F443545

General Info

Members Datasets Scaffolds Average Seq Length
436 200 872 120

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10012395|Ga0157370_100123957
Length 142
Sequence MEDFICYYEKVVDLRKLRNYMEKLTTQEEEAMQAIWKVGEGNVKLFLEHMEEGQKPPYTTLASTIKNLEKKGFLSSRLIGNSYLYKALITEDEYKKKFMNGFVKDYFADSYKELVNFFVEEKKLSAKELKEIIRLIEKSSDS

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
154 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
181 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
187 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
188 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
189 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
198 2738541278 Niastella sp. CF465 Isolate Unclassified
199 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
200 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 0
Rhizoplane 2.06
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 16.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10012395 3300013104 Bacteria 8841
2 JGI24743J22301_10031802 3300001991 Bacteria 1040
3 JGI24744J21845_10042698 3300002077 Bacteria 846
4 JGI24744J21845_10092482 3300002077 Bacteria 555
5 rootH1_10056233 3300003316 Bacteria 3496
6 rootH2_10013092 3300003320 Bacteria 17374
7 rootH2_10030903 3300003320 Bacteria 10740
8 Ga0065704_10084115 3300005289 Bacteria 3376
9 Ga0065704_10214483 3300005289 Bacteria 1096
10 Ga0065704_10480676 3300005289 Bacteria 682
11 Ga0065712_10188558 3300005290 Bacteria 1115
12 Ga0070676_10019345 3300005328 Bacteria 3787
13 Ga0070676_10099168 3300005328 Bacteria 1797
14 Ga0070676_10242524 3300005328 Bacteria 1199
15 Ga0070683_101293591 3300005329 Bacteria 701
16 Ga0070690_100011785 3300005330 Bacteria 5127
17 Ga0070690_100070942 3300005330 Bacteria 2263
18 Ga0070690_100104626 3300005330 Bacteria 1880
19 Ga0070690_100106517 3300005330 Unclassified 1865
20 Ga0070690_100944238 3300005330 Unclassified 677
21 Ga0068869_100038483 3300005334 Bacteria 3410
22 Ga0068869_100154504 3300005334 Bacteria 1782
23 Ga0068869_101137777 3300005334 Bacteria 684
24 Ga0070666_10029043 3300005335 Bacteria 3633
25 Ga0070666_10127547 3300005335 Bacteria 1766
26 Ga0070666_10283069 3300005335 Bacteria 1179
27 Ga0070682_100023635 3300005337 Unclassified 3651
28 Ga0068868_100006906 3300005338 Bacteria 8065
29 Ga0068868_100026993 3300005338 Bacteria 4378
30 Ga0068868_100356901 3300005338 Bacteria 1253
31 Ga0068868_101501839 3300005338 Bacteria 631
32 Ga0070660_100167923 3300005339 Unclassified 1771
33 Ga0070689_100250293 3300005340 Bacteria 1462
34 Ga0070691_10336716 3300005341 Bacteria 834
35 Ga0070661_100013822 3300005344 Bacteria 5673
36 Ga0070661_100111172 3300005344 Bacteria 2046
37 Ga0070661_100348669 3300005344 Bacteria 1161
38 Ga0070669_101452622 3300005353 Bacteria 596
39 Ga0070675_100099384 3300005354 Bacteria 2449
40 Ga0070671_100028739 3300005355 Bacteria 4581
41 Ga0070671_100365573 3300005355 Bacteria 1232
42 Ga0070671_100603607 3300005355 Bacteria 948
43 Ga0070674_100083382 3300005356 Bacteria 2289
44 Ga0070673_100354932 3300005364 Bacteria 1302
45 Ga0070673_100456061 3300005364 Bacteria 1151
46 Ga0070659_100015242 3300005366 Bacteria 5753
47 Ga0070659_100623803 3300005366 Bacteria 928
48 Ga0070659_100954699 3300005366 Unclassified 751
49 Ga0070667_100100950 3300005367 Bacteria 2492
50 Ga0070667_100688539 3300005367 Bacteria 945
51 Ga0070667_100950643 3300005367 Bacteria 801
52 Ga0070667_101516456 3300005367 Unclassified 630
53 Ga0070701_10014604 3300005438 Bacteria 3605
54 Ga0070700_100925283 3300005441 Bacteria 712
55 Ga0070663_100381321 3300005455 Bacteria 1148
56 Ga0070678_100037333 3300005456 Bacteria 3411
57 Ga0070678_100554481 3300005456 Bacteria 1021
58 Ga0070662_100032407 3300005457 Unclassified 3673
59 Ga0070662_100036535 3300005457 Bacteria 3475
60 Ga0070662_100068449 3300005457 Bacteria 2610
61 Ga0070662_100574207 3300005457 Bacteria 947
62 Ga0070681_10053197 3300005458 Bacteria 4035
63 Ga0068867_100167806 3300005459 Bacteria 1736
64 Ga0068867_100279463 3300005459 Bacteria 1369
65 Ga0070684_100000646 3300005535 Bacteria 23997
66 Ga0070684_100000788 3300005535 Bacteria 22000
67 Ga0070684_100557443 3300005535 Bacteria 1064
