F443553

General Info

Members Datasets Scaffolds Average Seq Length
436 226 873 221

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10000147|Ga0163163_1000014716
Length 249
Sequence VLEAAISSYAAGDDRCFFLLSPLWRANSSPMKKYVAEALGTFALVFVGTGAIVINEVSGGVITHPGIALTFGLIVLAMIYTVGDISGAHLNPAVTIGFWTARRLPGSQVGSYILSQVVGAIIASGLLKLLFPHSKLLGATLPAGSELQSFVLELVLTFLLMLTILNVSTGAKEKGITAGIAVGAVIALEAMFAGPICGASMNPARSFAPALISSHLEHLWLYLIAPPLGAAAAMFACRCIREPNCCGKS

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
167 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
225 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
226 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.23
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 3.44
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 19.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10000147 3300014325 Bacteria 73154
2 JGI24035J26624_1000398 3300002126 Bacteria 4083
3 JGI25151J46595_10026839 3300003187 Bacteria 2317
4 rootH2_10001201 3300003320 Bacteria 26611
5 rootH2_10010808 3300003320 Bacteria 73638
6 rootH2_10106787 3300003320 Bacteria 9047
7 rootH2_10311952 3300003320 Unclassified 1486
8 rootH1_10020455 3300003316 Bacteria 7263
9 rootH1_10020455 3300003323 Bacteria 13860
10 rootH1_10191129 3300003323 Bacteria 8180
11 Ga0065704_10168857 3300005289 Bacteria 1304
12 Ga0065704_10231544 3300005289 Unclassified 1041
13 Ga0065712_10071040 3300005290 Bacteria 5522
14 Ga0065715_10090742 3300005293 Bacteria 6527
15 Ga0070658_10000638 3300005327 Bacteria 30268
16 Ga0070658_10402382 3300005327 Bacteria 1176
17 Ga0070658_10425122 3300005327 Unclassified 1143
18 Ga0070676_10109758 3300005328 Unclassified 1716
19 Ga0070683_100024861 3300005329 Bacteria 5371
20 Ga0070683_100439817 3300005329 Unclassified 1244
21 Ga0070670_100049990 3300005331 Bacteria 3593
22 Ga0070670_100219823 3300005331 Unclassified 1652
23 Ga0070670_100243352 3300005331 Unclassified 1566
24 Ga0070670_100249975 3300005331 Unclassified 1545
25 Ga0068869_100082668 3300005334 Bacteria 2400
26 Ga0068869_100189394 3300005334 Bacteria 1617
27 Ga0068868_100024770 3300005338 Unclassified 4555
28 Ga0068868_100036049 3300005338 Bacteria 3826
29 Ga0070660_100095622 3300005339 Unclassified 2348
30 Ga0070660_100391477 3300005339 Bacteria 1148
31 Ga0070689_100014132 3300005340 Bacteria 5793
32 Ga0070689_100016487 3300005340 Bacteria 5407
33 Ga0070689_100122656 3300005340 Bacteria 2076
34 Ga0070689_100207276 3300005340 Bacteria 1603
35 Ga0070687_100001234 3300005343 Bacteria 8875
36 Ga0070675_100023517 3300005354 Unclassified 4929
37 Ga0070675_100069337 3300005354 Bacteria 2921
38 Ga0070671_100014386 3300005355 Bacteria 6393
39 Ga0070671_100544309 3300005355 Bacteria 1001
40 Ga0070674_100197163 3300005356 Bacteria 1552
41 Ga0070673_100000522 3300005364 Bacteria 20614
42 Ga0070673_100003661 3300005364 Bacteria 9619
43 Ga0070673_100013678 3300005364 Bacteria 5624
44 Ga0070688_100004708 3300005365 Bacteria 7126
45 Ga0070688_100064086 3300005365 Unclassified 2331
46 Ga0070659_100004328 3300005366 Bacteria 10138
47 Ga0070659_100015210 3300005366 Bacteria 5758
48 Ga0070659_100386613 3300005366 Bacteria 1179
49 Ga0070667_100138289 3300005367 Unclassified 2131
50 Ga0070667_100419067 3300005367 Bacteria 1220
51 Ga0070714_100101261 3300005435 Unclassified 2538
52 Ga0070713_100927830 3300005436 Bacteria 838
53 Ga0070701_10082223 3300005438 Unclassified 1746
54 Ga0070705_100033585 3300005440 Unclassified 2861
55 Ga0070694_100014482 3300005444 Bacteria 4937
56 Ga0070708_100699554 3300005445 Unclassified 954
57 Ga0070663_100148378 3300005455 Bacteria 1796
58 Ga0070678_100001380 3300005456 Bacteria 12941
59 Ga0070678_100004497 3300005456 Bacteria 7914
60 Ga0070662_100066917 3300005457 Bacteria 2637
61 Ga0068867_100001584 3300005459 Bacteria 15824
62 Ga0070685_10037249 3300005466 Unclassified 2754
63 Ga0070685_10042231 3300005466 Bacteria 2601
64 Ga0070706_100001327 3300005467 Bacteria 26298
65 Ga0070706_100057064 3300005467 Bacteria 3602
66 Ga0070707_100270750 3300005468 Bacteria 1651
67 Ga0070707_100305952 3300005468 Bacteria 1545
68 Ga0070699_100129167 3300005518 Bacteria 2227
69 Ga0070679_100000364 3300005530 Bacteria 38564
