F443558

General Info

Members Datasets Scaffolds Average Seq Length
436 229 872 324

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10004714|Ga0157379_100047142
Length 381
Sequence MSAFYIFFTSPLQAGNKLPESRWERGRKSLPPALASLRRDGWNRHRHKEIRVIKRLLSVGLALSLAXGLVGAGSTLVAPLMSKWQSDYASKAEETVTYGAIGSGGGIDQITNRTVDFGASDAPLTEEQFEEADAQGEVEQIPWALSGTVPAYNVKGAPAELKLSGEVLAGIYLGKIASWDDPAIAKLNPGASLPSTKITPVYRSDGSGDTYAFTNYLSTVDPEFKSKVGTSTQVKFPTGVGAEKNDGVSAAISQTDGAIGYVGLAYALQNELSMPLVENSAGEFPEPGVKSVEAAADAVSKIGPNNEISLADLPASAKGAYPISTYTYVIVPLESSKADALKKFITYAIGPGQEFGPDLDFAPLPKQVVAAGKKAIAKIGG

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 14.45
Rhizosphere 83.72
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10004714 3300014968 Bacteria 11711
2 JGI24740J21852_10001854 3300001979 Bacteria 9681
3 Ga0068869_100009141 3300005334 Bacteria 6421
4 Ga0070680_100043595 3300005336 Bacteria 3644
5 Ga0070682_100033865 3300005337 Bacteria 3106
6 Ga0070682_100130084 3300005337 Unclassified 1703
7 Ga0070689_100048213 3300005340 Bacteria 3285
8 Ga0070691_10052930 3300005341 Bacteria 1941
9 Ga0070661_100288417 3300005344 Bacteria 1275
10 Ga0070692_10033135 3300005345 Bacteria 2603
11 Ga0070675_100128290 3300005354 Bacteria 2159
12 Ga0070709_10048613 3300005434 Bacteria 2648
13 Ga0070714_100069729 3300005435 Bacteria 3037
14 Ga0070714_100119077 3300005435 Bacteria 2346
15 Ga0070713_100012896 3300005436 Bacteria 6150
16 Ga0070713_100086373 3300005436 Bacteria 2690
17 Ga0070713_100100388 3300005436 Bacteria 2505
18 Ga0070713_100132440 3300005436 Bacteria 2200
19 Ga0070710_10039021 3300005437 Bacteria 2612
20 Ga0070710_10221069 3300005437 Bacteria 1205
21 Ga0070711_100003931 3300005439 Bacteria 8735
22 Ga0070708_100022893 3300005445 Bacteria 5306
23 Ga0070663_100052809 3300005455 Bacteria 2900
24 Ga0070681_10004350 3300005458 Bacteria 13473
25 Ga0068867_100000266 3300005459 Bacteria 34381
26 Ga0068867_100209216 3300005459 Bacteria 1566
27 Ga0070706_100142388 3300005467 Bacteria 2238
28 Ga0070706_100142400 3300005467 Bacteria 2238
29 Ga0070707_100242363 3300005468 Bacteria 1754
30 Ga0070698_100402658 3300005471 Bacteria 1302
31 Ga0070699_100083155 3300005518 Bacteria 2792
32 Ga0070699_100171425 3300005518 Bacteria 1923
33 Ga0070699_100202161 3300005518 Bacteria 1767
34 Ga0070679_100110959 3300005530 Bacteria 2729
35 Ga0070684_100017557 3300005535 Bacteria 5877
36 Ga0070684_100029059 3300005535 Bacteria 4682
37 Ga0070684_100078669 3300005535 Bacteria 2914
38 Ga0070684_100137439 3300005535 Bacteria 2208
39 Ga0070672_100187464 3300005543 Bacteria 1726
40 Ga0070695_100059362 3300005545 Bacteria 2476
41 Ga0070696_100101152 3300005546 Bacteria 2066
42 Ga0068855_100082678 3300005563 Bacteria 3721
43 Ga0068855_100170134 3300005563 Bacteria 2468
44 Ga0068856_100022366 3300005614 Bacteria 6146
45 Ga0068856_100040306 3300005614 Bacteria 4586
46 Ga0068859_100582846 3300005617 Unclassified 1212
47 Ga0068863_100000021 3300005841 Bacteria 198088
48 Ga0068863_100226134 3300005841 Bacteria 1804
49 Ga0068858_100000267 3300005842 Bacteria 55818
50 Ga0068858_100016450 3300005842 Bacteria 6945
51 Ga0070717_10004645 3300006028 Bacteria 9958
52 Ga0070717_10013546 3300006028 Bacteria 6254
53 Ga0070717_10018777 3300006028 Bacteria 5407
54 Ga0070717_10049177 3300006028 Bacteria 3460
55 Ga0070717_10285640 3300006028 Bacteria 1464
56 Ga0070716_100195219 3300006173 Bacteria 1341
57 Ga0070712_100007558 3300006175 Bacteria 6793
58 Ga0070712_100081489 3300006175 Bacteria 2345
59 Ga0068871_100059548 3300006358 Bacteria 3112
60 Ga0068871_100228306 3300006358 Bacteria 1615
61 Ga0075428_100036271 3300006844 Bacteria 5432
62 Ga0075431_100101844 3300006847 Bacteria 2963
63 Ga0075433_10003317 3300006852 Bacteria 12434
64 Ga0075433_10033558 3300006852 Bacteria 4402
65 Ga0075433_10188989 3300006852 Bacteria 1832
66 Ga0075433_10274941 3300006852 Bacteria 1493
67 Ga0075434_100001689 3300006871 Bacteria 18872
68 Ga0075434_100133527 3300006871 Bacteria 2501
69 Ga0075434_100148056 3300006871 Bacteria 2368
70 Ga0075434_100156107 3300006871 Bacteria 2301
71 Ga0075434_100312016 3300006871 Bacteria 1593
72 Ga0075429_100135902 3300006880 Bacteria 2152