68 Ga0068853_100000536 3300005539 Bacteria 25818
69 Ga0068853_100103238 3300005539 Bacteria 2523
70 Ga0070672_100202652 3300005543 Bacteria 1660
71 Ga0070672_101125637 3300005543 Bacteria 698
72 Ga0070686_100012657 3300005544 Bacteria 4811
73 Ga0070686_100127950 3300005544 Bacteria 1753
74 Ga0070665_100277677 3300005548 Unclassified 1677
75 Ga0070665_100756874 3300005548 Bacteria 984
76 Ga0068855_100002469 3300005563 Bacteria 22826
77 Ga0068855_100040220 3300005563 Bacteria 5549
78 Ga0068855_100101910 3300005563 Bacteria 3304
79 Ga0068855_102180780 3300005563 Unclassified 556
80 Ga0070664_100002903 3300005564 Bacteria 13870
81 Ga0070664_100020534 3300005564 Bacteria 5440
82 Ga0070664_100504035 3300005564 Bacteria 1116
83 Ga0068857_100000647 3300005577 Bacteria 25630
84 Ga0068857_100015121 3300005577 Bacteria 6737
85 Ga0068857_100042210 3300005577 Unclassified 4045
86 Ga0068857_101199081 3300005577 Unclassified 735
87 Ga0068854_100008737 3300005578 Bacteria 6521
88 Ga0068854_100016949 3300005578 Unclassified 4867
89 Ga0068854_100063142 3300005578 Bacteria 2688
90 Ga0068854_100063591 3300005578 Bacteria 2679
91 Ga0068854_101358529 3300005578 Bacteria 641
92 Ga0068856_100039135 3300005614 Bacteria 4656
93 Ga0068856_100066253 3300005614 Bacteria 3569
94 Ga0068856_100138879 3300005614 Bacteria 2437
95 Ga0070702_100005065 3300005615 Bacteria 6092
96 Ga0068852_100147659 3300005616 Bacteria 2183
97 Ga0068852_100925001 3300005616 Bacteria 890
98 Ga0068852_100978737 3300005616 Bacteria 864
99 Ga0068852_101075984 3300005616 Bacteria 824
100 Ga0068859_100169725 3300005617 Bacteria 2262
101 Ga0068859_100217928 3300005617 Bacteria 1996
102 Ga0068859_100220511 3300005617 Bacteria 1984
103 Ga0068859_100270098 3300005617 Bacteria 1793
104 Ga0068859_100384763 3300005617 Bacteria 1498
105 Ga0068859_100683291 3300005617 Bacteria 1118
106 Ga0068859_102816493 3300005617 Unclassified 533
107 Ga0068864_100425017 3300005618 Bacteria 1267
108 Ga0068866_10009820 3300005718 Bacteria 4080
109 Ga0068861_101378364 3300005719 Bacteria 688
110 Ga0068851_10118750 3300005834 Bacteria 1419
111 Ga0068851_10488339 3300005834 Unclassified 737
112 Ga0068851_11000394 3300005834 Bacteria 527
113 Ga0068851_11000510 3300005834 Bacteria 527
114 Ga0068870_10134429 3300005840 Bacteria 1440
115 Ga0068863_100253532 3300005841 Bacteria 1700
116 Ga0068863_100357110 3300005841 Bacteria 1424
117 Ga0068863_100387845 3300005841 Bacteria 1365
118 Ga0068858_100178093 3300005842 Bacteria 2006
119 Ga0068860_100026228 3300005843 Bacteria 5618
120 Ga0068862_100804320 3300005844 Bacteria 918
121 Ga0068862_102101601 3300005844 Unclassified 576
122 Ga0081540_1006219 3300005983 Bacteria 8750
123 Ga0070715_10049112 3300006163 Bacteria 1807
124 Ga0097621_100376155 3300006237 Bacteria 1268
125 Ga0097621_100512278 3300006237 Bacteria 1088
126 Ga0097621_100557118 3300006237 Bacteria 1044
127 Ga0097621_100748419 3300006237 Bacteria 902
128 Ga0068871_100252955 3300006358 Bacteria 1535
129 Ga0068871_100423841 3300006358 Bacteria 1189
130 Ga0068871_102393346 3300006358 Bacteria 504
131 Ga0097620_100169718 3300006931 Bacteria 2262
132 Ga0097620_100217936 3300006931 Bacteria 1996
133 Ga0097620_100220500 3300006931 Bacteria 1984
134 Ga0097620_100270098 3300006931 Bacteria 1793
135 Ga0097620_100384753 3300006931 Bacteria 1498
136 Ga0097620_100683215 3300006931 Bacteria 1118
137 Ga0097620_102816546 3300006931 Unclassified 533
138 Ga0105240_10000716 3300009093 Bacteria 60717
139 Ga0105240_10001832 3300009093 Bacteria 35593
140 Ga0105240_10004490 3300009093 Bacteria 21219
141 Ga0105240_10084143 3300009093 Bacteria 3901
142 Ga0105240_10204294 3300009093 Bacteria 2313
143 Ga0105240_10512365 3300009093 Bacteria 1332
144 Ga0105240_11383164 3300009093 Unclassified 740
145 Ga0105240_12437991 3300009093 Bacteria 541
146 Ga0111539_10442001 3300009094 Bacteria 1514
147 Ga0105247_10488224 3300009101 Bacteria 895
148 Ga0105241_10007888 3300009174 Bacteria 7825
149 Ga0105241_10020766 3300009174 Bacteria 4854
150 Ga0105241_10271556 3300009174 Unclassified 1445
151 Ga0105241_10783788 3300009174 Unclassified 877
152 Ga0105242_10083506 3300009176 Bacteria 2675
153 Ga0105242_10543114 3300009176 Bacteria 1113