70 Ga0070679_100540075 3300005530 Unclassified 1109
71 Ga0070684_100000223 3300005535 Bacteria 39444
72 Ga0068853_100000051 3300005539 Bacteria 86702
73 Ga0068853_100001879 3300005539 Bacteria 15464
74 Ga0068853_100034101 3300005539 Bacteria 4319
75 Ga0068853_100120837 3300005539 Bacteria 2336
76 Ga0070672_100241688 3300005543 Bacteria 1519
77 Ga0070672_100835765 3300005543 Unclassified 811
78 Ga0070665_100000034 3300005548 Bacteria 324289
79 Ga0070665_100013014 3300005548 Bacteria 8379
80 Ga0070665_100204403 3300005548 Unclassified 1975
81 Ga0070704_100360229 3300005549 Unclassified 1230
82 Ga0070704_100482024 3300005549 Bacteria 1073
83 Ga0068855_100000226 3300005563 Bacteria 72130
84 Ga0068855_100018699 3300005563 Bacteria 8332
85 Ga0070664_100065678 3300005564 Bacteria 3097
86 Ga0068857_100084226 3300005577 Bacteria 2841
87 Ga0068857_100553393 3300005577 Bacteria 1084
88 Ga0070702_100133818 3300005615 Bacteria 1570
89 Ga0068852_100000630 3300005616 Bacteria 23035
90 Ga0068852_100398113 3300005616 Bacteria 1354
91 Ga0068859_100024859 3300005617 Bacteria 6012
92 Ga0068859_100316368 3300005617 Bacteria 1655
93 Ga0068859_100378600 3300005617 Bacteria 1511
94 Ga0068866_10046605 3300005718 Bacteria 2181
95 Ga0068861_100088418 3300005719 Unclassified 2440
96 Ga0068870_10095189 3300005840 Bacteria 1672
97 Ga0068858_100121441 3300005842 Unclassified 2443
98 Ga0068860_100044707 3300005843 Unclassified 4221
99 Ga0068860_100051825 3300005843 Bacteria 3904
100 Ga0068860_100113262 3300005843 Unclassified 2594
101 Ga0068860_100253188 3300005843 Unclassified 1715
102 Ga0068860_100434699 3300005843 Bacteria 1303
103 Ga0068860_100698292 3300005843 Bacteria 1024
104 Ga0068862_100122788 3300005844 Bacteria 2291
105 Ga0075366_10259904 3300006195 Unclassified 1060
106 Ga0097621_100000343 3300006237 Bacteria 31907
107 Ga0097621_100120151 3300006237 Bacteria 2228
108 Ga0097621_100719773 3300006237 Unclassified 920
109 Ga0097621_100867155 3300006237 Unclassified 839
110 Ga0068871_100000284 3300006358 Bacteria 35264
111 Ga0068871_100167243 3300006358 Unclassified 1883
112 Ga0068871_100265367 3300006358 Bacteria 1499
113 Ga0075434_100374231 3300006871 Unclassified 1445
114 Ga0068865_100000029 3300006881 Bacteria 91199
115 Ga0068865_100042365 3300006881 Bacteria 3104
116 Ga0097620_100024859 3300006931 Bacteria 6012
117 Ga0097620_100316366 3300006931 Bacteria 1655
118 Ga0097620_100378561 3300006931 Bacteria 1511
119 Ga0105240_10000124 3300009093 Bacteria 160617
120 Ga0105240_10000833 3300009093 Bacteria 55556
121 Ga0105240_10002040 3300009093 Bacteria 33263
122 Ga0111539_10071199 3300009094 Bacteria 4103
123 Ga0111539_10241787 3300009094 Bacteria 2102
124 Ga0111539_10583417 3300009094 Bacteria 1302
125 Ga0105241_10003988 3300009174 Bacteria 10911
126 Ga0105241_10075270 3300009174 Unclassified 2631
127 Ga0105242_10029644 3300009176 Bacteria 4364
128 Ga0105242_10298377 3300009176 Unclassified 1470
129 Ga0105242_10309635 3300009176 Unclassified 1444
130 Ga0105242_10943251 3300009176 Bacteria 866
131 Ga0105248_10438155 3300009177 Bacteria 1472
132 Ga0105248_11086724 3300009177 Unclassified 904
133 Ga0105237_10001073 3300009545 Bacteria 36751
134 Ga0105237_10002503 3300009545 Bacteria 22768
135 Ga0105237_10026390 3300009545 Bacteria 5937
136 Ga0105237_10219385 3300009545 Bacteria 1902
137 Ga0105237_10589995 3300009545 Bacteria 1118
138 Ga0105237_10795373 3300009545 Bacteria 953
139 Ga0105237_10931203 3300009545 Unclassified 876
140 Ga0105238_10000370 3300009551 Bacteria 48257
141 Ga0105238_10004453 3300009551 Bacteria 13887
142 Ga0105238_10036985 3300009551 Bacteria 4963
143 Ga0105238_10551337 3300009551 Bacteria 1157
144 Ga0105249_10001429 3300009553 Bacteria 20930
145 Ga0105249_10004437 3300009553 Bacteria 12144
146 Ga0105249_10069678 3300009553 Bacteria 3246
147 Ga0105249_10250547 3300009553 Unclassified 1756
148 Ga0105249_10389937 3300009553 Bacteria 1421
149 Ga0099796_10000695 3300010159 Bacteria 5936
150 Ga0105239_10000267 3300010375 Bacteria 77181
151 Ga0105239_10059026 3300010375 Bacteria 4211
152 Ga0105239_10086116 3300010375 Bacteria 3463
153 Ga0105239_10131433 3300010375 Bacteria 2785