73 Ga0075436_100062501 3300006914 Bacteria 2573
74 Ga0097620_100582953 3300006931 Unclassified 1212
75 Ga0075435_100000640 3300007076 Bacteria 21543
76 Ga0075435_100002085 3300007076 Bacteria 13125
77 Ga0075435_100071786 3300007076 Bacteria 2827
78 Ga0105240_10054987 3300009093 Bacteria 4985
79 Ga0111539_10060012 3300009094 Bacteria 4508
80 Ga0105245_10061287 3300009098 Bacteria 3391
81 Ga0105245_10426551 3300009098 Bacteria 1330
82 Ga0105247_10001765 3300009101 Bacteria 15212
83 Ga0105247_10023853 3300009101 Bacteria 3686
84 Ga0105247_10067443 3300009101 Bacteria 2229
85 Ga0114129_10001119 3300009147 Bacteria 35383
86 Ga0114129_10019604 3300009147 Bacteria 9627
87 Ga0114129_10089470 3300009147 Bacteria 4268
88 Ga0105241_10097101 3300009174 Bacteria 2335
89 Ga0105242_10020721 3300009176 Bacteria 5157
90 Ga0105242_10088731 3300009176 Bacteria 2598
91 Ga0105242_10204228 3300009176 Bacteria 1757
92 Ga0105248_10067097 3300009177 Bacteria 4028
93 Ga0105248_10100209 3300009177 Bacteria 3264
94 Ga0105237_10087217 3300009545 Bacteria 3110
95 Ga0105237_10206884 3300009545 Bacteria 1963
96 Ga0105238_10351564 3300009551 Bacteria 1463
97 Ga0105249_10038542 3300009553 Bacteria 4337
98 Ga0105239_10027953 3300010375 Bacteria 6206
99 Ga0105239_10145289 3300010375 Bacteria 2645
100 Ga0105239_10365540 3300010375 Bacteria 1630
101 Ga0105246_10114579 3300011119 Bacteria 1986
102 Ga0105246_10220788 3300011119 Unclassified 1485
103 Ga0157370_10087193 3300013104 Bacteria 2932
104 Ga0157374_10001597 3300013296 Bacteria 19027
105 Ga0157374_10011648 3300013296 Bacteria 7625
106 Ga0157374_10103631 3300013296 Bacteria 2730
107 Ga0157378_10021096 3300013297 Bacteria 5731
108 Ga0157378_10033230 3300013297 Bacteria 4559
109 Ga0157372_10200948 3300013307 Bacteria 2309
110 Ga0157372_10401417 3300013307 Bacteria 1597
111 Ga0157375_10000112 3300013308 Bacteria 79146
112 Ga0157375_10064189 3300013308 Bacteria 3655
113 Ga0157375_10270099 3300013308 Bacteria 1863
114 Ga0163163_10007946 3300014325 Bacteria 9382
115 Ga0163163_10104048 3300014325 Bacteria 2864
116 Ga0163163_10367673 3300014325 Bacteria 1495
117 Ga0157377_10039761 3300014745 Bacteria 2603
118 Ga0157379_10164157 3300014968 Bacteria 2005
119 Ga0163161_10000032 3300017792 Bacteria 165511
120 Ga0206353_11545272 3300020082 Bacteria 2559
121 Ga0224572_1002755 3300024225 Bacteria 2887
122 Ga0207692_10050854 3300025898 Bacteria 2098
123 Ga0207710_10003137 3300025900 Bacteria 7404
124 Ga0207699_10011031 3300025906 Bacteria 4552
125 Ga0207699_10079776 3300025906 Bacteria 2026
126 Ga0207684_10146943 3300025910 Bacteria 2028
127 Ga0207684_10309330 3300025910 Bacteria 1362
128 Ga0207707_10138583 3300025912 Bacteria 2127
129 Ga0207695_10004852 3300025913 Bacteria 18151
130 Ga0207663_10001792 3300025916 Bacteria 10130
131 Ga0207663_10252799 3300025916 Bacteria 1298
132 Ga0207660_10043335 3300025917 Bacteria 3162
133 Ga0207657_10012723 3300025919 Bacteria 8288
134 Ga0207652_10058803 3300025921 Bacteria 3312
135 Ga0207652_10078827 3300025921 Bacteria 2877
136 Ga0207646_10083474 3300025922 Bacteria 2858
137 Ga0207694_10337330 3300025924 Bacteria 1246
138 Ga0207687_10007076 3300025927 Bacteria 7394
139 Ga0207687_10325411 3300025927 Unclassified 1246
140 Ga0207700_10000012 3300025928 Bacteria 231712
141 Ga0207700_10011526 3300025928 Bacteria 5643
142 Ga0207700_10071270 3300025928 Bacteria 2675
143 Ga0207664_10003292 3300025929 Bacteria 10740
144 Ga0207664_10034606 3300025929 Bacteria 3891
145 Ga0207664_10047318 3300025929 Bacteria 3378
146 Ga0207664_10279961 3300025929 Bacteria 1463
147 Ga0207690_10019319 3300025932 Bacteria 4194
148 Ga0207706_10020260 3300025933 Bacteria 5978
149 Ga0207686_10014543 3300025934 Bacteria 4384
150 Ga0207686_10064504 3300025934 Bacteria 2333
151 Ga0207686_10096355 3300025934 Bacteria 1966
152 Ga0207709_10034856 3300025935 Bacteria 2970
153 Ga0207704_10063053 3300025938 Bacteria 2308
154 Ga0207665_10060858 3300025939 Bacteria 2558
155 Ga0207665_10212952 3300025939 Bacteria 1413
156 Ga0207667_10139251 3300025949 Bacteria 2498
157 Ga0207712_10216353 3300025961 Bacteria 1529
158 Ga0207677_10026976 3300026023 Bacteria 3610