154 Ga0105242_10576525 3300009176 Bacteria 1083
155 Ga0105237_10001524 3300009545 Bacteria 30382
156 Ga0105237_10009792 3300009545 Bacteria 10247
157 Ga0105237_10027490 3300009545 Bacteria 5807
158 Ga0105237_10028791 3300009545 Bacteria 5653
159 Ga0105237_10030371 3300009545 Bacteria 5489
160 Ga0105237_10031358 3300009545 Bacteria 5391
161 Ga0105237_11058534 3300009545 Unclassified 818
162 Ga0105237_12227713 3300009545 Unclassified 557
163 Ga0105238_10004822 3300009551 Bacteria 13344
164 Ga0105238_10202944 3300009551 Bacteria 1959
165 Ga0105238_10258904 3300009551 Unclassified 1719
166 Ga0105249_10535052 3300009553 Bacteria 1221
167 Ga0105249_12883440 3300009553 Bacteria 552
168 Ga0105239_10000457 3300010375 Bacteria 59635
169 Ga0105239_10009537 3300010375 Bacteria 10924
170 Ga0105239_10015212 3300010375 Bacteria 8527
171 Ga0105239_10151804 3300010375 Bacteria 2585
172 Ga0105239_10166271 3300010375 Bacteria 2467
173 Ga0105239_10359093 3300010375 Unclassified 1645
174 Ga0105239_10440828 3300010375 Bacteria 1477
175 Ga0105239_10664895 3300010375 Bacteria 1190
176 Ga0157373_10086363 3300013100 Bacteria 2211
177 Ga0157373_10203020 3300013100 Bacteria 1398
178 Ga0157373_10335431 3300013100 Bacteria 1077
179 Ga0157373_10923019 3300013100 Unclassified 648
180 Ga0157371_10118960 3300013102 Bacteria 1878
181 Ga0157371_10168882 3300013102 Bacteria 1563
182 Ga0157371_10533390 3300013102 Bacteria 869
183 Ga0157370_10013052 3300013104 Bacteria 8579
184 Ga0157369_10033804 3300013105 Bacteria 5616
185 Ga0157369_10122987 3300013105 Bacteria 2752
186 Ga0157374_10000007 3300013296 Bacteria 595643
187 Ga0157374_10102686 3300013296 Bacteria 2743
188 Ga0157374_10218701 3300013296 Bacteria 1869
189 Ga0157374_11139549 3300013296 Unclassified 801
190 Ga0157378_10002479 3300013297 Bacteria 16428
191 Ga0157378_10144982 3300013297 Bacteria 2208
192 Ga0157378_10253504 3300013297 Bacteria 1686
193 Ga0157378_12356728 3300013297 Bacteria 584
194 Ga0163162_10000934 3300013306 Bacteria 27147
195 Ga0163162_10057498 3300013306 Bacteria 3918
196 Ga0163162_10107044 3300013306 Bacteria 2891
197 Ga0163162_10293823 3300013306 Bacteria 1756
198 Ga0163162_10415548 3300013306 Bacteria 1477
199 Ga0157372_10001489 3300013307 Bacteria 25446
200 Ga0157372_10042382 3300013307 Bacteria 5035
201 Ga0157372_10056857 3300013307 Bacteria 4372
202 Ga0157372_10141420 3300013307 Bacteria 2772
203 Ga0157372_10181865 3300013307 Bacteria 2434
204 Ga0157372_10218374 3300013307 Bacteria 2210
205 Ga0157372_10805678 3300013307 Bacteria 1091
206 Ga0157372_11407455 3300013307 Bacteria 804
207 Ga0157375_10161805 3300013308 Bacteria 2380
208 Ga0157375_10314613 3300013308 Bacteria 1730
209 Ga0157375_10641645 3300013308 Bacteria 1219
210 Ga0163163_10596795 3300014325 Bacteria 1167
211 Ga0163163_10695140 3300014325 Bacteria 1080
212 Ga0163163_12845347 3300014325 Bacteria 540
213 Ga0157380_10641452 3300014326 Unclassified 1058
214 Ga0157380_10791470 3300014326 Bacteria 964
215 Ga0157377_10991956 3300014745 Unclassified 635
216 Ga0157379_10040117 3300014968 Bacteria 4177
217 Ga0157379_10064023 3300014968 Bacteria 3287
218 Ga0157379_10167457 3300014968 Bacteria 1984
219 Ga0157376_10001722 3300014969 Bacteria 14550
220 Ga0157376_11944020 3300014969 Unclassified 625
221 Ga0183373_1014 3300015682 Bacteria 95909
222 Ga0163161_10075168 3300017792 Bacteria 2479
223 Ga0163161_10116226 3300017792 Bacteria 2005
224 Ga0163161_10702108 3300017792 Bacteria 842
225 Ga0209646_1000002 3300025246 Bacteria 1425781
226 Ga0207656_10432707 3300025321 Bacteria 664
227 Ga0207642_10022446 3300025899 Bacteria 2503
228 Ga0207688_10005453 3300025901 Bacteria 6914
229 Ga0207680_10011236 3300025903 Bacteria 4517
230 Ga0207680_10161397 3300025903 Bacteria 1503
231 Ga0207680_10331734 3300025903 Bacteria 1065
232 Ga0207680_10334897 3300025903 Bacteria 1061
233 Ga0207647_10028029 3300025904 Bacteria 3665
234 Ga0207647_10394658 3300025904 Unclassified 780
235 Ga0207685_10151415 3300025905 Bacteria 1050
236 Ga0207645_10009798 3300025907 Bacteria 6608
237 Ga0207645_10020704 3300025907 Bacteria 4300
238 Ga0207645_10226293 3300025907 Bacteria 1234
239 Ga0207645_10244869 3300025907 Bacteria 1185
