F443575

General Info

Members Datasets Scaffolds Average Seq Length
436 315 872 155

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10652572|Ga0207669_106525722
Length 189
Sequence MLLMADDVGSPTRTLDIHGIYRLLPHRPPFLMVDRIKDIDGDNFAIGIKNVTANEPFFAGHFPEMPIMPGVLLIEGMAQTAGAICILSRGRSRPGVVYFMTIDDAKFRKPVTPGDTVEYHVRKIRNRGRVWRFYGEARVDGKIAAEAEVSAMLADTSEARAFAAGKQAPRKALVVWWDVSAVGIRFDDK

Samples

Sample ID Description Type Environment
1 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
230 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
231 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
232 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
233 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 2509276019 Ensifer aridi TW10 Isolate Nodule
238 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
239 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
240 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
241 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
242 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
243 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
244 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
245 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
246 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
247 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
248 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
249 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
250 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
251 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
252 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
253 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
254 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
255 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
256 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
257 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
258 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
259 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
260 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
261 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
262 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
263 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
264 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
265 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
266 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
267 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
268 2643221688 Rhizobium sp. Root482 Isolate Unclassified
269 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
270 2643221718 Rhizobium sp. Root268 Isolate Unclassified
271 2643221719 Rhizobium sp. Root274 Isolate Unclassified
272 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
273 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
274 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
275 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
276 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
277 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
278 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
279 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
280 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
281 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
282 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
283 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
284 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
285 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
286 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
287 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
288 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
289 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
290 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
291 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
292 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
293 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
294 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
295 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
296 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
297 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
298 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
299 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
300 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
301 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
302 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
303 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