154 Ga0105239_10138156 3300010375 Bacteria 2714
155 Ga0105239_10217394 3300010375 Bacteria 2143
156 Ga0105239_10347224 3300010375 Bacteria 1675
157 Ga0105239_11747898 3300010375 Unclassified 720
158 Ga0105246_10006214 3300011119 Bacteria 7291
159 Ga0105246_10324362 3300011119 Bacteria 1253
160 Ga0157371_10412693 3300013102 Unclassified 989
161 Ga0157374_10000003 3300013296 Bacteria 854471
162 Ga0157374_10000857 3300013296 Bacteria 26620
163 Ga0157374_10010119 3300013296 Bacteria 8101
164 Ga0157374_10060241 3300013296 Bacteria 3552
165 Ga0157374_10063199 3300013296 Bacteria 3472
166 Ga0157374_10065370 3300013296 Bacteria 3415
167 Ga0157374_10084384 3300013296 Bacteria 3019
168 Ga0157374_10145831 3300013296 Bacteria 2299
169 Ga0157374_10254637 3300013296 Unclassified 1728
170 Ga0157374_10914580 3300013296 Bacteria 895
171 Ga0157378_10015320 3300013297 Bacteria 6715
172 Ga0157378_10039669 3300013297 Unclassified 4177
173 Ga0157378_10057339 3300013297 Bacteria 3471
174 Ga0157378_10092032 3300013297 Bacteria 2758
175 Ga0157378_10210192 3300013297 Bacteria 1845
176 Ga0157378_10798415 3300013297 Unclassified 969
177 Ga0163162_10000018 3300013306 Bacteria 226257
178 Ga0163162_10003165 3300013306 Bacteria 15731
179 Ga0163162_10023979 3300013306 Bacteria 6020
180 Ga0163162_10041824 3300013306 Bacteria 4585
181 Ga0163162_10077903 3300013306 Bacteria 3379
182 Ga0163162_10153692 3300013306 Bacteria 2420
183 Ga0163162_11143744 3300013306 Bacteria 883
184 Ga0157372_10114845 3300013307 Unclassified 3087
185 Ga0157372_10185070 3300013307 Unclassified 2412
186 Ga0157372_10206811 3300013307 Bacteria 2274
187 Ga0157372_10675921 3300013307 Bacteria 1202
188 Ga0157375_10016838 3300013308 Bacteria 6580
189 Ga0157375_10019874 3300013308 Bacteria 6122
190 Ga0157375_10059791 3300013308 Bacteria 3777
191 Ga0157375_10084628 3300013308 Bacteria 3221
192 Ga0157375_10092883 3300013308 Bacteria 3082
193 Ga0157375_10104445 3300013308 Bacteria 2922
194 Ga0157375_10668970 3300013308 Bacteria 1193
195 Ga0163163_10045101 3300014325 Unclassified 4327
196 Ga0163163_10082788 3300014325 Bacteria 3213
197 Ga0163163_10086611 3300014325 Bacteria 3142
198 Ga0163163_10133480 3300014325 Bacteria 2523
199 Ga0163163_11079925 3300014325 Bacteria 866
200 Ga0157377_10008054 3300014745 Bacteria 5125
201 Ga0157377_10108724 3300014745 Bacteria 1664
202 Ga0157379_10223741 3300014968 Unclassified 1705
203 Ga0157379_10536679 3300014968 Bacteria 1087
204 Ga0157376_10000580 3300014969 Bacteria 23607
205 Ga0157376_10025087 3300014969 Bacteria 4692
206 Ga0213872_10044258 3300021361 Bacteria 2026
207 Ga0207666_1000215 3300025271 Bacteria 8575
208 Ga0207666_1006832 3300025271 Bacteria 1488
209 Ga0207673_1000151 3300025290 Bacteria 6812
210 Ga0207673_1000243 3300025290 Bacteria 5554
211 Ga0209025_1004106 3300025294 Bacteria 12960
212 Ga0207697_10000377 3300025315 Bacteria 24951
213 Ga0207697_10000729 3300025315 Bacteria 18691
214 Ga0207697_10001324 3300025315 Bacteria 13631
215 Ga0207682_10038307 3300025893 Unclassified 1945
216 Ga0207688_10030184 3300025901 Bacteria 2989
217 Ga0207688_10175056 3300025901 Bacteria 1277
218 Ga0207647_10030443 3300025904 Bacteria 3481
219 Ga0207645_10000666 3300025907 Bacteria 28512
220 Ga0207645_10000723 3300025907 Bacteria 27486
221 Ga0207645_10005267 3300025907 Bacteria 9416
222 Ga0207645_10051938 3300025907 Unclassified 2619
223 Ga0207645_10086785 3300025907 Bacteria 2010
224 Ga0207643_10005470 3300025908 Bacteria 6792
225 Ga0207705_10005178 3300025909 Bacteria 9777
226 Ga0207684_10001353 3300025910 Bacteria 26848
227 Ga0207654_10108546 3300025911 Bacteria 1722
228 Ga0207695_10000022 3300025913 Bacteria 659090
229 Ga0207695_10000184 3300025913 Bacteria 181201
230 Ga0207695_10003830 3300025913 Bacteria 20850
231 Ga0207671_10001942 3300025914 Bacteria 22821
232 Ga0207671_10255067 3300025914 Bacteria 1379
233 Ga0207671_10272649 3300025914 Unclassified 1333
234 Ga0207693_10150398 3300025915 Bacteria 1831
235 Ga0207663_10185616 3300025916 Unclassified 1489
236 Ga0207662_10000497 3300025918 Bacteria 17604
237 Ga0207657_10116212 3300025919 Bacteria 2205
238 Ga0207652_10000027 3300025921 Bacteria 151000
239 Ga0207652_10488726 3300025921 Unclassified 1109