240 Ga0207654_10046596 3300025911 Bacteria 2473
241 Ga0207654_10413723 3300025911 Bacteria 940
242 Ga0207695_10000130 3300025913 Bacteria 224214
243 Ga0207695_10000862 3300025913 Bacteria 55457
244 Ga0207695_10025833 3300025913 Bacteria 6566
245 Ga0207695_10218702 3300025913 Bacteria 1813
246 Ga0207695_10613718 3300025913 Bacteria 969
247 Ga0207671_10001240 3300025914 Bacteria 30129
248 Ga0207671_10010738 3300025914 Bacteria 7526
249 Ga0207671_10015129 3300025914 Bacteria 6062
250 Ga0207671_10016076 3300025914 Bacteria 5830
251 Ga0207671_10017297 3300025914 Bacteria 5563
252 Ga0207671_10052779 3300025914 Bacteria 3013
253 Ga0207657_10084815 3300025919 Bacteria 2654
254 Ga0207657_10560333 3300025919 Bacteria 893
255 Ga0207649_10033917 3300025920 Bacteria 3054
256 Ga0207649_10366539 3300025920 Unclassified 1070
257 Ga0207649_10531981 3300025920 Bacteria 897
258 Ga0207681_10111200 3300025923 Bacteria 1993
259 Ga0207694_10069104 3300025924 Bacteria 2759
260 Ga0207694_10180025 3300025924 Unclassified 1714
261 Ga0207644_10177012 3300025931 Bacteria 1669
262 Ga0207644_10304325 3300025931 Bacteria 1285
263 Ga0207644_10326112 3300025931 Bacteria 1242
264 Ga0207690_10090221 3300025932 Bacteria 2163
265 Ga0207690_10437883 3300025932 Bacteria 1048
266 Ga0207706_10037520 3300025933 Bacteria 4303
267 Ga0207706_10044944 3300025933 Bacteria 3913
268 Ga0207706_10074696 3300025933 Unclassified 2981
269 Ga0207686_10043456 3300025934 Unclassified 2753
270 Ga0207686_10991329 3300025934 Bacteria 681
271 Ga0207670_10365542 3300025936 Bacteria 1146
272 Ga0207670_11375226 3300025936 Bacteria 599
273 Ga0207669_10141833 3300025937 Bacteria 1669
274 Ga0207669_11066478 3300025937 Bacteria 681
275 Ga0207691_10012401 3300025940 Bacteria 8171
276 Ga0207691_10211114 3300025940 Bacteria 1686
277 Ga0207689_10007321 3300025942 Bacteria 9683
278 Ga0207689_10389484 3300025942 Bacteria 1161
279 Ga0207689_10811219 3300025942 Bacteria 790
280 Ga0207661_10002005 3300025944 Bacteria 14029
281 Ga0207661_10134835 3300025944 Bacteria 2119
282 Ga0207661_10187157 3300025944 Bacteria 1813
283 Ga0207679_10000938 3300025945 Bacteria 18653
284 Ga0207679_10078881 3300025945 Bacteria 2509
285 Ga0207679_10547043 3300025945 Bacteria 1038
286 Ga0207667_10000131 3300025949 Bacteria 115088
287 Ga0207667_10000915 3300025949 Bacteria 37602
288 Ga0207667_10019058 3300025949 Bacteria 7670
289 Ga0207667_10049029 3300025949 Bacteria 4463
290 Ga0207667_10099616 3300025949 Unclassified 2998
291 Ga0207667_10626235 3300025949 Unclassified 1083
292 Ga0207651_10588623 3300025960 Bacteria 971
293 Ga0207640_10068144 3300025981 Bacteria 2384
294 Ga0207640_10349153 3300025981 Bacteria 1188
295 Ga0207640_11188042 3300025981 Unclassified 678
296 Ga0207658_10091925 3300025986 Unclassified 2356
297 Ga0207658_10493332 3300025986 Bacteria 1090
298 Ga0207677_10116928 3300026023 Bacteria 1998
299 Ga0207677_10176451 3300026023 Bacteria 1676
300 Ga0207677_10920336 3300026023 Bacteria 789
301 Ga0207677_12011985 3300026023 Unclassified 537
302 Ga0207703_10593286 3300026035 Bacteria 1047
303 Ga0207703_10753467 3300026035 Bacteria 928
304 Ga0207639_10010945 3300026041 Bacteria 6291
305 Ga0207639_10168612 3300026041 Bacteria 1852
306 Ga0207639_10566200 3300026041 Bacteria 1045
307 Ga0207639_11226014 3300026041 Unclassified 704
308 Ga0207678_10059249 3300026067 Bacteria 3294
309 Ga0207708_10075829 3300026075 Bacteria 2579
310 Ga0207708_11781797 3300026075 Unclassified 540
311 Ga0207702_10037031 3300026078 Bacteria 4082
312 Ga0207702_10340320 3300026078 Bacteria 1433
313 Ga0207702_11198374 3300026078 Bacteria 753
314 Ga0207702_11341472 3300026078 Unclassified 709
315 Ga0207641_10081683 3300026088 Bacteria 2807
316 Ga0207641_10292484 3300026088 Bacteria 1536
317 Ga0207641_10404275 3300026088 Bacteria 1312
318 Ga0207641_10731417 3300026088 Unclassified 976
319 Ga0207648_10037293 3300026089 Bacteria 4281
320 Ga0207648_10100817 3300026089 Unclassified 2530
321 Ga0207648_10546892 3300026089 Bacteria 1063
322 Ga0207648_11019920 3300026089 Bacteria 775
323 Ga0207676_10841203 3300026095 Unclassified 897
324 Ga0207676_10982294 3300026095 Bacteria 831
325 Ga0207674_10001708 3300026116 Bacteria 28109