304 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
305 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
306 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
307 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
308 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
309 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
310 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
311 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
312 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
313 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
314 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
315 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.65
Metatranscriptomes 0.23
Isolates 18.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.01
Nodule 7.57
Rhizoplane 5.73
Rhizosphere 58.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207669_10652572 3300025937 Bacteria 861
2 JGI25155J39150_1000011 3300002704 Bacteria 207685
3 JGI25156J39149_1000027 3300002705 Bacteria 127396
4 JGI25156J39149_1000030 3300002705 Bacteria 126029
5 JGI25162J39368_1002899 3300002737 Bacteria 5852
6 JGI25162J39368_1002900 3300002737 Bacteria 5852
7 JGI25154J39366_1000057 3300002738 Bacteria 110584
8 JGI25157J39369_1000010 3300002741 Bacteria 207685
9 JGI25152J39213_1004312 3300002773 Bacteria 4528
10 JGI25159J45721_1001890 3300002987 Bacteria 8367
11 JGI25151J46595_10001641 3300003187 Bacteria 14725
12 JGI25151J46595_10057293 3300003187 Bacteria 1271
13 JGI25165J46597_1002487 3300003214 Bacteria 5852
14 JGI25165J46597_1002504 3300003214 Bacteria 5822
15 JGI25165J46597_1011180 3300003214 Bacteria 1288
16 rootH1_10106418 3300003316 Bacteria 1987
17 rootH2_10177198 3300003320 Bacteria 3068
18 rootL2_10001766 3300003322 Bacteria 1633
19 rootL2_10001767 3300003322 Bacteria 11648
20 JGI25160J50197_1000004 3300003354 Bacteria 419797
21 JGI25161J50226_1000003 3300003374 Bacteria 413345
22 Ga0055526_1021905 3300003771 Bacteria 2199
23 Ga0055524_1011436 3300003775 Bacteria 3471
24 Ga0055528_1001889 3300003790 Bacteria 11931
25 Ga0055543_1000001 3300004625 Bacteria 419949
26 Ga0065165_1000049 3300005262 Bacteria 195588
27 Ga0065165_1015257 3300005262 Bacteria 2938
28 Ga0070658_10305979 3300005327 Bacteria 1356
29 Ga0070660_100944264 3300005339 Bacteria 728
30 Ga0070689_100309887 3300005340 Bacteria 1316
31 Ga0070669_100884344 3300005353 Bacteria 762
32 Ga0070667_100203072 3300005367 Bacteria 1759
33 Ga0070714_100139185 3300005435 Bacteria 2176
34 Ga0070714_100227002 3300005435 Bacteria 1719
35 Ga0070710_10166205 3300005437 Bacteria 1372
36 Ga0070710_11037716 3300005437 Bacteria 599
37 Ga0070681_10424116 3300005458 Bacteria 1242
38 Ga0070679_100092935 3300005530 Bacteria 3004
39 Ga0068853_101370050 3300005539 Bacteria 684
40 Ga0070665_100019094 3300005548 Bacteria 6877
41 Ga0068854_100023587 3300005578 Bacteria 4205
42 Ga0068856_100140755 3300005614 Bacteria 2420
43 Ga0068856_100294104 3300005614 Bacteria 1641
44 Ga0068852_100035348 3300005616 Bacteria 4167
45 Ga0068864_102378626 3300005618 Bacteria 536
46 Ga0068851_10191441 3300005834 Bacteria 1137
47 Ga0075364_10426046 3300006051 Bacteria 906
48 Ga0070712_101428151 3300006175 Bacteria 604
49 Ga0075370_10007141 3300006353 Bacteria 5671
50 Ga0075428_100002909 3300006844 Bacteria 18640
51 Ga0075430_100020618 3300006846 Bacteria 5607
52 Ga0075431_100000417 3300006847 Bacteria 34661
53 Ga0075433_10312413 3300006852 Bacteria 1391
54 Ga0075434_100100936 3300006871 Bacteria 2892
55 Ga0075429_100004216 3300006880 Bacteria 12312
56 Ga0075436_100339638 3300006914 Bacteria 1081
57 Ga0105240_10000005 3300009093 Bacteria 702630
58 Ga0111539_10004674 3300009094 Bacteria 17895
59 Ga0105245_11069739 3300009098 Bacteria 852
60 Ga0114129_10002339 3300009147 Bacteria 26307
61 Ga0105243_10678284 3300009148 Bacteria 1002
62 Ga0105237_10002240 3300009545 Bacteria 24098
63 Ga0105239_10000739 3300010375 Bacteria 46483
64 Ga0157370_10006233 3300013104 Bacteria 13211
65 Ga0157370_10551852 3300013104 Bacteria 1056
66 Ga0157369_10232742 3300013105 Bacteria 1926
67 Ga0157372_10741426 3300013307 Bacteria 1142
68 Ga0163163_10007735 3300014325 Bacteria 9497
69 Ga0182007_10001732 3300015262 Bacteria 11483
70 Ga0214544_1000024 3300021320 Bacteria 163562
71 Ga0214542_1000015 3300021321 Bacteria 227912
72 Ga0214542_1026314 3300021321 Bacteria 2863
73 Ga0214543_1000011 3300021327 Bacteria 344093
74 Ga0214543_1000032 3300021327 Bacteria 200766
75 Ga0209435_100022 3300025206 Bacteria 207766
76 Ga0209437_100160 3300025233 Bacteria 149451
77 Ga0209437_100310 3300025233 Bacteria 65905
78 Ga0209646_1000078 3300025246 Bacteria 207766