159 Ga0207677_10387649 3300026023 Unclassified 1181
160 Ga0207703_10000040 3300026035 Bacteria 168191
161 Ga0207703_10016444 3300026035 Bacteria 5769
162 Ga0207702_10007611 3300026078 Bacteria 9220
163 Ga0207702_10102803 3300026078 Bacteria 2526
164 Ga0207641_10000151 3300026088 Bacteria 99225
165 Ga0207641_10064061 3300026088 Bacteria 3141
166 Ga0207648_10000848 3300026089 Bacteria 34516
167 Ga0207676_10099514 3300026095 Bacteria 2407
168 Ga0207698_10361096 3300026142 Bacteria 1375
169 Ga0207428_10002858 3300027907 Bacteria 17124
170 Ga0265337_1000259 3300028556 Bacteria 28578
171 Ga0265326_10000007 3300028558 Bacteria 223057
172 Ga0265319_1000025 3300028563 Bacteria 142639
173 Ga0265319_1000985 3300028563 Bacteria 17873
174 Ga0265318_10002263 3300028577 Bacteria 10355
175 Ga0265322_10000001 3300028654 Bacteria 543854
176 Ga0265336_10001017 3300028666 Bacteria 13775
177 Ga0265336_10010681 3300028666 Bacteria 3141
178 Ga0265338_10000473 3300028800 Bacteria 71777
179 Ga0265338_10011482 3300028800 Bacteria 10226
180 Ga0265338_10140458 3300028800 Bacteria 1892
181 Ga0307511_10073738 3300030521 Bacteria 2466
182 Ga0265330_10020045 3300031235 Bacteria 3057
183 Ga0265332_10090790 3300031238 Bacteria 1292
184 Ga0265328_10002019 3300031239 Bacteria 9202
185 Ga0265320_10000002 3300031240 Bacteria 542875
186 Ga0265320_10038495 3300031240 Bacteria 2398
187 Ga0265325_10047245 3300031241 Bacteria 2229
188 Ga0265329_10005871 3300031242 Bacteria 4922
189 Ga0265329_10023739 3300031242 Bacteria 2040
190 Ga0265340_10048148 3300031247 Bacteria 2073
191 Ga0265331_10002720 3300031250 Bacteria 11779
192 Ga0265327_10000011 3300031251 Bacteria 543807
193 Ga0265327_10003744 3300031251 Bacteria 14140
194 Ga0265316_10040047 3300031344 Bacteria 3758
195 Ga0265313_10030020 3300031595 Bacteria 2805
196 Ga0265314_10000058 3300031711 Bacteria 167476
197 Ga0265314_10017605 3300031711 Bacteria 5602
198 Ga0265314_10027444 3300031711 Bacteria 4262
199 Ga0265342_10057476 3300031712 Bacteria 2302
200 Ga0265342_10057996 3300031712 Bacteria 2289
201 Ga0373943_0001038 3300035170 Bacteria 12340
202 Ga0373946_0015686 3300035171 Bacteria 2877
203 Ga0373933_0118960 3300035724 Bacteria 1653
204 Ga0373947_0001046 3300035725 Bacteria 16888
205 Ga0373925_0004340 3300037068 Bacteria 10731
206 Ga0395899_0004374 3300037312 Bacteria 11017
207 Ga0395900_0016069 3300037418 Bacteria 7627
208 Ga0395900_0049278 3300037418 Bacteria 4339
209 Ga0395898_0420826 3300037466 Bacteria 1273
210 Ga0395905_0203483 3300037471 Bacteria 1856
211 Ga0395901_0093821 3300038443 Bacteria 3143
212 Ga0436365_0734817 3300039437 Bacteria 6940
213 Ga0436365_1029822 3300039437 Bacteria 2018
214 Ga0466969_0145272 3300044656 Bacteria 1095
215 Ga0466965_0034651 3300044683 Bacteria 2470
216 Ga0466963_0000001 3300044694 Bacteria 110556
217 Ga0466963_0000665 3300044694 Bacteria 16619
218 Ga0466963_0003151 3300044694 Bacteria 9360
219 Ga0466963_0004327 3300044694 Bacteria 8242
220 Ga0466963_0037253 3300044694 Bacteria 3174
221 Ga0466964_0084695 3300044706 Bacteria 1368
222 Ga0466971_0023691 3300044719 Bacteria 2737
223 Ga0466968_0183401 3300044735 Bacteria 974
224 Ga0466957_0001905 3300044842 Bacteria 11064
225 Ga0466957_0040822 3300044842 Bacteria 2804
226 Ga0466957_0192321 3300044842 Bacteria 1337
227 Ga0466960_0138285 3300044901 Unclassified 1291
228 Ga0466958_0001948 3300045836 Bacteria 10129
229 Ga0466958_0020524 3300045836 Bacteria 3854
230 Ga0466958_0219985 3300045836 Bacteria 1211
231 Ga0466967_0001109 3300045976 Bacteria 14932
232 Ga0466967_0005905 3300045976 Bacteria 8582
233 Ga0466967_0009592 3300045976 Bacteria 7194
234 Ga0466967_0013168 3300045976 Bacteria 6376
235 Ga0466967_0054979 3300045976 Bacteria 3506
236 Ga0466967_0128632 3300045976 Bacteria 2349
237 Ga0466967_0227032 3300045976 Bacteria 1776
238 Ga0466967_0250171 3300045976 Bacteria 1693
239 Ga0495592_0000036 3300046454 Bacteria 125461
240 Ga0495592_0034050 3300046454 Bacteria 3842
241 Ga0495592_0219134 3300046454 Bacteria 1273
242 Ga0495603_0000030 3300046455 Bacteria 60760
243 Ga0495603_0007671 3300046455 Bacteria 6500
244 Ga0495603_0104488 3300046455 Bacteria 1653