326 Ga0207674_10001751 3300026116 Bacteria 27757
327 Ga0207674_10038634 3300026116 Bacteria 4951
328 Ga0207674_11041674 3300026116 Unclassified 787
329 Ga0207675_101494259 3300026118 Bacteria 696
330 Ga0207683_10018226 3300026121 Bacteria 5988
331 Ga0207698_10208344 3300026142 Bacteria 1757
332 Ga0207698_10236538 3300026142 Bacteria 1662
333 Ga0207698_10312025 3300026142 Bacteria 1469
334 Ga0207698_10657983 3300026142 Bacteria 1038
335 Ga0207698_10906414 3300026142 Bacteria 889
336 Ga0268266_10000024 3300028379 Bacteria 490820
337 Ga0268266_10251113 3300028379 Bacteria 1636
338 Ga0268266_10287622 3300028379 Bacteria 1530
339 Ga0268266_10572037 3300028379 Bacteria 1084
340 Ga0268265_10180266 3300028380 Bacteria 1814
341 Ga0268265_10525966 3300028380 Bacteria 1119
342 Ga0268264_10000915 3300028381 Bacteria 30897
343 Ga0268264_10022145 3300028381 Bacteria 5187
344 Ga0268264_10412458 3300028381 Bacteria 1301
345 Ga0307517_10242407 3300028786 Unclassified 1068
346 Ga0307515_10096593 3300028794 Unclassified 3622
347 Ga0307511_10231996 3300030521 Bacteria 912
348 Ga0307513_10471921 3300031456 Bacteria 976
349 Ga0307513_10640644 3300031456 Bacteria 770
350 Ga0307509_10410967 3300031507 Bacteria 1057
351 Ga0307516_10002360 3300031730 Bacteria 25310
352 Ga0307516_10361946 3300031730 Bacteria 1115
353 Ga0316577_10022860 3300031733 Bacteria 3472
354 Ga0307413_11058741 3300031824 Unclassified 698
355 Ga0307415_102082043 3300032126 Unclassified 554
356 Ga0307510_10000406 3300033180 Bacteria 41007
357 Ga0373936_0502807 3300035113 Unclassified 564
358 Ga0316582_1004083 3300036647 Bacteria 570
359 Ga0439436_0014195 3300041404 Bacteria 2407
360 Ga0439439_0026465 3300041406 Unclassified 1462
361 Ga0451787_239260 3300041441 Bacteria 1315
362 Ga0451793_0182288 3300041452 Bacteria 699
363 Ga0451795_0743147 3300041456 Bacteria 566
364 Ga0451795_1065761 3300041456 Unclassified 589
365 Ga0451795_1340664 3300041456 Bacteria 785
366 Ga0451795_1404677 3300041456 Bacteria 2608
367 Ga0451807_1814411 3300041486 Bacteria 1367
368 Ga0451855_1801187 3300041511 Unclassified 575
369 Ga0439442_016659 3300042002 Unclassified 1516
370 Ga0439449_0008370 3300042007 Bacteria 3934
371 Ga0439449_0019014 3300042007 Bacteria 2576
372 Ga0439457_012657 3300042014 Bacteria 1900
373 Ga0439457_014017 3300042014 Bacteria 1797
374 Ga0439457_022467 3300042014 Unclassified 1397
375 Ga0439462_0044925 3300042015 Bacteria 1183
376 Ga0450923_062571 3300042125 Bacteria 814
377 Ga0450896_090479 3300042133 Unclassified 522
378 Ga0450898_008238 3300042134 Bacteria 1640
379 Ga0439434_0040353 3300042435 Bacteria 1433
380 Ga0466972_0009478 3300044658 Bacteria 4890
381 Ga0466965_0085505 3300044683 Unclassified 1599
382 Ga0466961_0036073 3300044693 Bacteria 3174
383 Ga0466964_0007860 3300044706 Bacteria 3994
384 Ga0466971_0013638 3300044719 Bacteria 3572
385 Ga0466970_0097582 3300044765 Bacteria 1599
386 Ga0466970_0447357 3300044765 Unclassified 740
387 Ga0466959_0084369 3300045049 Bacteria 2287
388 Ga0466958_0090929 3300045836 Unclassified 1889
389 Ga0495638_0253024 3300046460 Bacteria 970
390 Ga0495638_0306371 3300046460 Unclassified 854
391 Ga0495662_0368540 3300046476 Unclassified 706
392 Ga0495606_0010169 3300046507 Bacteria 7847
393 Ga0495648_0396654 3300046524 Bacteria 618
394 Ga0495611_0000121 3300046648 Bacteria 56074
395 Ga0495625_0108662 3300046660 Unclassified 1898
396 Ga0495625_0514681 3300046660 Unclassified 730
397 Ga0495671_0272572 3300046692 Bacteria 816
398 Ga0495649_0354443 3300046694 Unclassified 741
399 Ga0495674_0460306 3300047319 Bacteria 1021
400 Ga0495686_0000034 3300047472 Bacteria 325038
401 Ga0495686_0002885 3300047472 Bacteria 15434
402 Ga0495686_0601479 3300047472 Unclassified 569
403 Ga0496104_0765898 3300048907 Bacteria 872
404 Ga0496115_0209185 3300048918 Bacteria 1611
405 Ga0501047_0180253 3300049581 Bacteria 1979
406 Ga0501199_035408 3300049650 Unclassified 630
407 Ga0501217_084016 3300049661 Unclassified 885
408 Ga0501257_156464 3300049686 Unclassified 632
409 Ga0501225_0000628 3300049705 Bacteria 11003
410 Ga0501280_035728 3300049776 Bacteria 791
411 Ga0501044_0554867 3300049823 Bacteria 1046
412 Ga0500643_107766 3300053087 Bacteria 754