240 Ga0207646_10115872 3300025922 Unclassified 2407
241 Ga0207646_10235888 3300025922 Bacteria 1653
242 Ga0207681_10001007 3300025923 Bacteria 18378
243 Ga0207681_10018475 3300025923 Bacteria 4392
244 Ga0207694_10008521 3300025924 Bacteria 7743
245 Ga0207694_10011709 3300025924 Bacteria 6617
246 Ga0207650_10303769 3300025925 Unclassified 1304
247 Ga0207659_10013188 3300025926 Bacteria 5287
248 Ga0207659_10024863 3300025926 Bacteria 4020
249 Ga0207659_10117252 3300025926 Bacteria 2034
250 Ga0207659_10261988 3300025926 Bacteria 1407
251 Ga0207644_10010864 3300025931 Bacteria 6011
252 Ga0207690_10006875 3300025932 Bacteria 6749
253 Ga0207690_10043886 3300025932 Unclassified 2945
254 Ga0207706_10330159 3300025933 Unclassified 1327
255 Ga0207686_10015819 3300025934 Bacteria 4227
256 Ga0207686_10044334 3300025934 Bacteria 2730
257 Ga0207670_10004434 3300025936 Bacteria 7561
258 Ga0207670_10005486 3300025936 Bacteria 6968
259 Ga0207670_10019379 3300025936 Bacteria 4155
260 Ga0207670_10085030 3300025936 Bacteria 2222
261 Ga0207669_10050178 3300025937 Bacteria 2492
262 Ga0207704_10000035 3300025938 Bacteria 96154
263 Ga0207704_10030316 3300025938 Bacteria 3031
264 Ga0207691_10073276 3300025940 Unclassified 3088
265 Ga0207691_10237868 3300025940 Bacteria 1575
266 Ga0207711_10652958 3300025941 Unclassified 981
267 Ga0207689_10002983 3300025942 Bacteria 15619
268 Ga0207689_10317207 3300025942 Unclassified 1293
269 Ga0207661_10430108 3300025944 Unclassified 1200
270 Ga0207661_10955274 3300025944 Unclassified 789
271 Ga0207679_10060132 3300025945 Bacteria 2822
272 Ga0207667_10000039 3300025949 Bacteria 278843
273 Ga0207667_10257620 3300025949 Unclassified 1784
274 Ga0207651_10020332 3300025960 Bacteria 4005
275 Ga0207712_10005716 3300025961 Bacteria 7838
276 Ga0207712_10052693 3300025961 Bacteria 2851
277 Ga0207712_10176033 3300025961 Unclassified 1676
278 Ga0207668_10018086 3300025972 Bacteria 4428
279 Ga0207640_10247870 3300025981 Bacteria 1380
280 Ga0207658_10020987 3300025986 Bacteria 4528
281 Ga0207658_10081257 3300025986 Unclassified 2485
282 Ga0207658_10816509 3300025986 Unclassified 847
283 Ga0207677_10028067 3300026023 Unclassified 3555
284 Ga0207677_10042281 3300026023 Bacteria 3021
285 Ga0207677_10087257 3300026023 Bacteria 2258
286 Ga0207703_10007514 3300026035 Bacteria 8650
287 Ga0207703_10063339 3300026035 Bacteria 3032
288 Ga0207639_10000077 3300026041 Bacteria 86758
289 Ga0207639_10011515 3300026041 Bacteria 6144
290 Ga0207639_10032372 3300026041 Bacteria 3849
291 Ga0207639_10218361 3300026041 Bacteria 1645
292 Ga0207639_10942331 3300026041 Bacteria 808
293 Ga0207678_10717357 3300026067 Unclassified 881
294 Ga0207648_10000733 3300026089 Bacteria 36780
295 Ga0207648_10001434 3300026089 Bacteria 26245
296 Ga0207676_10063168 3300026095 Bacteria 2940
297 Ga0207674_10126499 3300026116 Bacteria 2521
298 Ga0207675_100016560 3300026118 Bacteria 6884
299 Ga0207683_10001858 3300026121 Bacteria 18672
300 Ga0207683_10010048 3300026121 Bacteria 8076
301 Ga0207698_10027876 3300026142 Bacteria 4018
302 Ga0207698_10282831 3300026142 Bacteria 1535
303 Ga0268266_10000119 3300028379 Bacteria 162424
304 Ga0268266_10016251 3300028379 Bacteria 6362
305 Ga0268266_10113276 3300028379 Unclassified 2405
306 Ga0268265_10059158 3300028380 Unclassified 2930
307 Ga0268264_10026582 3300028381 Bacteria 4730
308 Ga0268264_10031864 3300028381 Bacteria 4324
309 Ga0268264_10034453 3300028381 Bacteria 4165
310 Ga0268264_10063985 3300028381 Unclassified 3095
311 Ga0268264_10602231 3300028381 Bacteria 1083
312 Ga0307517_10013164 3300028786 Bacteria 11264
313 Ga0265338_10019102 3300028800 Bacteria 7294
314 Ga0265338_10028357 3300028800 Bacteria 5586
315 Ga0265338_10204645 3300028800 Bacteria 1486
316 Ga0265332_10023254 3300031238 Unclassified 2733
317 Ga0265320_10005032 3300031240 Bacteria 8561
318 Ga0265325_10000429 3300031241 Bacteria 30125
319 Ga0265339_10000805 3300031249 Bacteria 24215
320 Ga0265331_10000286 3300031250 Bacteria 56012
321 Ga0265331_10088469 3300031250 Bacteria 1433
322 Ga0265327_10002101 3300031251 Bacteria 22168
323 Ga0265327_10011076 3300031251 Bacteria 6258
