Ga0495601_0062277 3300053077 Bacteria 2369
420 Ga0495612_0108423 3300053078 Bacteria 1187
421 Ga0495595_0046175 3300053084 Bacteria 2005
422 Ga0495619_0001727 3300053085 Bacteria 14507
423 Ga0495619_0010927 3300053085 Bacteria 5713
424 Ga0500643_003844 3300053087 Bacteria 6991
425 Ga0500644_0000423 3300053088 Bacteria 19851
426 Ga0500651_0012804 3300053093 Bacteria 5092
427 Ga0500556_0000009 3300053104 Bacteria 288111
428 Ga0500595_000016 3300053119 Bacteria 211397
429 Ga0500597_052666 3300053120 Bacteria 1737
430 Ga0500652_122336 3300053131 Bacteria 1087
431 Ga0500616_0000006 3300053153 Bacteria 944738
432 Ga0500645_015988 3300053730 Bacteria 2371
433 Ga0501082_0240653 3300060353 Bacteria 1575
434 Ga0466962_0132022 3300061719 Bacteria 1207
435 2919456116 2919450847 Bacteria 5631160
436 8001849509 8001845381 Bacteria 5804942
437 Ga0070696_100109909
438 ARcpr5oldR_c004807
439 ARSoilOldRDRAFT_c000677
440 ARCol0yngRDRAFT_1000797
441 JGI24752J21851_1007707
442 JGI24746J21847_1011131
443 JGI24739J22299_10051257
444 JGI24737J22298_10005171
445 JGI24737J22298_10012886
446 JGI24750J21931_1007237
447 JGI24745J21846_1004839
448 JGI24738J21930_10002162
449 JGI24738J21930_10002843
450 JGI24749J21850_1010946
451 JGI24035J26624_1000649
452 JGI24742J22300_10009815
453 JGI24751J29686_10009592
454 Ga0065712_10274265
455 Ga0065715_10089811
456 Ga0070676_10000815
457 Ga0070683_100063206
458 Ga0070690_100008506
459 Ga0070690_100081235
460 Ga0068869_100003878
461 Ga0070666_10035734
462 Ga0070680_100024778
463 Ga0070682_100007443
464 Ga0070682_100052004
465 Ga0068868_100002152
466 Ga0070660_100006535
467 Ga0070691_10017100
468 Ga0070661_100004456
469 Ga0070661_100442092
470 Ga0070692_10002286
471 Ga0070668_100010034
472 Ga0070668_100184364
473 Ga0070675_100025947
474 Ga0070671_100007679
475 Ga0070674_100022804
476 Ga0070673_100078780
477 Ga0070688_100001118
478 Ga0070688_100297371
479 Ga0070688_100415687
480 Ga0070659_100001585
481 Ga0070659_100019303
482 Ga0070667_100011021
483 Ga0070709_10016133
484 Ga0070714_100072344
485 Ga0070714_100076665
486 Ga0070713_100038607
487 Ga0070713_100283077
488 Ga0070710_10019305
489 Ga0070711_100004033
490 Ga0070705_100004294
491 Ga0070694_100003318
492 Ga0070694_100103789
493 Ga0070663_100013533
494 Ga0070663_100020258
495 Ga0070663_100226687
496 Ga0070678_100082143
497 Ga0070681_10008398
498 Ga0070681_10056887
499 Ga0070681_10136223
500 Ga0070698_100165590
501 Ga0070698_100554068
502 Ga0070699_100002213
503 Ga0070679_100007296
504 Ga0070679_100120912
505 Ga0070684_100004511
506 Ga0068853_100015719
507 Ga0068853_100122156
508 Ga0068853_100363480
509 Ga0070672_100001360
510 Ga0070686_100003025
511 Ga0070695_100028434
512 Ga0070695_100064400
513 Ga0070696_100030574
514 Ga0070696_100114059
515 Ga0070693_100011627
516 Ga0070693_100045377
517 Ga0070665_100399693
518 Ga0070665_100770964
519 Ga0070704_100001466
520 Ga0070704_100078077
521 Ga0068855_100054285
522 Ga0070664_100020979
523 Ga0070664_100211163
524 Ga0068857_100005536
525 Ga0068854_100002249
526 Ga0068856_100010337
527 Ga0068859_100011396
528 Ga0068864_100003267
529 Ga0068866_10005568