413 Ga0500644_0010017 3300053088 Bacteria 2554
414 Ga0500646_0083078 3300053090 Bacteria 980
415 Ga0500583_0000056 3300053092 Bacteria 72293
416 Ga0500583_0000583 3300053092 Bacteria 10973
417 Ga0500583_0032506 3300053092 Bacteria 2302
418 Ga0500583_0138810 3300053092 Bacteria 1207
419 Ga0500553_243462 3300053101 Bacteria 556
420 Ga0500642_0042900 3300053130 Bacteria 1963
421 Ga0500652_012198 3300053131 Bacteria 3007
422 Ga0500658_0124795 3300053134 Bacteria 1144
423 Ga0500568_0005776 3300053139 Bacteria 6331
424 Ga0500568_0022377 3300053139 Bacteria 2704
425 Ga0500588_0033556 3300053146 Bacteria 1498
426 Ga0500588_0202291 3300053146 Bacteria 736
427 Ga0500588_0262605 3300053146 Bacteria 650
428 Ga0500616_0295410 3300053153 Unclassified 675
429 Ga0500622_0003603 3300053156 Bacteria 10197
430 Ga0500622_0015226 3300053156 Bacteria 4123
431 Ga0500637_0093014 3300053178 Bacteria 1747
432 Ga0466962_0019436 3300061719 Unclassified 3265
433 2522550886 2522125168 Bacteria 7376607
434 2738727007 2738541278 Bacteria 9755573
435 2910246596 2910245624 Bacteria 6935613
436 2929923253 2929921140 Bacteria 8649150
437 Ga0157370_10012395
438 JGI24743J22301_10031802
439 JGI24744J21845_10042698
440 JGI24744J21845_10092482
441 rootH1_10056233
442 rootH2_10013092
443 rootH2_10030903
444 Ga0065704_10084115
445 Ga0065704_10214483
446 Ga0065704_10480676
447 Ga0065712_10188558
448 Ga0070676_10019345
449 Ga0070676_10099168
450 Ga0070676_10242524
451 Ga0070683_101293591
452 Ga0070690_100011785
453 Ga0070690_100070942
454 Ga0070690_100104626
455 Ga0070690_100106517
456 Ga0070690_100944238
457 Ga0068869_100038483
458 Ga0068869_100154504
459 Ga0068869_101137777
460 Ga0070666_10029043
461 Ga0070666_10127547
462 Ga0070666_10283069
463 Ga0070682_100023635
464 Ga0068868_100006906
465 Ga0068868_100026993
466 Ga0068868_100356901
467 Ga0068868_101501839
468 Ga0070660_100167923
469 Ga0070689_100250293
470 Ga0070691_10336716
471 Ga0070661_100013822
472 Ga0070661_100111172
473 Ga0070661_100348669
474 Ga0070669_101452622
475 Ga0070675_100099384
476 Ga0070671_100028739
477 Ga0070671_100365573
478 Ga0070671_100603607
479 Ga0070674_100083382
480 Ga0070673_100354932
481 Ga0070673_100456061
482 Ga0070659_100015242
483 Ga0070659_100623803
484 Ga0070659_100954699
485 Ga0070667_100100950
486 Ga0070667_100688539
487 Ga0070667_100950643
488 Ga0070667_101516456
489 Ga0070701_10014604
490 Ga0070700_100925283
491 Ga0070663_100381321
492 Ga0070678_100037333
493 Ga0070678_100554481
494 Ga0070662_100032407
495 Ga0070662_100036535
496 Ga0070662_100068449
497 Ga0070662_100574207
498 Ga0070681_10053197
499 Ga0068867_100167806
500 Ga0068867_100279463
501 Ga0070684_100000646
502 Ga0070684_100000788
503 Ga0070684_100557443
504 Ga0068853_100000536
505 Ga0068853_100103238
506 Ga0070672_100202652
507 Ga0070672_101125637
508 Ga0070686_100012657
509 Ga0070686_100127950
510 Ga0070665_100277677
511 Ga0070665_100756874
512 Ga0068855_100002469
513 Ga0068855_100040220
514 Ga0068855_100101910
515 Ga0068855_102180780
516 Ga0070664_100002903
517 Ga0070664_100020534
518 Ga0070664_100504035
519 Ga0068857_100000647
520 Ga0068857_100015121
521 Ga0068857_100042210
522 Ga0068857_101199081
523 Ga0068854_100008737
524 Ga0068854_100016949
525 Ga0068854_100063142
526 Ga0068854_100063591
527 Ga0068854_101358529
528 Ga0068856_100039135
529 Ga0068856_100066253
530 Ga0068856_100138879
531 Ga0070702_100005065
532 Ga0068852_100147659
533 Ga0068852_100925001
534 Ga0068852_100978737
535 Ga0068852_101075984
536 Ga0068859_100169725
537 Ga0068859_100217928
538 Ga0068859_100220511
539 Ga0068859_100270098
540 Ga0068859_100384763
541 Ga0068859_100683291
542 Ga0068859_102816493
543 Ga0068864_100425017
544 Ga0068866_10009820
545 Ga0068861_101378364
546 Ga0068851_10118750
547 Ga0068851_10488339
548 Ga0068851_11000394
549 Ga0068851_11000510
550 Ga0068870_10134429
551 Ga0068863_100253532
552 Ga0068863_100357110
553 Ga0068863_100387845
554 Ga0068858_100178093
555 Ga0068860_100026228
556 Ga0068862_100804320
557 Ga0068862_102101601
558 Ga0081540_1006219
559 Ga0070715_10049112
560 Ga0097621_100376155
561 Ga0097621_100512278
562 Ga0097621_100557118
563 Ga0097621_100748419
564 Ga0068871_100252955