245 Ga0495629_0082278 3300046459 Bacteria 2247
246 Ga0495641_0001672 3300046461 Bacteria 18563
247 Ga0495641_0011046 3300046461 Bacteria 5174
248 Ga0495641_0036248 3300046461 Bacteria 2319
249 Ga0495641_0043280 3300046461 Bacteria 2083
250 Ga0495641_0077581 3300046461 Bacteria 1489
251 Ga0495651_0178148 3300046462 Bacteria 1507
252 Ga0495651_0326549 3300046462 Bacteria 1021
253 Ga0495653_0044449 3300046463 Bacteria 3447
254 Ga0495580_0297000 3300046472 Bacteria 1100
255 Ga0495580_0320230 3300046472 Bacteria 1054
256 Ga0495582_0000112 3300046473 Bacteria 42740
257 Ga0495582_0055956 3300046473 Bacteria 2174
258 Ga0495582_0094836 3300046473 Bacteria 1666
259 Ga0495639_0058102 3300046475 Bacteria 1768
260 Ga0495662_0000083 3300046476 Bacteria 34253
261 Ga0495594_0001099 3300046499 Bacteria 14099
262 Ga0495608_0003552 3300046511 Bacteria 11167
263 Ga0495608_0035266 3300046511 Bacteria 3375
264 Ga0495618_0000207 3300046514 Bacteria 42305
265 Ga0495618_0232472 3300046514 Bacteria 1160
266 Ga0495628_0010910 3300046516 Bacteria 7693
267 Ga0495628_0112016 3300046516 Bacteria 2098
268 Ga0495630_0000251 3300046517 Bacteria 43193
269 Ga0495630_0013169 3300046517 Bacteria 6012
270 Ga0495630_0022752 3300046517 Bacteria 4629
271 Ga0495630_0030426 3300046517 Bacteria 4016
272 Ga0495666_0039133 3300046526 Bacteria 2303
273 Ga0495652_0000019 3300046529 Bacteria 190248
274 Ga0495652_0021835 3300046529 Bacteria 5689
275 Ga0495640_0010855 3300046533 Bacteria 7026
276 Ga0495640_0013752 3300046533 Bacteria 6150
277 Ga0495586_0001076 3300046535 Bacteria 15423
278 Ga0495586_0016379 3300046535 Bacteria 3943
279 Ga0495586_0068423 3300046535 Bacteria 1937
280 Ga0495587_0005656 3300046536 Bacteria 8148
281 Ga0495587_0020623 3300046536 Bacteria 4065
282 Ga0495645_0053219 3300046543 Bacteria 2943
283 Ga0495667_0000032 3300046559 Bacteria 143493
284 Ga0495634_0000018 3300046642 Bacteria 121323
285 Ga0495634_0000801 3300046642 Bacteria 30517
286 Ga0495634_0069274 3300046642 Bacteria 2328
287 Ga0495634_0083738 3300046642 Bacteria 2081
288 Ga0495635_0068378 3300046663 Bacteria 2436
289 Ga0495635_0232367 3300046663 Bacteria 1245
290 Ga0495659_0062010 3300046664 Bacteria 1383
291 Ga0495588_0002209 3300046674 Bacteria 8330
292 Ga0495657_0006681 3300046675 Bacteria 9004
293 Ga0495657_0134391 3300046675 Unclassified 1547
294 Ga0495599_0210644 3300046678 Unclassified 1192
295 Ga0495647_0010447 3300046681 Bacteria 3160
296 Ga0495658_0000005 3300046683 Bacteria 149839
297 Ga0495658_0072708 3300046683 Bacteria 2000
298 Ga0495613_0001367 3300046689 Bacteria 18594
299 Ga0495613_0008942 3300046689 Bacteria 7434
300 Ga0495624_0008839 3300046690 Bacteria 7003
301 Ga0495624_0023041 3300046690 Bacteria 4109
302 Ga0495624_0082443 3300046690 Bacteria 1990
303 Ga0495600_0000638 3300046809 Bacteria 18124
304 Ga0495581_0043681 3300047315 Bacteria 2592
305 Ga0495604_0000019 3300047317 Bacteria 175064
306 Ga0495674_0064758 3300047319 Bacteria 3177
307 Ga0495674_0221862 3300047319 Bacteria 1562
308 Ga0495676_0009955 3300047321 Bacteria 8638
309 Ga0495676_0071231 3300047321 Bacteria 2673
310 Ga0495676_0146178 3300047321 Bacteria 1688
311 Ga0495680_0005991 3300047322 Bacteria 11367
312 Ga0495680_0006828 3300047322 Bacteria 10543
313 Ga0495675_0219913 3300047444 Bacteria 1150
314 Ga0495685_040002 3300047447 Bacteria 1604
315 Ga0495684_0001301 3300047471 Bacteria 20049
316 Ga0495684_0110315 3300047471 Bacteria 2077
317 Ga0495593_0169073 3300047673 Bacteria 1102
318 Ga0495602_0002001 3300048088 Bacteria 20483
319 Ga0495602_0032615 3300048088 Bacteria 4902
320 Ga0495602_0166811 3300048088 Bacteria 1713
321 Ga0496100_0009533 3300048903 Bacteria 5457
322 Ga0496100_0073164 3300048903 Bacteria 2293
323 Ga0496100_0099377 3300048903 Bacteria 2002
324 Ga0496100_0124312 3300048903 Bacteria 1809
325 Ga0496100_0181701 3300048903 Unclassified 1521
326 Ga0496101_0001601 3300048904 Bacteria 13610
327 Ga0496101_0046614 3300048904 Bacteria 3109
328 Ga0496102_0170283 3300048905 Bacteria 2050
329 Ga0496102_0279003 3300048905 Bacteria 1575
330 Ga0496103_0017213 3300048906 Bacteria 4323
331 Ga0496104_0000004 3300048907 Bacteria 641830