79 Ga0209026_1000065 3300025250 Bacteria 207766
80 Ga0209677_100545 3300025253 Bacteria 20941
81 Ga0209148_1006730 3300025254 Bacteria 2460
82 Ga0209759_1000055 3300025256 Bacteria 207766
83 Ga0209759_1013023 3300025256 Bacteria 2271
84 Ga0209129_1000349 3300025258 Bacteria 38942
85 Ga0209233_1000168 3300025261 Bacteria 149312
86 Ga0209233_1000303 3300025261 Bacteria 59138
87 Ga0209233_1000594 3300025261 Bacteria 18858
88 Ga0209233_1039512 3300025261 Bacteria 1033
89 Ga0209673_1000068 3300025273 Bacteria 245891
90 Ga0209130_1000012 3300025284 Bacteria 421329
91 Ga0209676_1040587 3300025292 Bacteria 1309
92 Ga0209025_1000320 3300025294 Bacteria 106773
93 Ga0209025_1000949 3300025294 Bacteria 43938
94 Ga0209564_1070581 3300025295 Bacteria 728
95 Ga0209758_1023693 3300025297 Bacteria 2766
96 Ga0209758_1063642 3300025297 Bacteria 1200
97 Ga0209256_1002171 3300025299 Bacteria 16856
98 Ga0209256_1032466 3300025299 Bacteria 1415
99 Ga0207426_1000010 3300025302 Bacteria 796003
100 Ga0209257_1035464 3300025304 Bacteria 1544
101 Ga0207656_10181827 3300025321 Bacteria 1009
102 Ga0207692_10436109 3300025898 Bacteria 822
103 Ga0207705_10754121 3300025909 Bacteria 756
104 Ga0207707_10263055 3300025912 Bacteria 1497
105 Ga0207707_10418804 3300025912 Bacteria 1149
106 Ga0207695_10000011 3300025913 Bacteria 910221
107 Ga0207671_10001291 3300025914 Bacteria 29425
108 Ga0207652_10109673 3300025921 Bacteria 2447
109 Ga0207652_10189902 3300025921 Bacteria 1848
110 Ga0207681_11720625 3300025923 Bacteria 524
111 Ga0207700_10696111 3300025928 Bacteria 907
112 Ga0207700_11175491 3300025928 Bacteria 685
113 Ga0207664_10017152 3300025929 Bacteria 5300
114 Ga0207664_10438008 3300025929 Bacteria 1165
115 Ga0207664_10614120 3300025929 Bacteria 977
116 Ga0207670_10366384 3300025936 Bacteria 1144
117 Ga0207640_10021585 3300025981 Bacteria 3840
118 Ga0207702_10351078 3300026078 Bacteria 1411
119 Ga0207676_12301401 3300026095 Bacteria 536
120 Ga0207698_10015324 3300026142 Bacteria 5129
121 Ga0209371_1001716 3300027312 Bacteria 13867
122 Ga0207428_10003786 3300027907 Bacteria 14512
123 Ga0268266_10034834 3300028379 Bacteria 4283
124 Ga0307515_10000274 3300028794 Bacteria 126011
125 Ga0307515_10022134 3300028794 Bacteria 11218
126 Ga0265338_10808578 3300028800 Bacteria 642
127 Ga0268256_1000997 3300030500 Bacteria 19214
128 Ga0265325_10000643 3300031241 Bacteria 25400
129 Ga0265340_10167268 3300031247 Bacteria 997
130 Ga0265340_10248218 3300031247 Bacteria 794
131 Ga0265339_10000953 3300031249 Bacteria 22121
132 Ga0265316_10206387 3300031344 Bacteria 1455
133 Ga0265316_10717582 3300031344 Bacteria 704
134 Ga0307513_10020747 3300031456 Bacteria 7779
135 Ga0265313_10029898 3300031595 Bacteria 2811
136 Ga0265313_10207081 3300031595 Bacteria 814
137 Ga0316579_10031779 3300031691 Bacteria 2418
138 Ga0307412_11429980 3300031911 Bacteria 627
139 Ga0307414_10043240 3300032004 Bacteria 3067
140 Ga0373953_0135838 3300035117 Bacteria 1050
141 Ga0373956_0060129 3300035119 Bacteria 1720
142 Ga0373956_0062564 3300035119 Bacteria 1687
143 Ga0373957_0077258 3300035120 Bacteria 1310
144 Ga0373946_0058668 3300035171 Bacteria 1631
145 Ga0316574_0165742 3300035398 Bacteria 1423
146 Ga0373924_0109878 3300035410 Bacteria 1191
147 Ga0373935_0385935 3300035692 Bacteria 1003
148 Ga0373927_0000055 3300035695 Bacteria 81098
149 Ga0373933_0042846 3300035724 Bacteria 2676
150 Ga0373933_0053775 3300035724 Bacteria 2412
151 Ga0373933_0804317 3300035724 Bacteria 619
152 Ga0373937_0061346 3300036401 Bacteria 3456
153 Ga0373925_0011698 3300037068 Bacteria 6346
154 Ga0395900_0022784 3300037418 Bacteria 6408
155 Ga0395900_1508010 3300037418 Bacteria 584
156 Ga0395905_0010545 3300037471 Bacteria 8975
157 Ga0436364_0702307 3300037853 Bacteria 4678
158 Ga0436361_1129876 3300039447 Bacteria 788
159 Ga0439465_0057771 3300041413 Bacteria 1281
160 Ga0439465_0310400 3300041413 Bacteria 591
161 Ga0439432_192964 3300042006 Bacteria 591
162 Ga0450920_004827 3300042122 Bacteria 2383
163 Ga0439446_0333632 3300042156 Bacteria 538
164 Ga0439434_0023554 3300042435 Bacteria 1855
165 Ga0450918_015592 3300042531 Bacteria 1321
166 Ga0466968_0061815 3300044735 Bacteria 1616
167 Ga0466967_1493868 3300045976 Bacteria 673
168 Ga0495592_0027496 3300046454 Bacteria 4313
169 Ga0495629_0005126 3300046459 Bacteria 9797
170 Ga0495641_0267010 3300046461 Bacteria 770
171 Ga0495639_0028535 3300046475 Bacteria 2473
172 Ga0495662_0008017 3300046476 Bacteria 5202
173 Ga0495606_0305198 3300046507 Bacteria 861
174 Ga0495618_0544816 3300046514 Bacteria 695
175 Ga0495632_0007052 3300046519 Bacteria 7120
176 Ga0495648_0209391 3300046524 Bacteria 970