324 Ga0307408_100000031 3300031548 Bacteria 214210
325 Ga0265313_10000845 3300031595 Bacteria 30854
326 Ga0265314_10000082 3300031711 Bacteria 143717
327 Ga0265314_10037840 3300031711 Bacteria 3492
328 Ga0265314_10071867 3300031711 Bacteria 2313
329 Ga0265342_10004421 3300031712 Bacteria 11084
330 Ga0265342_10104906 3300031712 Bacteria 1606
331 Ga0307407_10008359 3300031903 Unclassified 4744
332 Ga0307415_100853546 3300032126 Bacteria 836
333 Ga0307510_10005630 3300033180 Bacteria 14934
334 Ga0373943_0352518 3300035170 Unclassified 844
335 Ga0373955_0229501 3300035172 Bacteria 1110
336 Ga0373935_0620543 3300035692 Unclassified 792
337 Ga0373937_0205846 3300036401 Bacteria 1850
338 Ga0395899_0000751 3300037312 Bacteria 32145
339 Ga0395899_0017894 3300037312 Bacteria 5394
340 Ga0395899_0165851 3300037312 Bacteria 1558
341 Ga0395900_0000153 3300037418 Bacteria 115432
342 Ga0395900_0004510 3300037418 Bacteria 14733
343 Ga0395900_0188274 3300037418 Bacteria 2094
344 Ga0395898_0239758 3300037466 Bacteria 1729
345 Ga0395905_0000752 3300037471 Bacteria 42735
346 Ga0395905_0003545 3300037471 Bacteria 16635
347 Ga0395905_0043163 3300037471 Bacteria 4231
348 Ga0395905_0110457 3300037471 Bacteria 2582
349 Ga0395905_0261763 3300037471 Bacteria 1615
350 Ga0395905_0581768 3300037471 Bacteria 1021
351 Ga0436364_0768674 3300037853 Bacteria 1126
352 Ga0395901_0000330 3300038443 Bacteria 58380
353 Ga0395901_0014493 3300038443 Bacteria 8019
354 Ga0395901_0124460 3300038443 Bacteria 2709
355 Ga0395901_0178249 3300038443 Bacteria 2229
356 Ga0395901_0269895 3300038443 Unclassified 1770
357 Ga0436361_0672383 3300039447 Bacteria 9246
358 Ga0439431_0015152 3300041997 Bacteria 1793
359 Ga0450891_002469 3300042129 Bacteria 1863
360 Ga0450893_0006815 3300042532 Bacteria 1849
361 Ga0451576_0148197 3300045051 Bacteria 2447
362 Ga0451576_0151039 3300045051 Bacteria 2423
363 Ga0451576_0511594 3300045051 Bacteria 1261
364 Ga0451576_0570339 3300045051 Unclassified 1189
365 Ga0495592_0000054 3300046454 Bacteria 107373
366 Ga0495580_0349935 3300046472 Bacteria 1001
367 Ga0495639_0022662 3300046475 Bacteria 2756
368 Ga0495639_0139942 3300046475 Bacteria 1163
369 Ga0495662_0031675 3300046476 Bacteria 2554
370 Ga0495664_0008267 3300046477 Bacteria 5800
371 Ga0495608_0205540 3300046511 Bacteria 1239
372 Ga0495618_0045213 3300046514 Bacteria 2777
373 Ga0495628_0000241 3300046516 Bacteria 48162
374 Ga0495630_0002703 3300046517 Bacteria 12302
375 Ga0495630_0097238 3300046517 Bacteria 2227
376 Ga0495630_0132026 3300046517 Bacteria 1897
377 Ga0495643_0000149 3300046522 Bacteria 113849
378 Ga0495643_0000997 3300046522 Bacteria 28895
379 Ga0495644_0030585 3300046523 Bacteria 2033
380 Ga0495666_0045542 3300046526 Bacteria 2116
381 Ga0495652_0374738 3300046529 Bacteria 1014
382 Ga0495665_0016027 3300046531 Bacteria 4038
383 Ga0495586_0000670 3300046535 Bacteria 19540
384 Ga0495587_0148404 3300046536 Unclassified 1336
385 Ga0495645_0001139 3300046543 Bacteria 18013
386 Ga0495645_0116700 3300046543 Bacteria 1884
387 Ga0495645_0162067 3300046543 Bacteria 1546
388 Ga0495633_0262066 3300046558 Bacteria 788
389 Ga0495668_0072504 3300046616 Bacteria 1892
390 Ga0495634_0232583 3300046642 Unclassified 1133
391 Ga0495635_0055532 3300046663 Bacteria 2728
392 Ga0495599_0281321 3300046678 Bacteria 1008
393 Ga0495658_0009605 3300046683 Bacteria 4824
394 Ga0495658_0022505 3300046683 Bacteria 3334
395 Ga0495624_0012458 3300046690 Bacteria 5810
396 Ga0495674_0005248 3300047319 Bacteria 12433
397 Ga0495674_0010378 3300047319 Bacteria 8818
398 Ga0495683_0024829 3300047323 Bacteria 3074
399 Ga0495684_0014746 3300047471 Bacteria 6018
400 Ga0496100_0201694 3300048903 Bacteria 1450
401 Ga0496102_0089564 3300048905 Unclassified 2847
402 Ga0496103_0292748 3300048906 Unclassified 1047
403 Ga0496104_0041973 3300048907 Bacteria 4290
404 Ga0496107_0151765 3300048910 Unclassified 1714
405 Ga0496107_0261863 3300048910 Bacteria 1287
406 Ga0496108_0051400 3300048911 Unclassified 3453
407 Ga0496110_0076182 3300048913 Plasmid 2982
408 Ga0496111_0092515 3300048914 Bacteria 2217
409 Ga0496112_0068315 3300048915 Bacteria 3509
410 Ga0496113_0249536 3300048916 Bacteria 1417