530 Ga0068861_100000864
531 Ga0068863_100004580
532 Ga0068858_100023582
533 Ga0068860_100029880
534 Ga0068860_100076187
535 Ga0068862_100084756
536 Ga0081455_10011460
537 Ga0081455_10021313
538 Ga0081455_10064361
539 Ga0081540_1007780
540 Ga0070717_10132295
541 Ga0070717_10237362
542 Ga0075365_10095909
543 Ga0075368_10004155
544 Ga0075364_10122952
545 Ga0075364_10152939
546 Ga0070715_10019056
547 Ga0070716_100014610
548 Ga0070716_100104890
549 Ga0070712_100077826
550 Ga0075369_10166439
551 Ga0097621_100001680
552 Ga0075370_10007876
553 Ga0068871_100001520
554 Ga0075430_100000020
555 Ga0075431_100401610
556 Ga0075433_10012818
557 Ga0075434_100024676
558 Ga0075429_100130338
559 Ga0068865_100189388
560 Ga0075436_100199246
561 Ga0075436_100306042
562 Ga0097620_100011397
563 Ga0111539_10005194
564 Ga0111539_10079742
565 Ga0111539_10187630
566 Ga0105245_10013663
567 Ga0114129_10119473
568 Ga0114129_10289392
569 Ga0114129_10782478
570 Ga0105243_10014592
571 Ga0105241_10110940
572 Ga0105241_10245486
573 Ga0105242_10044279
574 Ga0105242_10247769
575 Ga0105248_10026506
576 Ga0105237_10220327
577 Ga0105249_10018114
578 Ga0105249_10108423
579 Ga0105249_10286268
580 Ga0105239_10057095
581 Ga0105246_10008851
582 Ga0105246_10114572
583 Ga0105246_10166563
584 Ga0157324_1001023
585 Ga0157373_10082850
586 Ga0157370_10045810
587 Ga0157374_10003448
588 Ga0157374_10209939
589 Ga0157378_10362534
590 Ga0157378_10442550
591 Ga0163162_10012119
592 Ga0157372_10043257
593 Ga0157375_10001004
594 Ga0163163_10280380
595 Ga0157380_10080882
596 Ga0157380_10377703
597 Ga0157377_10004048
598 Ga0157379_10018331
599 Ga0157376_10002571
600 Ga0163161_10008317
601 Ga0213872_10089435
602 Ga0213876_10001582
603 Ga0213876_10035935
604 Ga0213876_10232485
605 Ga0207666_1000228
606 Ga0207673_1000503
607 Ga0207653_10076385
608 Ga0207682_10000458
609 Ga0207692_10008086
610 Ga0207642_10089136
611 Ga0207688_10000649
612 Ga0207647_10074872
613 Ga0207699_10001512
614 Ga0207645_10002032
615 Ga0207645_10167119
616 Ga0207645_10233210
617 Ga0207643_10001494
618 Ga0207654_10090170
619 Ga0207654_10139951
620 Ga0207707_10020523
621 Ga0207707_10060921
622 Ga0207671_10092755
623 Ga0207693_10071305
624 Ga0207693_10197930
625 Ga0207663_10013762
626 Ga0207663_10281167
627 Ga0207660_10059416
628 Ga0207660_10326202
629 Ga0207657_10009414
630 Ga0207649_10002570
631 Ga0207652_10067059
632 Ga0207652_10076587
633 Ga0207652_10107832
634 Ga0207652_10322443
635 Ga0207659_10000873
636 Ga0207687_10021382
637 Ga0207700_10041908
638 Ga0207700_10414972
639 Ga0207664_10013685
640 Ga0207664_10070982
641 Ga0207644_10084293
642 Ga0207706_10005856
643 Ga0207706_10353908
644 Ga0207686_10016576
645 Ga0207709_10019240
646 Ga0207709_10033337
647 Ga0207669_10014329
648 Ga0207704_10041111
649 Ga0207665_10016327
650 Ga0207691_10018798
651 Ga0207711_10014857
652 Ga0207689_10002205
653 Ga0207661_10005396
654 Ga0207679_10000949
655 Ga0207651_10016709
656 Ga0207651_10173760
657 Ga0207712_10010967
658 Ga0207712_10216401
659 Ga0207712_10386524
660 Ga0207640_10023642
661 Ga0207658_10317992
662 Ga0207677_10559888
663 Ga0207677_10603302