177 Ga0495666_0469159 3300046526 Bacteria 563
178 Ga0495652_0222768 3300046529 Bacteria 1417
179 Ga0495640_0337365 3300046533 Bacteria 932
180 Ga0495587_0051571 3300046536 Bacteria 2432
181 Ga0495622_0166784 3300046557 Bacteria 991
182 Ga0495667_0229876 3300046559 Bacteria 1182
183 Ga0495634_0178213 3300046642 Bacteria 1332
184 Ga0495625_0074820 3300046660 Bacteria 2371
185 Ga0495625_0531084 3300046660 Bacteria 715
186 Ga0495635_0212677 3300046663 Bacteria 1309
187 Ga0495588_0018739 3300046674 Bacteria 3379
188 Ga0495588_0086652 3300046674 Bacteria 1638
189 Ga0495657_0018041 3300046675 Bacteria 5116
190 Ga0495623_0094822 3300046679 Bacteria 1825
191 Ga0495646_0177182 3300046680 Bacteria 1172
192 Ga0495658_0118681 3300046683 Bacteria 1598
193 Ga0495600_0029445 3300046809 Bacteria 3555
194 Ga0495604_0058070 3300047317 Bacteria 2972
195 Ga0495604_0311708 3300047317 Bacteria 1054
196 Ga0495674_0234777 3300047319 Bacteria 1513
197 Ga0495672_0025106 3300047320 Bacteria 3822
198 Ga0495676_0084914 3300047321 Bacteria 2387
199 Ga0495676_0085393 3300047321 Bacteria 2378
200 Ga0495602_0099087 3300048088 Bacteria 2397
201 Ga0496100_0047744 3300048903 Bacteria 2761
202 Ga0496100_0437644 3300048903 Bacteria 1001
203 Ga0496101_1037354 3300048904 Bacteria 644
204 Ga0496102_0037869 3300048905 Bacteria 4350
205 Ga0496102_0121776 3300048905 Bacteria 2437
206 Ga0496103_0142435 3300048906 Bacteria 1534
207 Ga0496104_0002270 3300048907 Bacteria 16574
208 Ga0496104_1027387 3300048907 Bacteria 728
209 Ga0496105_0069303 3300048908 Bacteria 2914
210 Ga0496106_0161679 3300048909 Bacteria 1771
211 Ga0496106_0395941 3300048909 Bacteria 1110
212 Ga0496107_0024441 3300048910 Bacteria 4274
213 Ga0496107_0824012 3300048910 Bacteria 679
214 Ga0496108_0007026 3300048911 Bacteria 9116
215 Ga0496109_0035133 3300048912 Bacteria 4519
216 Ga0496109_1694556 3300048912 Bacteria 566
217 Ga0496110_0674161 3300048913 Bacteria 934
218 Ga0496111_0032237 3300048914 Bacteria 3735
219 Ga0496112_0015450 3300048915 Bacteria 7127
220 Ga0496112_0338660 3300048915 Bacteria 1448
221 Ga0496113_0017362 3300048916 Bacteria 4993
222 Ga0496113_0124965 3300048916 Bacteria 2014
223 Ga0496115_0008747 3300048918 Bacteria 7506
224 Ga0496116_0017284 3300048919 Bacteria 5607
225 Ga0496116_0369528 3300048919 Bacteria 648
226 Ga0496117_0000338 3300048920 Bacteria 82688
227 Ga0496117_0006495 3300048920 Bacteria 11801
228 Ga0496118_0000958 3300048921 Bacteria 45054
229 Ga0496119_0004524 3300048922 Bacteria 13799
230 Ga0496119_0016820 3300048922 Bacteria 5537
231 Ga0496119_0191270 3300048922 Bacteria 1066
232 Ga0496121_0000612 3300048924 Bacteria 66397
233 Ga0496121_0004568 3300048924 Bacteria 18460
234 Ga0496121_0265203 3300048924 Bacteria 1183
235 Ga0496121_0279077 3300048924 Bacteria 1144
236 Ga0496121_0433565 3300048924 Bacteria 852
237 Ga0496121_0764679 3300048924 Bacteria 572
238 Ga0496122_0001265 3300048925 Bacteria 42335
239 Ga0496122_0037414 3300048925 Bacteria 3906
240 Ga0496122_0092560 3300048925 Bacteria 2054
241 Ga0496123_0000043 3300048926 Bacteria 253752
242 Ga0496123_0022796 3300048926 Bacteria 4812
243 Ga0496123_0054439 3300048926 Bacteria 2634
244 Ga0496124_0026216 3300048927 Bacteria 5261
245 Ga0496124_0029341 3300048927 Bacteria 4903
246 Ga0496124_0030229 3300048927 Bacteria 4811
247 Ga0496125_0014418 3300048928 Bacteria 7697
248 Ga0496125_0048248 3300048928 Bacteria 3553
249 Ga0496125_0110871 3300048928 Bacteria 1987
250 Ga0496125_0182014 3300048928 Bacteria 1399
251 Ga0496126_0001099 3300048929 Bacteria 45449
252 Ga0496126_0060135 3300048929 Bacteria 3418
253 Ga0496126_0173233 3300048929 Bacteria 1837
254 Ga0501315_071841 3300049531 Bacteria 575
255 Ga0501031_0064008 3300049568 Bacteria 2395
256 Ga0501031_0504379 3300049568 Bacteria 780
257 Ga0501032_0005962 3300049569 Bacteria 8994
258 Ga0501032_0056419 3300049569 Bacteria 2640
259 Ga0501032_0068559 3300049569 Bacteria 2368
260 Ga0501032_0212985 3300049569 Bacteria 1259
261 Ga0501032_0653780 3300049569 Bacteria 667
262 Ga0501033_0008543 3300049570 Bacteria 7922
263 Ga0501033_0020663 3300049570 Bacteria 4974
264 Ga0501033_0185781 3300049570 Bacteria 1489
265 Ga0501033_0564508 3300049570 Bacteria 783
266 Ga0501034_0110733 3300049571 Bacteria 2736
267 Ga0501034_0133244 3300049571 Bacteria 2467
268 Ga0501034_0137134 3300049571 Bacteria 2427
269 Ga0501034_0142303 3300049571 Bacteria 2377
270 Ga0501034_0167148 3300049571 Bacteria 2168
271 Ga0501034_0284501 3300049571 Bacteria 1593
272 Ga0501036_0032196 3300049572 Bacteria 4430
273 Ga0501036_0110701 3300049572 Bacteria 2320
274 Ga0501036_0114635 3300049572 Bacteria 2277