332 Ga0496104_0000381 3300048907 Bacteria 38927
333 Ga0496104_0012021 3300048907 Bacteria 7769
334 Ga0496104_0021441 3300048907 Bacteria 5931
335 Ga0496104_0136249 3300048907 Bacteria 2359
336 Ga0496105_0000001 3300048908 Bacteria 1328178
337 Ga0496105_0018717 3300048908 Bacteria 5575
338 Ga0496105_0033584 3300048908 Bacteria 4215
339 Ga0496106_0002419 3300048909 Bacteria 13910
340 Ga0496106_0029721 3300048909 Bacteria 4074
341 Ga0496106_0105898 3300048909 Bacteria 2185
342 Ga0496107_0000324 3300048910 Bacteria 25792
343 Ga0496107_0007813 3300048910 Bacteria 7384
344 Ga0496107_0073768 3300048910 Bacteria 2482
345 Ga0496107_0084824 3300048910 Bacteria 2311
346 Ga0496108_0001220 3300048911 Bacteria 20175
347 Ga0496108_0001569 3300048911 Bacteria 18097
348 Ga0496108_0007891 3300048911 Bacteria 8630
349 Ga0496108_0089437 3300048911 Bacteria 2617
350 Ga0496108_0210611 3300048911 Bacteria 1687
351 Ga0496109_0000168 3300048912 Bacteria 64462
352 Ga0496109_0002111 3300048912 Bacteria 16525
353 Ga0496109_0006233 3300048912 Bacteria 10031
354 Ga0496109_0028732 3300048912 Bacteria 4977
355 Ga0496109_0095907 3300048912 Bacteria 2747
356 Ga0496109_0139479 3300048912 Bacteria 2267
357 Ga0496109_0218282 3300048912 Bacteria 1793
358 Ga0496110_0000890 3300048913 Bacteria 21075
359 Ga0496110_0006204 3300048913 Bacteria 9435
360 Ga0496110_0013623 3300048913 Bacteria 6732
361 Ga0496110_0074293 3300048913 Bacteria 3019
362 Ga0496111_0000043 3300048914 Bacteria 49176
363 Ga0496111_0010490 3300048914 Bacteria 6220
364 Ga0496111_0031181 3300048914 Bacteria 3796
365 Ga0496111_0084139 3300048914 Bacteria 2325
366 Ga0496112_0000003 3300048915 Bacteria 660147
367 Ga0496112_0000145 3300048915 Bacteria 44395
368 Ga0496112_0011560 3300048915 Bacteria 8066
369 Ga0496113_0266926 3300048916 Bacteria 1368
370 Ga0496113_0277208 3300048916 Bacteria 1340
371 Ga0496113_0425663 3300048916 Bacteria 1066
372 Ga0496114_0003868 3300048917 Bacteria 11539
373 Ga0496114_0004481 3300048917 Bacteria 10837
374 Ga0496114_0006095 3300048917 Bacteria 9493
375 Ga0496114_0040194 3300048917 Bacteria 3871
376 Ga0496114_0057955 3300048917 Bacteria 3234
377 Ga0496114_0107228 3300048917 Bacteria 2390
378 Ga0496114_0136469 3300048917 Bacteria 2121
379 Ga0496115_0002008 3300048918 Bacteria 14544
380 Ga0496115_0046557 3300048918 Bacteria 3467
381 Ga0496115_0078420 3300048918 Bacteria 2687
382 Ga0496115_0157210 3300048918 Bacteria 1878
383 Ga0496115_0182505 3300048918 Bacteria 1734
384 Ga0496120_0028977 3300048923 Bacteria 3386
385 Ga0501067_0000031 3300049583 Bacteria 87732
386 Ga0501067_0017660 3300049583 Bacteria 3949
387 Ga0501068_0000884 3300049584 Bacteria 15631
388 Ga0501069_0000032 3300049585 Bacteria 96425
389 Ga0501069_0066641 3300049585 Bacteria 2013
390 Ga0501070_0004968 3300049586 Bacteria 11347
391 Ga0501070_0065383 3300049586 Bacteria 3011
392 Ga0501070_0126481 3300049586 Bacteria 2112
393 Ga0501071_0017486 3300049587 Bacteria 4946
394 Ga0501073_0114612 3300049589 Bacteria 1868
395 Ga0501074_0000095 3300049590 Bacteria 42376
396 Ga0501080_0000250 3300049742 Bacteria 40604
397 Ga0501080_0018522 3300049742 Bacteria 6441
398 Ga0501080_0032260 3300049742 Bacteria 4884
399 Ga0501083_0001707 3300049744 Bacteria 14977
400 Ga0501035_0050792 3300049822 Bacteria 3715
401 Ga0501044_0019840 3300049823 Bacteria 7180
402 nmdc:mga03n38_89824_c1 3300050490 Bacteria 1460
403 nmdc:mga0yw44_139237_c1 3300050492 Bacteria 1576
404 nmdc:mga06z11_250166_c1 3300050494 Bacteria 1043
405 nmdc:mga09592_246619_c1 3300050508 Bacteria 1548
406 nmdc:mga06r32_166042_c1 3300050510 Bacteria 2190
407 nmdc:mga08y16_41472_c1 3300050511 Bacteria 4821
408 nmdc:mga0n895_1436_c1 3300050512 Bacteria 17804
409 nmdc:mga0n895_195914_c1 3300050512 Bacteria 2052
410 nmdc:mga0n895_24206_c1 3300050512 Bacteria 5720
411 nmdc:mga0n895_387335_c1 3300050512 Bacteria 1414
412 nmdc:mga0rr50_15814_c1 3300050513 Bacteria 4991
413 nmdc:mga0rr50_228594_c1 3300050513 Bacteria 1538
414 nmdc:mga0rr50_2382_c1 3300050513 Bacteria 10575
415 nmdc:mga0rr50_28457_c1 3300050513 Bacteria 3929
416 nmdc:mga0rr50_43811_c1 3300050513 Bacteria 3278
417 nmdc:mga08x19_164658_c1 3300050514 Bacteria 1507