664 Ga0207703_10011046
665 Ga0207639_10008371
666 Ga0207678_10002965
667 Ga0207678_10062778
668 Ga0207708_10006918
669 Ga0207702_10019683
670 Ga0207702_10145544
671 Ga0207641_10017611
672 Ga0207676_10278146
673 Ga0207674_10002264
674 Ga0207675_100027409
675 Ga0207683_10019250
676 Ga0209966_1043053
677 Ga0209813_10003616
678 Ga0209813_10019033
679 Ga0209974_10029754
680 Ga0207428_10000256
681 Ga0268266_10038511
682 Ga0268264_10006266
683 Ga0265325_10004400
684 Ga0265325_10014159
685 Ga0265314_10032067
686 Ga0307416_100855189
687 Ga0373959_0003517
688 Ga0373926_0018506
689 Ga0373929_0011046
690 Ga0373944_0009576
691 Ga0373944_0104813
692 Ga0373939_0006383
693 Ga0373943_0003365
694 Ga0373943_0019317
695 Ga0373946_0005201
696 Ga0373946_0038340
697 Ga0373955_0043721
698 Ga0373962_0005068
699 Ga0373962_0015812
700 Ga0373931_0000570
701 Ga0373931_0023118
702 Ga0373935_0008142
703 Ga0373935_0287318
704 Ga0373927_0016016
705 Ga0373947_0109140
706 Ga0373937_0023880
707 Ga0316582_0216248
708 Ga0373925_0010159
709 Ga0373925_0054942
710 Ga0395899_0099034
711 Ga0395900_0009072
712 Ga0395900_0014282
713 Ga0395898_0008034
714 Ga0395898_0084923
715 Ga0395901_0030628
716 Ga0395901_0068625
717 Ga0436365_1376240
718 Ga0436361_0776264
719 Ga0436363_1382380
720 Ga0436362_0882590
721 Ga0439443_027680
722 Ga0439448_0021118
723 Ga0466966_0262177
724 Ga0466961_0326076
725 Ga0466963_0264989
726 Ga0466957_0002311
727 Ga0466957_0339888
728 Ga0466959_0039649
729 Ga0466959_0249214
730 Ga0466958_0021725
731 Ga0466958_0202187
732 Ga0495603_0086686
733 Ga0495603_0088355
734 Ga0495638_0051270
735 Ga0495641_0075204
736 Ga0495651_0197027
737 Ga0495580_0067940
738 Ga0495582_0049208
739 Ga0495662_0017435
740 Ga0495594_0056596
741 Ga0495594_0115987
742 Ga0495637_0084613
743 Ga0495666_0076258
744 Ga0495666_0164953
745 Ga0495667_0057199
746 Ga0495588_0027282
747 Ga0495647_0026063
748 Ga0495613_0090584
749 Ga0495624_0011653
750 Ga0495680_0311986
751 Ga0495593_0055087
752 Ga0495614_0097696
753 Ga0496100_0013267
754 Ga0496101_0009638
755 Ga0496102_0001249
756 Ga0496102_0063346
757 Ga0496103_0003877
758 Ga0496104_0002110
759 Ga0496105_0065871
760 Ga0496106_0359551
761 Ga0496107_0003955
762 Ga0496107_0051750
763 Ga0496107_0070233
764 Ga0496108_0051296
765 Ga0496108_0053161
766 Ga0496108_0160992
767 Ga0496109_0015864
768 Ga0496109_0227977
769 Ga0496109_0407967
770 Ga0496110_0135925
771 Ga0496111_0035547
772 Ga0496111_0110022
773 Ga0496112_0023502
774 Ga0496112_0028954
775 Ga0496114_0139076
776 Ga0496114_0140686
777 Ga0496121_0001055
778 Ga0496122_0032655
779 Ga0496123_0007961
780 Ga0496126_0010120
781 Ga0501032_0043168
782 Ga0501032_0155691
783 Ga0501033_0045978
784 Ga0501033_0289213
785 Ga0501034_0002812
786 Ga0501034_0010203
787 Ga0501034_0027823
788 Ga0501034_0062882
789 Ga0501034_0475370
790 Ga0501034_0540422
791 Ga0501036_0006158
792 Ga0501036_0092895
793 Ga0501037_0029406
794 Ga0501037_0071504
795 Ga0501037_0132671
796 Ga0501038_0026905
797 Ga0501038_0050428
798 Ga0501038_0250707
799 Ga0501039_0078276
800 Ga0501043_0021236
801 Ga0501043_0024047
802 Ga0501043_0072978
803 Ga0501046_0031985