275 Ga0501036_0121302 3300049572 Bacteria 2207
276 Ga0501037_0018959 3300049573 Bacteria 5071
277 Ga0501037_0037763 3300049573 Bacteria 3561
278 Ga0501037_0102930 3300049573 Bacteria 2059
279 Ga0501037_0366917 3300049573 Bacteria 991
280 Ga0501038_0015813 3300049574 Bacteria 6855
281 Ga0501038_0071920 3300049574 Bacteria 2932
282 Ga0501038_0299911 3300049574 Bacteria 1261
283 Ga0501038_0494874 3300049574 Bacteria 935
284 Ga0501039_0051470 3300049575 Bacteria 3187
285 Ga0501039_0054609 3300049575 Bacteria 3092
286 Ga0501039_0447999 3300049575 Bacteria 1014
287 Ga0501043_0052072 3300049579 Bacteria 3216
288 Ga0501043_0090646 3300049579 Bacteria 2404
289 Ga0501043_0099850 3300049579 Bacteria 2281
290 Ga0501043_0320809 3300049579 Bacteria 1181
291 Ga0501046_0040574 3300049580 Bacteria 3718
292 Ga0501046_0091421 3300049580 Bacteria 2341
293 Ga0501047_0004381 3300049581 Bacteria 13286
294 Ga0501047_0168794 3300049581 Bacteria 2058
295 Ga0501047_0263645 3300049581 Bacteria 1570
296 Ga0501047_0266190 3300049581 Bacteria 1561
297 Ga0501047_0267645 3300049581 Bacteria 1555
298 Ga0501047_0320253 3300049581 Bacteria 1390
299 Ga0501047_0704785 3300049581 Bacteria 827
300 Ga0501048_0559327 3300049582 Bacteria 821
301 Ga0501067_0002317 3300049583 Bacteria 10528
302 Ga0501067_0188449 3300049583 Bacteria 1149
303 Ga0501068_0089991 3300049584 Bacteria 1893
304 Ga0501069_0066924 3300049585 Bacteria 2009
305 Ga0501070_0011025 3300049586 Bacteria 7630
306 Ga0501070_0044627 3300049586 Bacteria 3687
307 Ga0501070_0251627 3300049586 Bacteria 1445
308 Ga0501070_0289313 3300049586 Bacteria 1335
309 Ga0501070_0547932 3300049586 Bacteria 926
310 Ga0501071_1487463 3300049587 Bacteria 523
311 Ga0501072_0012673 3300049588 Bacteria 6446
312 Ga0501073_0005983 3300049589 Bacteria 9077
313 Ga0501073_0047000 3300049589 Bacteria 3034
314 Ga0501073_0706228 3300049589 Bacteria 696
315 Ga0501074_0062371 3300049590 Bacteria 2684
316 Ga0501075_0716376 3300049591 Bacteria 762
317 Ga0501077_0862365 3300049593 Bacteria 582
318 Ga0501079_0353170 3300049741 Bacteria 1152
319 Ga0501080_0427904 3300049742 Bacteria 1188
320 Ga0501080_0880812 3300049742 Bacteria 781
321 Ga0501080_1646210 3300049742 Bacteria 543
322 Ga0501083_0262870 3300049744 Bacteria 1123
323 Ga0501280_003338 3300049776 Bacteria 2483
324 Ga0501280_006856 3300049776 Bacteria 1600
325 Ga0501035_0004352 3300049822 Bacteria 13446
326 Ga0501035_0032607 3300049822 Bacteria 4738
327 Ga0501035_0155478 3300049822 Bacteria 1982
328 Ga0501035_0416047 3300049822 Bacteria 1116
329 Ga0501044_0030062 3300049823 Bacteria 5725
330 Ga0501044_0035226 3300049823 Bacteria 5243
331 Ga0501044_0035366 3300049823 Bacteria 5231
332 Ga0501044_0567450 3300049823 Bacteria 1030
333 nmdc:mga00v17_608330_c1 3300050491 Bacteria 704
334 nmdc:mga05p37_5554_c1 3300050507 Bacteria 14822
335 nmdc:mga09592_16793_c1 3300050508 Bacteria 5991
336 nmdc:mga0qj67_8335_c1 3300050509 Bacteria 7684
337 nmdc:mga06r32_1399_c1 3300050510 Bacteria 21806
338 nmdc:mga06r32_293613_c1 3300050510 Bacteria 1612
339 nmdc:mga08y16_2157_c1 3300050511 Bacteria 20180
340 nmdc:mga08y16_445069_c1 3300050511 Bacteria 1322
341 nmdc:mga0n895_90476_c1 3300050512 Bacteria 3062
342 nmdc:mga0rr50_211387_c1 3300050513 Bacteria 1598
343 nmdc:mga08x19_511399_c1 3300050514 Bacteria 848
344 nmdc:mga0a205_28315_c1 3300050515 Bacteria 5356
345 Ga0495601_0132758 3300053077 Bacteria 1622
346 Ga0495619_0308761 3300053085 Bacteria 1095
347 Ga0495619_1149651 3300053085 Bacteria 515
348 Ga0500646_0322803 3300053090 Bacteria 558
349 Ga0500614_062185 3300053123 Bacteria 1007
350 Ga0500618_003422 3300053125 Bacteria 5447
351 Ga0500573_0001192 3300053140 Bacteria 12152
352 Ga0500590_007617 3300053148 Bacteria 5363
353 Ga0500619_030604 3300053154 Bacteria 1637
354 Ga0500636_0278176 3300053177 Bacteria 837
355 Ga0501084_0050149 3300054114 Bacteria 3494
356 Ga0501082_0537896 3300060353 Bacteria 1022
357 Ga0501082_0940680 3300060353 Bacteria 756
358 2509376217 2509276019 Bacteria 6802256
359 2510841070 2510461069 Bacteria 5505000
360 2511133689 2510917022 Bacteria 6504556
361 2513909768 2513237144 Bacteria 7530820
362 2513926538 2513237146 Bacteria 7166346
363 2514000328 2513237159 Bacteria 6810126
364 2523468088 2523231067 Bacteria 5230452
365 2524462663 2524023209 Bacteria 6679728
366 2558863086 2558860100 Bacteria 8458965
367 2585168345 2582581283 Bacteria 6030556
368 2585268972 2582581306 Bacteria 6450535
369 2585270579 2582581307 Bacteria 6597605
370 2585276924 2582581308 Bacteria 7413247
371 2585324073 2582581315 Bacteria 7318924
372 2585333533 2582581316 Bacteria 7774528
373 2585389497 2582581865 Bacteria 6644329