418 nmdc:mga08x19_21699_c1 3300050514 Bacteria 3968
419 nmdc:mga08x19_35577_c1 3300050514 Bacteria 3152
420 nmdc:mga0a205_24969_c1 3300050515 Bacteria 5690
421 nmdc:mga0a205_320176_c1 3300050515 Unclassified 1422
422 nmdc:mga0a205_90999_c1 3300050515 Bacteria 2948
423 Ga0495601_0000435 3300053077 Bacteria 21841
424 Ga0495595_0000087 3300053084 Bacteria 43931
425 Ga0495595_0010787 3300053084 Bacteria 3807
426 Ga0495619_0000021 3300053085 Bacteria 187095
427 Ga0495619_0000589 3300053085 Bacteria 24114
428 Ga0495619_0004419 3300053085 Bacteria 8967
429 Ga0495619_0016862 3300053085 Bacteria 4626
430 Ga0495619_0024236 3300053085 Bacteria 3891
431 Ga0495619_0026622 3300053085 Bacteria 3721
432 Ga0500556_0002133 3300053104 Bacteria 6723
433 Ga0501084_0000874 3300054114 Bacteria 23309
434 Ga0466962_0049344 3300061719 Bacteria 2012
435 Ga0530510_0000745 3300061734 Bacteria 21090
436 Ga0530510_0119785 3300061734 Bacteria 1931
437 Ga0157379_10004714
438 JGI24740J21852_10001854
439 Ga0068869_100009141
440 Ga0070680_100043595
441 Ga0070682_100033865
442 Ga0070682_100130084
443 Ga0070689_100048213
444 Ga0070691_10052930
445 Ga0070661_100288417
446 Ga0070692_10033135
447 Ga0070675_100128290
448 Ga0070709_10048613
449 Ga0070714_100069729
450 Ga0070714_100119077
451 Ga0070713_100012896
452 Ga0070713_100086373
453 Ga0070713_100100388
454 Ga0070713_100132440
455 Ga0070710_10039021
456 Ga0070710_10221069
457 Ga0070711_100003931
458 Ga0070708_100022893
459 Ga0070663_100052809
460 Ga0070681_10004350
461 Ga0068867_100000266
462 Ga0068867_100209216
463 Ga0070706_100142388
464 Ga0070706_100142400
465 Ga0070707_100242363
466 Ga0070698_100402658
467 Ga0070699_100083155
468 Ga0070699_100171425
469 Ga0070699_100202161
470 Ga0070679_100110959
471 Ga0070684_100017557
472 Ga0070684_100029059
473 Ga0070684_100078669
474 Ga0070684_100137439
475 Ga0070672_100187464
476 Ga0070695_100059362
477 Ga0070696_100101152
478 Ga0068855_100082678
479 Ga0068855_100170134
480 Ga0068856_100022366
481 Ga0068856_100040306
482 Ga0068859_100582846
483 Ga0068863_100000021
484 Ga0068863_100226134
485 Ga0068858_100000267
486 Ga0068858_100016450
487 Ga0070717_10004645
488 Ga0070717_10013546
489 Ga0070717_10018777
490 Ga0070717_10049177
491 Ga0070717_10285640
492 Ga0070716_100195219
493 Ga0070712_100007558
494 Ga0070712_100081489
495 Ga0068871_100059548
496 Ga0068871_100228306
497 Ga0075428_100036271
498 Ga0075431_100101844
499 Ga0075433_10003317
500 Ga0075433_10033558
501 Ga0075433_10188989
502 Ga0075433_10274941
503 Ga0075434_100001689
504 Ga0075434_100133527
505 Ga0075434_100148056
506 Ga0075434_100156107
507 Ga0075434_100312016
508 Ga0075429_100135902
509 Ga0075436_100062501
510 Ga0097620_100582953
511 Ga0075435_100000640
512 Ga0075435_100002085
513 Ga0075435_100071786
514 Ga0105240_10054987
515 Ga0111539_10060012
516 Ga0105245_10061287
517 Ga0105245_10426551
518 Ga0105247_10001765
519 Ga0105247_10023853
520 Ga0105247_10067443
521 Ga0114129_10001119
522 Ga0114129_10019604
523 Ga0114129_10089470
524 Ga0105241_10097101
525 Ga0105242_10020721
526 Ga0105242_10088731
527 Ga0105242_10204228
528 Ga0105248_10067097
529 Ga0105248_10100209
530 Ga0105237_10087217
531 Ga0105237_10206884
532 Ga0105238_10351564
533 Ga0105249_10038542
534 Ga0105239_10027953
535 Ga0105239_10145289
536 Ga0105239_10365540
537 Ga0105246_10114579
538 Ga0105246_10220788
539 Ga0157370_10087193
540 Ga0157374_10001597
541 Ga0157374_10011648
542 Ga0157374_10103631
543 Ga0157378_10021096
544 Ga0157378_10033230
545 Ga0157372_10200948
546 Ga0157372_10401417
547 Ga0157375_10000112
548 Ga0157375_10064189
549 Ga0157375_10270099
550 Ga0163163_10007946
551 Ga0163163_10104048
552 Ga0163163_10367673
553 Ga0157377_10039761
554 Ga0157379_10164157
555 Ga0163161_10000032
556 Ga0206353_11545272
557 Ga0224572_1002755
558 Ga0207692_10050854
559 Ga0207710_10003137
560 Ga0207699_10011031
561 Ga0207699_10079776
562 Ga0207684_10146943
563 Ga0207684_10309330
564 Ga0207707_10138583
565 Ga0207695_10004852
566 Ga0207663_10001792
567 Ga0207663_10252799
568 Ga0207660_10043335
569 Ga0207657_10012723
570 Ga0207652_10058803
571 Ga0207652_10078827
572 Ga0207646_10083474
573 Ga0207694_10337330