411 Ga0496113_0317985 3300048916 Unclassified 1247
412 Ga0496113_0560549 3300048916 Bacteria 916
413 Ga0496114_0051111 3300048917 Bacteria 3441
414 Ga0496115_0011823 3300048918 Bacteria 6557
415 Ga0501309_017625 3300049129 Unclassified 982
416 Ga0501032_0446100 3300049569 Bacteria 829
417 Ga0501034_0002093 3300049571 Bacteria 24922
418 Ga0501037_0044882 3300049573 Bacteria 3245
419 Ga0501038_0495040 3300049574 Bacteria 935
420 Ga0501046_0402395 3300049580 Bacteria 989
421 Ga0501047_0332002 3300049581 Bacteria 1359
422 Ga0501080_0094125 3300049742 Bacteria 2782
423 Ga0501083_0069322 3300049744 Bacteria 2346
424 Ga0501035_0327025 3300049822 Bacteria 1287
425 Ga0501044_0020929 3300049823 Bacteria 6985
426 Ga0501044_0145532 3300049823 Bacteria 2356
427 Ga0501044_0168526 3300049823 Unclassified 2163
428 Ga0501044_0387798 3300049823 Bacteria 1311
429 nmdc:mga0k408_114715_c1 3300050493 Unclassified 1593
430 Ga0500608_058732 3300053122 Bacteria 1841
431 Ga0500568_0004121 3300053139 Bacteria 7870
432 Ga0500616_0019154 3300053153 Bacteria 3859
433 Ga0501084_0002478 3300054114 Bacteria 14869
434 2673162762 2671180531 Bacteria 9045424
435 2673168732 2671180531 Bacteria 9045424
436 2688394126 2687453341 Bacteria 6534136
437 2920112789 2920107658 Bacteria 10042636
438 Ga0163163_10000147
439 JGI24035J26624_1000398
440 JGI25151J46595_10026839
441 rootH2_10001201
442 rootH2_10010808
443 rootH2_10106787
444 rootH2_10311952
445 rootH1_10020455
446 rootH1_10191129
447 Ga0065704_10168857
448 Ga0065704_10231544
449 Ga0065712_10071040
450 Ga0065715_10090742
451 Ga0070658_10000638
452 Ga0070658_10402382
453 Ga0070658_10425122
454 Ga0070676_10109758
455 Ga0070683_100024861
456 Ga0070683_100439817
457 Ga0070670_100049990
458 Ga0070670_100219823
459 Ga0070670_100243352
460 Ga0070670_100249975
461 Ga0068869_100082668
462 Ga0068869_100189394
463 Ga0068868_100024770
464 Ga0068868_100036049
465 Ga0070660_100095622
466 Ga0070660_100391477
467 Ga0070689_100014132
468 Ga0070689_100016487
469 Ga0070689_100122656
470 Ga0070689_100207276
471 Ga0070687_100001234
472 Ga0070675_100023517
473 Ga0070675_100069337
474 Ga0070671_100014386
475 Ga0070671_100544309
476 Ga0070674_100197163
477 Ga0070673_100000522
478 Ga0070673_100003661
479 Ga0070673_100013678
480 Ga0070688_100004708
481 Ga0070688_100064086
482 Ga0070659_100004328
483 Ga0070659_100015210
484 Ga0070659_100386613
485 Ga0070667_100138289
486 Ga0070667_100419067
487 Ga0070714_100101261
488 Ga0070713_100927830
489 Ga0070701_10082223
490 Ga0070705_100033585
491 Ga0070694_100014482
492 Ga0070708_100699554
493 Ga0070663_100148378
494 Ga0070678_100001380
495 Ga0070678_100004497
496 Ga0070662_100066917
497 Ga0068867_100001584
498 Ga0070685_10037249
499 Ga0070685_10042231
500 Ga0070706_100001327
501 Ga0070706_100057064
502 Ga0070707_100270750
503 Ga0070707_100305952
504 Ga0070699_100129167
505 Ga0070679_100000364
506 Ga0070679_100540075
507 Ga0070684_100000223
508 Ga0068853_100000051
509 Ga0068853_100001879
510 Ga0068853_100034101
511 Ga0068853_100120837
512 Ga0070672_100241688
513 Ga0070672_100835765
514 Ga0070665_100000034
515 Ga0070665_100013014
516 Ga0070665_100204403
517 Ga0070704_100360229
518 Ga0070704_100482024
519 Ga0068855_100000226
520 Ga0068855_100018699
521 Ga0070664_100065678
522 Ga0068857_100084226
523 Ga0068857_100553393
524 Ga0070702_100133818
525 Ga0068852_100000630
526 Ga0068852_100398113
527 Ga0068859_100024859
528 Ga0068859_100316368
529 Ga0068859_100378600
530 Ga0068866_10046605
531 Ga0068861_100088418
532 Ga0068870_10095189
533 Ga0068858_100121441
534 Ga0068860_100044707
535 Ga0068860_100051825
536 Ga0068860_100113262
537 Ga0068860_100253188
538 Ga0068860_100434699
539 Ga0068860_100698292
540 Ga0068862_100122788
541 Ga0075366_10259904
542 Ga0097621_100000343
543 Ga0097621_100120151
544 Ga0097621_100719773
545 Ga0097621_100867155
546 Ga0068871_100000284
547 Ga0068871_100167243
548 Ga0068871_100265367
549 Ga0075434_100374231
550 Ga0068865_100000029
551 Ga0068865_100042365
552 Ga0097620_100024859
553 Ga0097620_100316366
554 Ga0097620_100378561
555 Ga0105240_10000124
556 Ga0105240_10000833
557 Ga0105240_10002040
558 Ga0111539_10071199
559 Ga0111539_10241787
560 Ga0111539_10583417