374 2585393890 2582581866 Bacteria 6859583
375 2585534770 2585427527 Bacteria 7273426
376 2585551784 2585427530 Bacteria 7383882
377 2585558283 2585427531 Bacteria 6992870
378 2585897677 2585427608 Bacteria 6544331
379 2585904728 2585427609 Bacteria 6667127
380 2587980156 2585428125 Bacteria 6662905
381 2599331504 2599185156 Bacteria 5403036
382 2599418031 2599185170 Bacteria 7295545
383 2616308297 2615840626 Bacteria 7921970
384 2616556642 2615840698 Bacteria 7319877
385 2617381650 2617270742 Bacteria 6808054
386 2644210981 2643221637 Bacteria 5345260
387 2644239247 2643221643 Bacteria 5749658
388 2644300348 2643221653 Bacteria 4569637
389 2644494676 2643221688 Bacteria 5260751
390 2644499053 2643221689 Bacteria 6042950
391 2644654636 2643221718 Bacteria 5345506
392 2644658572 2643221719 Bacteria 4568197
393 2657683665 2657244999 Bacteria 5946535
394 2671115694 2667528174 Bacteria 6435400
395 2739350117 2738543031 Bacteria 5769731
396 2776913270 2775507049 Bacteria 6284736
397 2778176437 2775507266 Bacteria 7392367
398 2792581157 2791355082 Bacteria 5973319
399 2793279510 2791355253 Bacteria 5171699
400 2804751898 2802429268 Bacteria 6094027
401 2819242034 2818991272 Bacteria 4622173
402 2819610449 2818991448 Bacteria 6772224
403 2819638188 2818991453 Bacteria 7181617
404 2838032170 2838029111 Bacteria 6603031
405 2838040969 2838035591 Bacteria 7166484
406 2838666186 2838661181 Bacteria 7385261
407 2842301878 2842298080 Bacteria 6123127
408 2842362324 2842357229 Bacteria 6485165
409 2842479201 2842475841 Bacteria 6603183
410 2842487172 2842482326 Bacteria 7212537
411 2842506079 2842502639 Bacteria 6604161
412 2842510170 2842509118 Bacteria 6850950
413 2842525998 2842521101 Bacteria 6569494
414 2842923901 2842922631 Bacteria 5824079
415 2850080844 2850079185 Bacteria 6848280
416 2852389578 2852387548 Bacteria 8025568
417 2891374210 2891373044 Bacteria 5202277
418 2913300487 2913295892 Bacteria 6333755
419 2919409747 2919408235 Bacteria 6149349
420 2920765618 2920760137 Bacteria 7427611
421 2933017557 2933016740 Bacteria 6355406
422 2989353034 2989349275 Bacteria 6349068
423 2989778691 2989776772 Bacteria 4843317
424 2995393329 2995392953 Bacteria 4539380
425 3005409671 3005409236 Bacteria 7188837
426 3005420387 3005416602 Bacteria 7064308
427 8005250736 8005246636 Bacteria 4933972
428 8005317338 8005314921 Bacteria 7072929
429 8005486596 8005484373 Bacteria 6297373
430 8005646260 8005645114 Bacteria 6950293
431 8005659351 8005658619 Bacteria 4500593
432 8018155634 8018150411 Bacteria 5549903
433 8024492537 8024486573 Bacteria 6540512
434 8046770305 8046767195 Bacteria 7547379
435 8049294433 8049293176 Bacteria 6128433
436 8057578233 8057575449 Bacteria 7367519
437 Ga0207669_10652572
438 JGI25155J39150_1000011
439 JGI25156J39149_1000027
440 JGI25156J39149_1000030
441 JGI25162J39368_1002899
442 JGI25162J39368_1002900
443 JGI25154J39366_1000057
444 JGI25157J39369_1000010
445 JGI25152J39213_1004312
446 JGI25159J45721_1001890
447 JGI25151J46595_10001641
448 JGI25151J46595_10057293
449 JGI25165J46597_1002487
450 JGI25165J46597_1002504
451 JGI25165J46597_1011180
452 rootH1_10106418
453 rootH2_10177198
454 rootL2_10001766
455 rootL2_10001767
456 JGI25160J50197_1000004
457 JGI25161J50226_1000003
458 Ga0055526_1021905
459 Ga0055524_1011436
460 Ga0055528_1001889
461 Ga0055543_1000001
462 Ga0065165_1000049
463 Ga0065165_1015257
464 Ga0070658_10305979
465 Ga0070660_100944264
466 Ga0070689_100309887
467 Ga0070669_100884344
468 Ga0070667_100203072
469 Ga0070714_100139185
470 Ga0070714_100227002
471 Ga0070710_10166205
472 Ga0070710_11037716
473 Ga0070681_10424116
474 Ga0070679_100092935
475 Ga0068853_101370050
476 Ga0070665_100019094
477 Ga0068854_100023587
478 Ga0068856_100140755
479 Ga0068856_100294104
480 Ga0068852_100035348
481 Ga0068864_102378626
482 Ga0068851_10191441
483 Ga0075364_10426046
484 Ga0070712_101428151
485 Ga0075370_10007141
486 Ga0075428_100002909
487 Ga0075430_100020618
488 Ga0075431_100000417
489 Ga0075433_10312413
490 Ga0075434_100100936
491 Ga0075429_100004216
492 Ga0075436_100339638
493 Ga0105240_10000005
494 Ga0111539_10004674
495 Ga0105245_11069739
496 Ga0114129_10002339
497 Ga0105243_10678284
498 Ga0105237_10002240
499 Ga0105239_10000739
500 Ga0157370_10006233
501 Ga0157370_10551852
502 Ga0157369_10232742
503 Ga0157372_10741426
504 Ga0163163_10007735
505 Ga0182007_10001732
506 Ga0214544_1000024
507 Ga0214542_1000015
508 Ga0214542_1026314
509 Ga0214543_1000011
510 Ga0214543_1000032
511 Ga0209435_100022
512 Ga0209437_100160
513 Ga0209437_100310
514 Ga0209646_1000078
515 Ga0209026_1000065
516 Ga0209677_100545