574 Ga0207687_10007076
575 Ga0207687_10325411
576 Ga0207700_10000012
577 Ga0207700_10011526
578 Ga0207700_10071270
579 Ga0207664_10003292
580 Ga0207664_10034606
581 Ga0207664_10047318
582 Ga0207664_10279961
583 Ga0207690_10019319
584 Ga0207706_10020260
585 Ga0207686_10014543
586 Ga0207686_10064504
587 Ga0207686_10096355
588 Ga0207709_10034856
589 Ga0207704_10063053
590 Ga0207665_10060858
591 Ga0207665_10212952
592 Ga0207667_10139251
593 Ga0207712_10216353
594 Ga0207677_10026976
595 Ga0207677_10387649
596 Ga0207703_10000040
597 Ga0207703_10016444
598 Ga0207702_10007611
599 Ga0207702_10102803
600 Ga0207641_10000151
601 Ga0207641_10064061
602 Ga0207648_10000848
603 Ga0207676_10099514
604 Ga0207698_10361096
605 Ga0207428_10002858
606 Ga0265337_1000259
607 Ga0265326_10000007
608 Ga0265319_1000025
609 Ga0265319_1000985
610 Ga0265318_10002263
611 Ga0265322_10000001
612 Ga0265336_10001017
613 Ga0265336_10010681
614 Ga0265338_10000473
615 Ga0265338_10011482
616 Ga0265338_10140458
617 Ga0307511_10073738
618 Ga0265330_10020045
619 Ga0265332_10090790
620 Ga0265328_10002019
621 Ga0265320_10000002
622 Ga0265320_10038495
623 Ga0265325_10047245
624 Ga0265329_10005871
625 Ga0265329_10023739
626 Ga0265340_10048148
627 Ga0265331_10002720
628 Ga0265327_10000011
629 Ga0265327_10003744
630 Ga0265316_10040047
631 Ga0265313_10030020
632 Ga0265314_10000058
633 Ga0265314_10017605
634 Ga0265314_10027444
635 Ga0265342_10057476
636 Ga0265342_10057996
637 Ga0373943_0001038
638 Ga0373946_0015686
639 Ga0373933_0118960
640 Ga0373947_0001046
641 Ga0373925_0004340
642 Ga0395899_0004374
643 Ga0395900_0016069
644 Ga0395900_0049278
645 Ga0395898_0420826
646 Ga0395905_0203483
647 Ga0395901_0093821
648 Ga0436365_0734817
649 Ga0436365_1029822
650 Ga0466969_0145272
651 Ga0466965_0034651
652 Ga0466963_0000001
653 Ga0466963_0000665
654 Ga0466963_0003151
655 Ga0466963_0004327
656 Ga0466963_0037253
657 Ga0466964_0084695
658 Ga0466971_0023691
659 Ga0466968_0183401
660 Ga0466957_0001905
661 Ga0466957_0040822
662 Ga0466957_0192321
663 Ga0466960_0138285
664 Ga0466958_0001948
665 Ga0466958_0020524
666 Ga0466958_0219985
667 Ga0466967_0001109
668 Ga0466967_0005905
669 Ga0466967_0009592
670 Ga0466967_0013168
671 Ga0466967_0054979
672 Ga0466967_0128632
673 Ga0466967_0227032
674 Ga0466967_0250171
675 Ga0495592_0000036
676 Ga0495592_0034050
677 Ga0495592_0219134
678 Ga0495603_0000030
679 Ga0495603_0007671
680 Ga0495603_0104488
681 Ga0495629_0082278
682 Ga0495641_0001672
683 Ga0495641_0011046
684 Ga0495641_0036248
685 Ga0495641_0043280
686 Ga0495641_0077581
687 Ga0495651_0178148
688 Ga0495651_0326549
689 Ga0495653_0044449
690 Ga0495580_0297000
691 Ga0495580_0320230
692 Ga0495582_0000112
693 Ga0495582_0055956
694 Ga0495582_0094836
695 Ga0495639_0058102
696 Ga0495662_0000083
697 Ga0495594_0001099
698 Ga0495608_0003552
699 Ga0495608_0035266
700 Ga0495618_0000207
701 Ga0495618_0232472
702 Ga0495628_0010910
703 Ga0495628_0112016
704 Ga0495630_0000251
705 Ga0495630_0013169
706 Ga0495630_0022752
707 Ga0495630_0030426
708 Ga0495666_0039133
709 Ga0495652_0000019
710 Ga0495652_0021835
711 Ga0495640_0010855
712 Ga0495640_0013752
713 Ga0495586_0001076
714 Ga0495586_0016379
715 Ga0495586_0068423
716 Ga0495587_0005656
717 Ga0495587_0020623
718 Ga0495645_0053219
719 Ga0495667_0000032
720 Ga0495634_0000018
721 Ga0495634_0000801
722 Ga0495634_0069274
723 Ga0495634_0083738
724 Ga0495635_0068378
725 Ga0495635_0232367
726 Ga0495659_0062010
727 Ga0495588_0002209
728 Ga0495657_0006681
729 Ga0495657_0134391
730 Ga0495599_0210644
731 Ga0495647_0010447
732 Ga0495658_0000005
733 Ga0495658_0072708
734 Ga0495613_0001367
735 Ga0495613_0008942
736 Ga0495624_0008839
737 Ga0495624_0023041
738 Ga0495624_0082443
739 Ga0495600_0000638
740 Ga0495581_0043681
741 Ga0495604_0000019
742 Ga0495674_0064758
743 Ga0495674_0221862
744 Ga0495676_0009955
745 Ga0495676_0071231
746 Ga0495676_0146178
747 Ga0495680_0005991
748 Ga0495680_0006828
749 Ga0495675_0219913
750 Ga0495685_040002
751 Ga0495684_0001301
752 Ga0495684_0110315
753 Ga0495593_0169073
754 Ga0495602_0002001
755 Ga0495602_0032615
756 Ga0495602_0166811
757 Ga0496100_0009533
758 Ga0496100_0073164