804 Ga0501046_0401833
805 Ga0501047_0003372
806 Ga0501047_0032291
807 Ga0501047_0033920
808 Ga0501047_0041021
809 Ga0501047_0300604
810 Ga0501048_0003146
811 Ga0501068_0006821
812 Ga0501068_0054215
813 Ga0501069_0026811
814 Ga0501069_0037772
815 Ga0501070_0007204
816 Ga0501070_0009577
817 Ga0501070_0143515
818 Ga0501073_0048221
819 Ga0501073_0107424
820 Ga0501073_0162239
821 Ga0501073_0297486
822 Ga0501074_0050526
823 Ga0501074_0077693
824 Ga0501075_0262364
825 Ga0501075_0363522
826 Ga0501076_0158566
827 Ga0501077_0379623
828 Ga0501079_0163082
829 Ga0501079_0406694
830 Ga0501080_0003500
831 Ga0501080_0166166
832 Ga0501083_0024850
833 Ga0501083_0043291
834 Ga0501035_0002937
835 Ga0501035_0021278
836 Ga0501035_0055114
837 Ga0501044_0010393
838 Ga0501044_0017066
839 Ga0501044_0024596
840 Ga0501044_0066114
841 nmdc:mga03n38_19823_c1
842 nmdc:mga06z11_28413_c1
843 nmdc:mga04h51_1735_c1
844 nmdc:mga07m45_52058_c1
845 nmdc:mga05p37_630702_c1
846 nmdc:mga05p37_96430_c1
847 nmdc:mga0qj67_40_c1
848 nmdc:mga0qj67_72257_c1
849 nmdc:mga08y16_33653_c1
850 nmdc:mga0n895_233466_c1
851 nmdc:mga0n895_30186_c1
852 nmdc:mga0rr50_150094_c1
853 nmdc:mga08x19_193551_c1
854 nmdc:mga0a205_102928_c1
855 Ga0495601_0062277
856 Ga0495612_0108423
857 Ga0495595_0046175
858 Ga0495619_0001727
859 Ga0495619_0010927
860 Ga0500643_003844
861 Ga0500644_0000423
862 Ga0500651_0012804
863 Ga0500556_0000009
864 Ga0500595_000016
865 Ga0500597_052666
866 Ga0500652_122336
867 Ga0500616_0000006
868 Ga0500645_015988
869 Ga0501082_0240653
870 Ga0466962_0132022
871 2919456116
872 8001849509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

165

306

0.97

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

83

156

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8963 109 267
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8561 109 267
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.8427 34 264
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.8401 121 266
1v2x-assembly1.cif.gz_A-2 trmh 0.8298 113 266
ID Description Score Start End Superfamily
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9126 119 266 3.40.1280.10
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.888 121 262 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8819 113 264 3.40.1280.10
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8738 107 266 3.40.1280.10
af_Q8W497_402_589_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8701 119 270 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A356FWP9-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9249 97 267 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7W1KAL1-F1-model_v4 RNA methyltransferase 0.9247 163 270 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A533J5Y6-F1-model_v4 deleted 0.9239 148 268
AF-A0A218PQY8-F1-model_v4 Putative rRNA methylase putative 23S rRNA (Guanosine-2'-O-)-methyltransferase rlmB-like (EC 2.1.1.-) 0.9217 61 265 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A1W9TV33-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9197 168 266 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Map