517 Ga0209148_1006730
518 Ga0209759_1000055
519 Ga0209759_1013023
520 Ga0209129_1000349
521 Ga0209233_1000168
522 Ga0209233_1000303
523 Ga0209233_1000594
524 Ga0209233_1039512
525 Ga0209673_1000068
526 Ga0209130_1000012
527 Ga0209676_1040587
528 Ga0209025_1000320
529 Ga0209025_1000949
530 Ga0209564_1070581
531 Ga0209758_1023693
532 Ga0209758_1063642
533 Ga0209256_1002171
534 Ga0209256_1032466
535 Ga0207426_1000010
536 Ga0209257_1035464
537 Ga0207656_10181827
538 Ga0207692_10436109
539 Ga0207705_10754121
540 Ga0207707_10263055
541 Ga0207707_10418804
542 Ga0207695_10000011
543 Ga0207671_10001291
544 Ga0207652_10109673
545 Ga0207652_10189902
546 Ga0207681_11720625
547 Ga0207700_10696111
548 Ga0207700_11175491
549 Ga0207664_10017152
550 Ga0207664_10438008
551 Ga0207664_10614120
552 Ga0207670_10366384
553 Ga0207640_10021585
554 Ga0207702_10351078
555 Ga0207676_12301401
556 Ga0207698_10015324
557 Ga0209371_1001716
558 Ga0207428_10003786
559 Ga0268266_10034834
560 Ga0307515_10000274
561 Ga0307515_10022134
562 Ga0265338_10808578
563 Ga0268256_1000997
564 Ga0265325_10000643
565 Ga0265340_10167268
566 Ga0265340_10248218
567 Ga0265339_10000953
568 Ga0265316_10206387
569 Ga0265316_10717582
570 Ga0307513_10020747
571 Ga0265313_10029898
572 Ga0265313_10207081
573 Ga0316579_10031779
574 Ga0307412_11429980
575 Ga0307414_10043240
576 Ga0373953_0135838
577 Ga0373956_0060129
578 Ga0373956_0062564
579 Ga0373957_0077258
580 Ga0373946_0058668
581 Ga0316574_0165742
582 Ga0373924_0109878
583 Ga0373935_0385935
584 Ga0373927_0000055
585 Ga0373933_0042846
586 Ga0373933_0053775
587 Ga0373933_0804317
588 Ga0373937_0061346
589 Ga0373925_0011698
590 Ga0395900_0022784
591 Ga0395900_1508010
592 Ga0395905_0010545
593 Ga0436364_0702307
594 Ga0436361_1129876
595 Ga0439465_0057771
596 Ga0439465_0310400
597 Ga0439432_192964
598 Ga0450920_004827
599 Ga0439446_0333632
600 Ga0439434_0023554
601 Ga0450918_015592
602 Ga0466968_0061815
603 Ga0466967_1493868
604 Ga0495592_0027496
605 Ga0495629_0005126
606 Ga0495641_0267010
607 Ga0495639_0028535
608 Ga0495662_0008017
609 Ga0495606_0305198
610 Ga0495618_0544816
611 Ga0495632_0007052
612 Ga0495648_0209391
613 Ga0495666_0469159
614 Ga0495652_0222768
615 Ga0495640_0337365
616 Ga0495587_0051571
617 Ga0495622_0166784
618 Ga0495667_0229876
619 Ga0495634_0178213
620 Ga0495625_0074820
621 Ga0495625_0531084
622 Ga0495635_0212677
623 Ga0495588_0018739
624 Ga0495588_0086652
625 Ga0495657_0018041
626 Ga0495623_0094822
627 Ga0495646_0177182
628 Ga0495658_0118681
629 Ga0495600_0029445
630 Ga0495604_0058070
631 Ga0495604_0311708
632 Ga0495674_0234777
633 Ga0495672_0025106
634 Ga0495676_0084914
635 Ga0495676_0085393
636 Ga0495602_0099087
637 Ga0496100_0047744
638 Ga0496100_0437644
639 Ga0496101_1037354
640 Ga0496102_0037869
641 Ga0496102_0121776
642 Ga0496103_0142435
643 Ga0496104_0002270
644 Ga0496104_1027387
645 Ga0496105_0069303
646 Ga0496106_0161679
647 Ga0496106_0395941
648 Ga0496107_0024441
649 Ga0496107_0824012
650 Ga0496108_0007026
651 Ga0496109_0035133
652 Ga0496109_1694556
653 Ga0496110_0674161
654 Ga0496111_0032237
655 Ga0496112_0015450
656 Ga0496112_0338660
657 Ga0496113_0017362
658 Ga0496113_0124965
659 Ga0496115_0008747
660 Ga0496116_0017284
661 Ga0496116_0369528
662 Ga0496117_0000338
663 Ga0496117_0006495
664 Ga0496118_0000958
665 Ga0496119_0004524
666 Ga0496119_0016820
667 Ga0496119_0191270
668 Ga0496121_0000612
669 Ga0496121_0004568
670 Ga0496121_0265203
671 Ga0496121_0279077
672 Ga0496121_0433565
673 Ga0496121_0764679
674 Ga0496122_0001265
675 Ga0496122_0037414
676 Ga0496122_0092560
677 Ga0496123_0000043
678 Ga0496123_0022796
679 Ga0496123_0054439
680 Ga0496124_0026216
681 Ga0496124_0029341
682 Ga0496124_0030229
683 Ga0496125_0014418
684 Ga0496125_0048248
685 Ga0496125_0110871
686 Ga0496125_0182014
687 Ga0496126_0001099
688 Ga0496126_0060135
689 Ga0496126_0173233
690 Ga0501315_071841
691 Ga0501031_0064008
692 Ga0501031_0504379
693 Ga0501032_0005962
694 Ga0501032_0056419
695 Ga0501032_0068559
696 Ga0501032_0212985
697 Ga0501032_0653780
698 Ga0501033_0008543
699 Ga0501033_0020663
700 Ga0501033_0185781
701 Ga0501033_0564508
702 Ga0501034_0110733
703 Ga0501034_0133244
704 Ga0501034_0137134
705 Ga0501034_0142303
706 Ga0501034_0167148
707 Ga0501034_0284501
708 Ga0501036_0032196
709 Ga0501036_0110701
710 Ga0501036_0114635
711 Ga0501036_0121302
712 Ga0501037_0018959
713 Ga0501037_0037763
714 Ga0501037_0102930
715 Ga0501037_0366917
716 Ga0501038_0015813
717 Ga0501038_0071920
718 Ga0501038_0299911
719 Ga0501038_0494874
720 Ga0501039_0051470
721 Ga0501039_0054609
722 Ga0501039_0447999
723 Ga0501043_0052072
724 Ga0501043_0090646