561 Ga0105241_10003988
562 Ga0105241_10075270
563 Ga0105242_10029644
564 Ga0105242_10298377
565 Ga0105242_10309635
566 Ga0105242_10943251
567 Ga0105248_10438155
568 Ga0105248_11086724
569 Ga0105237_10001073
570 Ga0105237_10002503
571 Ga0105237_10026390
572 Ga0105237_10219385
573 Ga0105237_10589995
574 Ga0105237_10795373
575 Ga0105237_10931203
576 Ga0105238_10000370
577 Ga0105238_10004453
578 Ga0105238_10036985
579 Ga0105238_10551337
580 Ga0105249_10001429
581 Ga0105249_10004437
582 Ga0105249_10069678
583 Ga0105249_10250547
584 Ga0105249_10389937
585 Ga0099796_10000695
586 Ga0105239_10000267
587 Ga0105239_10059026
588 Ga0105239_10086116
589 Ga0105239_10131433
590 Ga0105239_10138156
591 Ga0105239_10217394
592 Ga0105239_10347224
593 Ga0105239_11747898
594 Ga0105246_10006214
595 Ga0105246_10324362
596 Ga0157371_10412693
597 Ga0157374_10000003
598 Ga0157374_10000857
599 Ga0157374_10010119
600 Ga0157374_10060241
601 Ga0157374_10063199
602 Ga0157374_10065370
603 Ga0157374_10084384
604 Ga0157374_10145831
605 Ga0157374_10254637
606 Ga0157374_10914580
607 Ga0157378_10015320
608 Ga0157378_10039669
609 Ga0157378_10057339
610 Ga0157378_10092032
611 Ga0157378_10210192
612 Ga0157378_10798415
613 Ga0163162_10000018
614 Ga0163162_10003165
615 Ga0163162_10023979
616 Ga0163162_10041824
617 Ga0163162_10077903
618 Ga0163162_10153692
619 Ga0163162_11143744
620 Ga0157372_10114845
621 Ga0157372_10185070
622 Ga0157372_10206811
623 Ga0157372_10675921
624 Ga0157375_10016838
625 Ga0157375_10019874
626 Ga0157375_10059791
627 Ga0157375_10084628
628 Ga0157375_10092883
629 Ga0157375_10104445
630 Ga0157375_10668970
631 Ga0163163_10045101
632 Ga0163163_10082788
633 Ga0163163_10086611
634 Ga0163163_10133480
635 Ga0163163_11079925
636 Ga0157377_10008054
637 Ga0157377_10108724
638 Ga0157379_10223741
639 Ga0157379_10536679
640 Ga0157376_10000580
641 Ga0157376_10025087
642 Ga0213872_10044258
643 Ga0207666_1000215
644 Ga0207666_1006832
645 Ga0207673_1000151
646 Ga0207673_1000243
647 Ga0209025_1004106
648 Ga0207697_10000377
649 Ga0207697_10000729
650 Ga0207697_10001324
651 Ga0207682_10038307
652 Ga0207688_10030184
653 Ga0207688_10175056
654 Ga0207647_10030443
655 Ga0207645_10000666
656 Ga0207645_10000723
657 Ga0207645_10005267
658 Ga0207645_10051938
659 Ga0207645_10086785
660 Ga0207643_10005470
661 Ga0207705_10005178
662 Ga0207684_10001353
663 Ga0207654_10108546
664 Ga0207695_10000022
665 Ga0207695_10000184
666 Ga0207695_10003830
667 Ga0207671_10001942
668 Ga0207671_10255067
669 Ga0207671_10272649
670 Ga0207693_10150398
671 Ga0207663_10185616
672 Ga0207662_10000497
673 Ga0207657_10116212
674 Ga0207652_10000027
675 Ga0207652_10488726
676 Ga0207646_10115872
677 Ga0207646_10235888
678 Ga0207681_10001007
679 Ga0207681_10018475
680 Ga0207694_10008521
681 Ga0207694_10011709
682 Ga0207650_10303769
683 Ga0207659_10013188
684 Ga0207659_10024863
685 Ga0207659_10117252
686 Ga0207659_10261988
687 Ga0207644_10010864
688 Ga0207690_10006875
689 Ga0207690_10043886
690 Ga0207706_10330159
691 Ga0207686_10015819
692 Ga0207686_10044334
693 Ga0207670_10004434
694 Ga0207670_10005486
695 Ga0207670_10019379
696 Ga0207670_10085030
697 Ga0207669_10050178
698 Ga0207704_10000035
699 Ga0207704_10030316
700 Ga0207691_10073276
701 Ga0207691_10237868
702 Ga0207711_10652958
703 Ga0207689_10002983
704 Ga0207689_10317207
705 Ga0207661_10430108
706 Ga0207661_10955274
707 Ga0207679_10060132
708 Ga0207667_10000039
709 Ga0207667_10257620
710 Ga0207651_10020332
711 Ga0207712_10005716
712 Ga0207712_10052693
713 Ga0207712_10176033
714 Ga0207668_10018086
715 Ga0207640_10247870
716 Ga0207658_10020987
717 Ga0207658_10081257
718 Ga0207658_10816509
719 Ga0207677_10028067
720 Ga0207677_10042281
721 Ga0207677_10087257
722 Ga0207703_10007514
723 Ga0207703_10063339
724 Ga0207639_10000077
725 Ga0207639_10011515
726 Ga0207639_10032372
727 Ga0207639_10218361
728 Ga0207639_10942331
729 Ga0207678_10717357
730 Ga0207648_10000733
731 Ga0207648_10001434
732 Ga0207676_10063168
733 Ga0207674_10126499
734 Ga0207675_100016560
735 Ga0207683_10001858
736 Ga0207683_10010048
737 Ga0207698_10027876
738 Ga0207698_10282831
739 Ga0268266_10000119
740 Ga0268266_10016251
741 Ga0268266_10113276