565 Ga0068871_100423841
566 Ga0068871_102393346
567 Ga0097620_100169718
568 Ga0097620_100217936
569 Ga0097620_100220500
570 Ga0097620_100270098
571 Ga0097620_100384753
572 Ga0097620_100683215
573 Ga0097620_102816546
574 Ga0105240_10000716
575 Ga0105240_10001832
576 Ga0105240_10004490
577 Ga0105240_10084143
578 Ga0105240_10204294
579 Ga0105240_10512365
580 Ga0105240_11383164
581 Ga0105240_12437991
582 Ga0111539_10442001
583 Ga0105247_10488224
584 Ga0105241_10007888
585 Ga0105241_10020766
586 Ga0105241_10271556
587 Ga0105241_10783788
588 Ga0105242_10083506
589 Ga0105242_10543114
590 Ga0105242_10576525
591 Ga0105237_10001524
592 Ga0105237_10009792
593 Ga0105237_10027490
594 Ga0105237_10028791
595 Ga0105237_10030371
596 Ga0105237_10031358
597 Ga0105237_11058534
598 Ga0105237_12227713
599 Ga0105238_10004822
600 Ga0105238_10202944
601 Ga0105238_10258904
602 Ga0105249_10535052
603 Ga0105249_12883440
604 Ga0105239_10000457
605 Ga0105239_10009537
606 Ga0105239_10015212
607 Ga0105239_10151804
608 Ga0105239_10166271
609 Ga0105239_10359093
610 Ga0105239_10440828
611 Ga0105239_10664895
612 Ga0157373_10086363
613 Ga0157373_10203020
614 Ga0157373_10335431
615 Ga0157373_10923019
616 Ga0157371_10118960
617 Ga0157371_10168882
618 Ga0157371_10533390
619 Ga0157370_10013052
620 Ga0157369_10033804
621 Ga0157369_10122987
622 Ga0157374_10000007
623 Ga0157374_10102686
624 Ga0157374_10218701
625 Ga0157374_11139549
626 Ga0157378_10002479
627 Ga0157378_10144982
628 Ga0157378_10253504
629 Ga0157378_12356728
630 Ga0163162_10000934
631 Ga0163162_10057498
632 Ga0163162_10107044
633 Ga0163162_10293823
634 Ga0163162_10415548
635 Ga0157372_10001489
636 Ga0157372_10042382
637 Ga0157372_10056857
638 Ga0157372_10141420
639 Ga0157372_10181865
640 Ga0157372_10218374
641 Ga0157372_10805678
642 Ga0157372_11407455
643 Ga0157375_10161805
644 Ga0157375_10314613
645 Ga0157375_10641645
646 Ga0163163_10596795
647 Ga0163163_10695140
648 Ga0163163_12845347
649 Ga0157380_10641452
650 Ga0157380_10791470
651 Ga0157377_10991956
652 Ga0157379_10040117
653 Ga0157379_10064023
654 Ga0157379_10167457
655 Ga0157376_10001722
656 Ga0157376_11944020
657 Ga0183373_1014
658 Ga0163161_10075168
659 Ga0163161_10116226
660 Ga0163161_10702108
661 Ga0209646_1000002
662 Ga0207656_10432707
663 Ga0207642_10022446
664 Ga0207688_10005453
665 Ga0207680_10011236
666 Ga0207680_10161397
667 Ga0207680_10331734
668 Ga0207680_10334897
669 Ga0207647_10028029
670 Ga0207647_10394658
671 Ga0207685_10151415
672 Ga0207645_10009798
673 Ga0207645_10020704
674 Ga0207645_10226293
675 Ga0207645_10244869
676 Ga0207654_10046596
677 Ga0207654_10413723
678 Ga0207695_10000130
679 Ga0207695_10000862
680 Ga0207695_10025833
681 Ga0207695_10218702
682 Ga0207695_10613718
683 Ga0207671_10001240
684 Ga0207671_10010738
685 Ga0207671_10015129
686 Ga0207671_10016076
687 Ga0207671_10017297
688 Ga0207671_10052779
689 Ga0207657_10084815
690 Ga0207657_10560333
691 Ga0207649_10033917
692 Ga0207649_10366539
693 Ga0207649_10531981
694 Ga0207681_10111200
695 Ga0207694_10069104
696 Ga0207694_10180025
697 Ga0207644_10177012
698 Ga0207644_10304325
699 Ga0207644_10326112
700 Ga0207690_10090221
701 Ga0207690_10437883
702 Ga0207706_10037520
703 Ga0207706_10044944
704 Ga0207706_10074696
705 Ga0207686_10043456
706 Ga0207686_10991329
707 Ga0207670_10365542
708 Ga0207670_11375226
709 Ga0207669_10141833
710 Ga0207669_11066478
711 Ga0207691_10012401
712 Ga0207691_10211114
713 Ga0207689_10007321
714 Ga0207689_10389484
715 Ga0207689_10811219
716 Ga0207661_10002005
717 Ga0207661_10134835
718 Ga0207661_10187157
719 Ga0207679_10000938
720 Ga0207679_10078881
721 Ga0207679_10547043
722 Ga0207667_10000131
723 Ga0207667_10000915
724 Ga0207667_10019058
725 Ga0207667_10049029
726 Ga0207667_10099616
727 Ga0207667_10626235
728 Ga0207651_10588623
729 Ga0207640_10068144
730 Ga0207640_10349153
731 Ga0207640_11188042
732 Ga0207658_10091925
733 Ga0207658_10493332
734 Ga0207677_10116928
735 Ga0207677_10176451
736 Ga0207677_10920336
737 Ga0207677_12011985
738 Ga0207703_10593286
739 Ga0207703_10753467
740 Ga0207639_10010945
741 Ga0207639_10168612
742 Ga0207639_10566200
743 Ga0207639_11226014
744 Ga0207678_10059249
745 Ga0207708_10075829