725 Ga0501043_0099850
726 Ga0501043_0320809
727 Ga0501046_0040574
728 Ga0501046_0091421
729 Ga0501047_0004381
730 Ga0501047_0168794
731 Ga0501047_0263645
732 Ga0501047_0266190
733 Ga0501047_0267645
734 Ga0501047_0320253
735 Ga0501047_0704785
736 Ga0501048_0559327
737 Ga0501067_0002317
738 Ga0501067_0188449
739 Ga0501068_0089991
740 Ga0501069_0066924
741 Ga0501070_0011025
742 Ga0501070_0044627
743 Ga0501070_0251627
744 Ga0501070_0289313
745 Ga0501070_0547932
746 Ga0501071_1487463
747 Ga0501072_0012673
748 Ga0501073_0005983
749 Ga0501073_0047000
750 Ga0501073_0706228
751 Ga0501074_0062371
752 Ga0501075_0716376
753 Ga0501077_0862365
754 Ga0501079_0353170
755 Ga0501080_0427904
756 Ga0501080_0880812
757 Ga0501080_1646210
758 Ga0501083_0262870
759 Ga0501280_003338
760 Ga0501280_006856
761 Ga0501035_0004352
762 Ga0501035_0032607
763 Ga0501035_0155478
764 Ga0501035_0416047
765 Ga0501044_0030062
766 Ga0501044_0035226
767 Ga0501044_0035366
768 Ga0501044_0567450
769 nmdc:mga00v17_608330_c1
770 nmdc:mga05p37_5554_c1
771 nmdc:mga09592_16793_c1
772 nmdc:mga0qj67_8335_c1
773 nmdc:mga06r32_1399_c1
774 nmdc:mga06r32_293613_c1
775 nmdc:mga08y16_2157_c1
776 nmdc:mga08y16_445069_c1
777 nmdc:mga0n895_90476_c1
778 nmdc:mga0rr50_211387_c1
779 nmdc:mga08x19_511399_c1
780 nmdc:mga0a205_28315_c1
781 Ga0495601_0132758
782 Ga0495619_0308761
783 Ga0495619_1149651
784 Ga0500646_0322803
785 Ga0500614_062185
786 Ga0500618_003422
787 Ga0500573_0001192
788 Ga0500590_007617
789 Ga0500619_030604
790 Ga0500636_0278176
791 Ga0501084_0050149
792 Ga0501082_0537896
793 Ga0501082_0940680
794 2509376217
795 2510841070
796 2511133689
797 2513909768
798 2513926538
799 2514000328
800 2523468088
801 2524462663
802 2558863086
803 2585168345
804 2585268972
805 2585270579
806 2585276924
807 2585324073
808 2585333533
809 2585389497
810 2585393890
811 2585534770
812 2585551784
813 2585558283
814 2585897677
815 2585904728
816 2587980156
817 2599331504
818 2599418031
819 2616308297
820 2616556642
821 2617381650
822 2644210981
823 2644239247
824 2644300348
825 2644494676
826 2644499053
827 2644654636
828 2644658572
829 2657683665
830 2671115694
831 2739350117
832 2776913270
833 2778176437
834 2792581157
835 2793279510
836 2804751898
837 2819242034
838 2819610449
839 2819638188
840 2838032170
841 2838040969
842 2838666186
843 2842301878
844 2842362324
845 2842479201
846 2842487172
847 2842506079
848 2842510170
849 2842525998
850 2842923901
851 2850080844
852 2852389578
853 2891374210
854 2913300487
855 2919409747
856 2920765618
857 2933017557
858 2989353034
859 2989778691
860 2995393329
861 3005409671
862 3005420387
863 8005250736
864 8005317338
865 8005486596
866 8005646260
867 8005659351
868 8018155634
869 8024492537
870 8046770305
871 8049294433
872 8057578233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

24

148

0.91

PF03061

4HBT

Thioesterase superfamily

74

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zw0-assembly1.cif.gz_C crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from candidatus asiaticum 0.9728 9 151
4h4g-assembly1.cif.gz_B crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9643 12 144
4h4g-assembly2.cif.gz_H-2 crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9633 13 150
3doz-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase (fabz) from helicobacter pylori in complex with compound 3k 0.9624 10 152
3d6x-assembly1.cif.gz_A crystal structure of campylobacter jejuni fabz 0.9616 12 150
ID Description Score Start End Superfamily
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9578 9 148 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9529 12 148 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9529 12 151 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9522 12 150 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9452 12 150 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2G6NWY1-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9695 11 152 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
GO:0046872
GO:0103117
AF-H0G8A9-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) 0.9664 4 111 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-M1E447-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9658 12 151 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A437MJL4-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9653 10 152 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2D7BQS1-F1-model_v4 Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acylglucosamine N-acyltransferase (EC 2.3.1.191)] 0.9651 6 153 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0016410
GO:0019171

Map