759 Ga0496100_0099377
760 Ga0496100_0124312
761 Ga0496100_0181701
762 Ga0496101_0001601
763 Ga0496101_0046614
764 Ga0496102_0170283
765 Ga0496102_0279003
766 Ga0496103_0017213
767 Ga0496104_0000004
768 Ga0496104_0000381
769 Ga0496104_0012021
770 Ga0496104_0021441
771 Ga0496104_0136249
772 Ga0496105_0000001
773 Ga0496105_0018717
774 Ga0496105_0033584
775 Ga0496106_0002419
776 Ga0496106_0029721
777 Ga0496106_0105898
778 Ga0496107_0000324
779 Ga0496107_0007813
780 Ga0496107_0073768
781 Ga0496107_0084824
782 Ga0496108_0001220
783 Ga0496108_0001569
784 Ga0496108_0007891
785 Ga0496108_0089437
786 Ga0496108_0210611
787 Ga0496109_0000168
788 Ga0496109_0002111
789 Ga0496109_0006233
790 Ga0496109_0028732
791 Ga0496109_0095907
792 Ga0496109_0139479
793 Ga0496109_0218282
794 Ga0496110_0000890
795 Ga0496110_0006204
796 Ga0496110_0013623
797 Ga0496110_0074293
798 Ga0496111_0000043
799 Ga0496111_0010490
800 Ga0496111_0031181
801 Ga0496111_0084139
802 Ga0496112_0000003
803 Ga0496112_0000145
804 Ga0496112_0011560
805 Ga0496113_0266926
806 Ga0496113_0277208
807 Ga0496113_0425663
808 Ga0496114_0003868
809 Ga0496114_0004481
810 Ga0496114_0006095
811 Ga0496114_0040194
812 Ga0496114_0057955
813 Ga0496114_0107228
814 Ga0496114_0136469
815 Ga0496115_0002008
816 Ga0496115_0046557
817 Ga0496115_0078420
818 Ga0496115_0157210
819 Ga0496115_0182505
820 Ga0496120_0028977
821 Ga0501067_0000031
822 Ga0501067_0017660
823 Ga0501068_0000884
824 Ga0501069_0000032
825 Ga0501069_0066641
826 Ga0501070_0004968
827 Ga0501070_0065383
828 Ga0501070_0126481
829 Ga0501071_0017486
830 Ga0501073_0114612
831 Ga0501074_0000095
832 Ga0501080_0000250
833 Ga0501080_0018522
834 Ga0501080_0032260
835 Ga0501083_0001707
836 Ga0501035_0050792
837 Ga0501044_0019840
838 nmdc:mga03n38_89824_c1
839 nmdc:mga0yw44_139237_c1
840 nmdc:mga06z11_250166_c1
841 nmdc:mga09592_246619_c1
842 nmdc:mga06r32_166042_c1
843 nmdc:mga08y16_41472_c1
844 nmdc:mga0n895_1436_c1
845 nmdc:mga0n895_195914_c1
846 nmdc:mga0n895_24206_c1
847 nmdc:mga0n895_387335_c1
848 nmdc:mga0rr50_15814_c1
849 nmdc:mga0rr50_228594_c1
850 nmdc:mga0rr50_2382_c1
851 nmdc:mga0rr50_28457_c1
852 nmdc:mga0rr50_43811_c1
853 nmdc:mga08x19_164658_c1
854 nmdc:mga08x19_21699_c1
855 nmdc:mga08x19_35577_c1
856 nmdc:mga0a205_24969_c1
857 nmdc:mga0a205_320176_c1
858 nmdc:mga0a205_90999_c1
859 Ga0495601_0000435
860 Ga0495595_0000087
861 Ga0495595_0010787
862 Ga0495619_0000021
863 Ga0495619_0000589
864 Ga0495619_0004419
865 Ga0495619_0016862
866 Ga0495619_0024236
867 Ga0495619_0026622
868 Ga0500556_0002133
869 Ga0501084_0000874
870 Ga0466962_0049344
871 Ga0530510_0000745
872 Ga0530510_0119785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

58

351

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pc3-assembly1.cif.gz_A crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. 0.9443 13 327
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9398 14 325
8ods-assembly1.cif.gz_A phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate 0.9395 12 325
2z22-assembly2.cif.gz_A crystal structure of phosphate preplasmic binding protein psts from yersinia pestis 0.9377 12 321
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9361 13 321
ID Description Score Start End Superfamily
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9292 93 267 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9237 94 267 3.40.190.10
4lvqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9116 93 268 3.40.190.10
4jwoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9006 13 89 3.40.190.10
4lvqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.896 93 268 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4S1FX25-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9953 105 207
AF-A0A838V1B6-F1-model_v4 Phosphate-binding protein 0.9917 1 327 GO:0035435
GO:0042301
GO:0043190
AF-T1ADT3-F1-model_v4 Phosphate ABC transporter, periplasmic phosphate-binding protein 0.9895 122 240
AF-A0A838V1B6-F1-model_v4 Phosphate-binding protein 0.9857 1 327 GO:0035435
GO:0042301
GO:0043190
AF-A0A1M3BFC5-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.976 26 323 GO:0035435
GO:0042301
GO:0043190

Map