746 Ga0207708_11781797
747 Ga0207702_10037031
748 Ga0207702_10340320
749 Ga0207702_11198374
750 Ga0207702_11341472
751 Ga0207641_10081683
752 Ga0207641_10292484
753 Ga0207641_10404275
754 Ga0207641_10731417
755 Ga0207648_10037293
756 Ga0207648_10100817
757 Ga0207648_10546892
758 Ga0207648_11019920
759 Ga0207676_10841203
760 Ga0207676_10982294
761 Ga0207674_10001708
762 Ga0207674_10001751
763 Ga0207674_10038634
764 Ga0207674_11041674
765 Ga0207675_101494259
766 Ga0207683_10018226
767 Ga0207698_10208344
768 Ga0207698_10236538
769 Ga0207698_10312025
770 Ga0207698_10657983
771 Ga0207698_10906414
772 Ga0268266_10000024
773 Ga0268266_10251113
774 Ga0268266_10287622
775 Ga0268266_10572037
776 Ga0268265_10180266
777 Ga0268265_10525966
778 Ga0268264_10000915
779 Ga0268264_10022145
780 Ga0268264_10412458
781 Ga0307517_10242407
782 Ga0307515_10096593
783 Ga0307511_10231996
784 Ga0307513_10471921
785 Ga0307513_10640644
786 Ga0307509_10410967
787 Ga0307516_10002360
788 Ga0307516_10361946
789 Ga0316577_10022860
790 Ga0307413_11058741
791 Ga0307415_102082043
792 Ga0307510_10000406
793 Ga0373936_0502807
794 Ga0316582_1004083
795 Ga0439436_0014195
796 Ga0439439_0026465
797 Ga0451787_239260
798 Ga0451793_0182288
799 Ga0451795_0743147
800 Ga0451795_1065761
801 Ga0451795_1340664
802 Ga0451795_1404677
803 Ga0451807_1814411
804 Ga0451855_1801187
805 Ga0439442_016659
806 Ga0439449_0008370
807 Ga0439449_0019014
808 Ga0439457_012657
809 Ga0439457_014017
810 Ga0439457_022467
811 Ga0439462_0044925
812 Ga0450923_062571
813 Ga0450896_090479
814 Ga0450898_008238
815 Ga0439434_0040353
816 Ga0466972_0009478
817 Ga0466965_0085505
818 Ga0466961_0036073
819 Ga0466964_0007860
820 Ga0466971_0013638
821 Ga0466970_0097582
822 Ga0466970_0447357
823 Ga0466959_0084369
824 Ga0466958_0090929
825 Ga0495638_0253024
826 Ga0495638_0306371
827 Ga0495662_0368540
828 Ga0495606_0010169
829 Ga0495648_0396654
830 Ga0495611_0000121
831 Ga0495625_0108662
832 Ga0495625_0514681
833 Ga0495671_0272572
834 Ga0495649_0354443
835 Ga0495674_0460306
836 Ga0495686_0000034
837 Ga0495686_0002885
838 Ga0495686_0601479
839 Ga0496104_0765898
840 Ga0496115_0209185
841 Ga0501047_0180253
842 Ga0501199_035408
843 Ga0501217_084016
844 Ga0501257_156464
845 Ga0501225_0000628
846 Ga0501280_035728
847 Ga0501044_0554867
848 Ga0500643_107766
849 Ga0500644_0010017
850 Ga0500646_0083078
851 Ga0500583_0000056
852 Ga0500583_0000583
853 Ga0500583_0032506
854 Ga0500583_0138810
855 Ga0500553_243462
856 Ga0500642_0042900
857 Ga0500652_012198
858 Ga0500658_0124795
859 Ga0500568_0005776
860 Ga0500568_0022377
861 Ga0500588_0033556
862 Ga0500588_0202291
863 Ga0500588_0262605
864 Ga0500616_0295410
865 Ga0500622_0003603
866 Ga0500622_0015226
867 Ga0500637_0093014
868 Ga0466962_0019436
869 2522550886
870 2738727007
871 2910246596
872 2929923253

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

24

138

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9042 2 65
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8724 7 65
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.87 8 65
3zec-assembly1.cif.gz_A fic protein from shewanella oneidensis (e73g mutant) in complex with amppnp 0.8623 10 66
5sva-assembly1.cif.gz_h mediator-rna polymerase ii pre-initiation complex 0.8557 7 63
ID Description Score Start End Superfamily
3mwmB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9054 7 68 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8991 5 65 1.10.10.10
af_Q91ZY6_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8786 7 65 1.10.10.10
af_B6TAH2_3_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8781 8 65 1.10.10.10
5boxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8754 3 66 1.10.10.10
ID Description Score Start End GO Terms
AF-D5VN90-F1-model_v4 Transcriptional repressor, CopY family 0.9217 3 66 GO:0003677
GO:0045892
AF-A0A162T783-F1-model_v4 Uncharacterized protein 0.9198 3 69
AF-A0A359G5H8-F1-model_v4 Transcriptional regulator 0.9178 2 89 GO:0003677
GO:0005737
GO:0045892
AF-A0A6L8HA91-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9077 2 69 GO:0003677
GO:0045892
AF-A0A538NYA2-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9044 1 70 GO:0003677
GO:0045892

Map