742 Ga0268265_10059158
743 Ga0268264_10026582
744 Ga0268264_10031864
745 Ga0268264_10034453
746 Ga0268264_10063985
747 Ga0268264_10602231
748 Ga0307517_10013164
749 Ga0265338_10019102
750 Ga0265338_10028357
751 Ga0265338_10204645
752 Ga0265332_10023254
753 Ga0265320_10005032
754 Ga0265325_10000429
755 Ga0265339_10000805
756 Ga0265331_10000286
757 Ga0265331_10088469
758 Ga0265327_10002101
759 Ga0265327_10011076
760 Ga0307408_100000031
761 Ga0265313_10000845
762 Ga0265314_10000082
763 Ga0265314_10037840
764 Ga0265314_10071867
765 Ga0265342_10004421
766 Ga0265342_10104906
767 Ga0307407_10008359
768 Ga0307415_100853546
769 Ga0307510_10005630
770 Ga0373943_0352518
771 Ga0373955_0229501
772 Ga0373935_0620543
773 Ga0373937_0205846
774 Ga0395899_0000751
775 Ga0395899_0017894
776 Ga0395899_0165851
777 Ga0395900_0000153
778 Ga0395900_0004510
779 Ga0395900_0188274
780 Ga0395898_0239758
781 Ga0395905_0000752
782 Ga0395905_0003545
783 Ga0395905_0043163
784 Ga0395905_0110457
785 Ga0395905_0261763
786 Ga0395905_0581768
787 Ga0436364_0768674
788 Ga0395901_0000330
789 Ga0395901_0014493
790 Ga0395901_0124460
791 Ga0395901_0178249
792 Ga0395901_0269895
793 Ga0436361_0672383
794 Ga0439431_0015152
795 Ga0450891_002469
796 Ga0450893_0006815
797 Ga0451576_0148197
798 Ga0451576_0151039
799 Ga0451576_0511594
800 Ga0451576_0570339
801 Ga0495592_0000054
802 Ga0495580_0349935
803 Ga0495639_0022662
804 Ga0495639_0139942
805 Ga0495662_0031675
806 Ga0495664_0008267
807 Ga0495608_0205540
808 Ga0495618_0045213
809 Ga0495628_0000241
810 Ga0495630_0002703
811 Ga0495630_0097238
812 Ga0495630_0132026
813 Ga0495643_0000149
814 Ga0495643_0000997
815 Ga0495644_0030585
816 Ga0495666_0045542
817 Ga0495652_0374738
818 Ga0495665_0016027
819 Ga0495586_0000670
820 Ga0495587_0148404
821 Ga0495645_0001139
822 Ga0495645_0116700
823 Ga0495645_0162067
824 Ga0495633_0262066
825 Ga0495668_0072504
826 Ga0495634_0232583
827 Ga0495635_0055532
828 Ga0495599_0281321
829 Ga0495658_0009605
830 Ga0495658_0022505
831 Ga0495624_0012458
832 Ga0495674_0005248
833 Ga0495674_0010378
834 Ga0495683_0024829
835 Ga0495684_0014746
836 Ga0496100_0201694
837 Ga0496102_0089564
838 Ga0496103_0292748
839 Ga0496104_0041973
840 Ga0496107_0151765
841 Ga0496107_0261863
842 Ga0496108_0051400
843 Ga0496110_0076182
844 Ga0496111_0092515
845 Ga0496112_0068315
846 Ga0496113_0249536
847 Ga0496113_0317985
848 Ga0496113_0560549
849 Ga0496114_0051111
850 Ga0496115_0011823
851 Ga0501309_017625
852 Ga0501032_0446100
853 Ga0501034_0002093
854 Ga0501037_0044882
855 Ga0501038_0495040
856 Ga0501046_0402395
857 Ga0501047_0332002
858 Ga0501080_0094125
859 Ga0501083_0069322
860 Ga0501035_0327025
861 Ga0501044_0020929
862 Ga0501044_0145532
863 Ga0501044_0168526
864 Ga0501044_0387798
865 nmdc:mga0k408_114715_c1
866 Ga0500608_058732
867 Ga0500568_0004121
868 Ga0500616_0019154
869 Ga0501084_0002478
870 2673162762
871 2673168732
872 2688394126
873 2920112789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

24

237

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9579 3 212
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9362 3 212
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9354 1 214
7nl4-assembly1.cif.gz_B osnip2;1 silicon transporter from rice 0.9354 3 212
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.9326 1 211
ID Description Score Start End Superfamily
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9794 2 100 1.20.1080.10
af_K7KZ85_1_217_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.967 17 212 1.20.1080.10
af_Q8W036_4_264_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9659 2 212 1.20.1080.10
af_Q9ATN2_41_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9643 2 212 1.20.1080.10
af_A0A1D6J0S8_31_279_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9561 2 212 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A4Q3L3Y8-F1-model_v4 deleted 0.9883 2 207
AF-A0A518GQG0-F1-model_v4 Aquaporin Z 0.9877 1 213 GO:0015267
GO:0016020
AF-A0A225DR87-F1-model_v4 Aquaporin Z 0.9854 3 189 GO:0015267
GO:0016020
AF-A0A3C1YCT3-F1-model_v4 Aquaporin 0.9853 3 206 GO:0015267
GO:0016020
AF-A0A2D0N743-F1-model_v4 Aquaporin 0.9851 3 211 GO:0015267
GO:0016020

Map