F443593

General Info

Members Datasets Scaffolds Average Seq Length
436 289 872 175

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000224|Ga0395900_0000224_48153_48752
Length 199
Sequence MAHDGNGQPTAAAASDAAAGRSSPTATDARRGRWRRLLRHRWHDERDALRLLGDGALDRLQQRVQASERRHTGEIRVCVEAGLPLSYLWRGAGARERAIAMFGKLRVWDTEHDNGVLIYLLLAERAIEIVADRGLARRVPVGIWPALVARMADGFRNGRFEDGLAQAIDTVEGLLVQHFPLAEGAQRPNELPDRPYIAG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
158 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
159 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
235 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
236 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
237 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
247 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
248 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
249 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
250 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
251 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
252 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
253 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
257 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
260 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
261 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
264 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
267 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
268 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
269 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
270 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
271 2643221658 Variovorax sp. Root411 Isolate Unclassified
272 2643221672 Variovorax sp. Root434 Isolate Unclassified
273 2738541277 Variovorax sp. GV051 Isolate Unclassified
274 2738541307 Variovorax sp. GV008 Isolate Unclassified
275 2738543019 Variovorax sp. GV040 Isolate Unclassified
276 2818991446 Variovorax sp. 1180 Isolate Unclassified
277 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
278 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
279 2885198086 Variovorax sp. 679 Isolate Unclassified
280 2885211737 Variovorax sp. 553 Isolate Unclassified
281 2899924645 Variovorax sp. 369 Isolate Unclassified
282 2928037797 Variovorax sp. 1126 Isolate Unclassified
283 2928044640 Variovorax sp. 1128 Isolate Unclassified
284 2928051484 Variovorax sp. 1133 Isolate Unclassified
285 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
286 2928070936 Variovorax gossypii 1167 Isolate Unclassified
287 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
288 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
289 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.04
Metatranscriptomes 0.46
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.06
Nodule 0.69
Rhizoplane 5.28
Rhizosphere 56.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0000224 3300037418 Bacteria 89200
2 JGI25152J39213_1010091 3300002773 Bacteria 2185
3 JGI25150J39212_1001540 3300002774 Bacteria 6318
4 JGI25159J45721_1017175 3300002987 Bacteria 1507
5 JGI25151J46595_10013609 3300003187 Bacteria 3655
6 JGI25151J46595_10030788 3300003187 Bacteria 2105
7 JGI25153J46596_10011476 3300003215 Bacteria 3910
8 JGI25153J46596_10014634 3300003215 Bacteria 3248
9 rootH2_10086219 3300003320 Bacteria 3184
10 JGI25160J50197_1008785 3300003354 Bacteria 3817
11 Ga0006562J51391_1072711 3300003578 Bacteria 2626
12 Ga0055527_1008538 3300003760 Bacteria 1221
13 Ga0055535_1002945 3300003761 Bacteria 5274
14 Ga0055542_1000058 3300003762 Bacteria 162781
15 Ga0055526_1013675 3300003771 Bacteria 3410
16 Ga0055526_1021643 3300003771 Bacteria 2226
17 Ga0055537_1007943 3300003773 Bacteria 2495
18 Ga0055524_1000307 3300003775 Bacteria 46545
19 Ga0055524_1010619 3300003775 Bacteria 3655
20 Ga0055524_1011714 3300003775 Bacteria 3410
21 Ga0055536_1010585 3300003781 Bacteria 3639
22 Ga0055534_1005592 3300003784 Bacteria 3327
23 Ga0055534_1007874 3300003784 Bacteria 2478
24 Ga0055528_1009990 3300003790 Bacteria 3910
25 Ga0055528_1012365 3300003790 Bacteria 3318
26 Ga0055530_10001026 3300003791 Bacteria 22224
27 Ga0055530_10012229 3300003791 Bacteria 3009
28 Ga0055540_1000007 3300003792 Bacteria 318178
29 Ga0055540_1002001 3300003792 Bacteria 11376
30 Ga0055540_1010517 3300003792 Bacteria 3073
31 Ga0055540_1016293 3300003792 Bacteria 2122
32 Ga0055540_1028848 3300003792 Bacteria 1306
33 Ga0055531_10000958 3300003794 Bacteria 23160
34 Ga0055531_10001023 3300003794 Bacteria 22138
35 Ga0055531_10004026 3300003794 Bacteria 9117
36 Ga0055531_10010342 3300003794 Bacteria 4647
37 Ga0055531_10017845 3300003794 Bacteria 2967
38 Ga0055543_1001446 3300004625 Bacteria 9405
39 Ga0055543_1004435 3300004625 Bacteria 3832
40 Ga0065165_1010613 3300005262 Bacteria 3953
41 Ga0065165_1023346 3300005262 Bacteria 2099
42 Ga0065714_10084751 3300005288 Bacteria 2182
43 Ga0070675_100312317 3300005354 Bacteria 1387
44 Ga0070667_100018221 3300005367 Bacteria 5821
45 Ga0070662_100037630 3300005457 Bacteria 3432
46 Ga0070706_100026455 3300005467 Bacteria 5338
47 Ga0070707_101563050 3300005468 Bacteria 627
48 Ga0068853_101272027 3300005539 Bacteria 711
49 Ga0070672_101566072 3300005543 Bacteria 591
50 Ga0070693_100550486 3300005547 Bacteria 826
51 Ga0070665_100772631 3300005548 Bacteria 974
52 Ga0070665_100791132 3300005548 Bacteria 961
53 Ga0070664_100057519 3300005564 Bacteria 3305
54 Ga0068854_100455167 3300005578 Bacteria 1070
55 Ga0068852_100631054 3300005616 Bacteria 1078
56 Ga0068859_100080772 3300005617 Bacteria 3293
57 Ga0068861_100444799 3300005719 Bacteria 1160
58 Ga0068851_10004457 3300005834 Bacteria 6316
59 Ga0068863_100113868 3300005841 Bacteria 2577
60 Ga0068858_100226901 3300005842 Bacteria 1770
61 Ga0068860_100070513 3300005843 Bacteria 3323
62 Ga0068860_100071283 3300005843 Bacteria 3303
63 Ga0068862_101078153 3300005844 Bacteria 797
64 Ga0068862_101820027 3300005844 Bacteria 618
65 Ga0068862_101994169 3300005844 Bacteria 591
66 Ga0075362_10050052 3300006177 Bacteria 1868
67 Ga0075362_10461564 3300006177 Bacteria 646
68 Ga0075366_10630964 3300006195 Bacteria 665
69 Ga0075366_10634827 3300006195 Bacteria 662
70 Ga0075370_10194268 3300006353 Bacteria 1196
71 Ga0075370_10884263 3300006353 Bacteria 546
72 Ga0075430_100042206 3300006846 Bacteria 3857
73 Ga0075430_100434982 3300006846 Bacteria 1083
74 Ga0075429_100001832 3300006880 Bacteria 17596
75 Ga0097620_100080778 3300006931 Bacteria 3293
76 Ga0079104_1000009 3300006946 Bacteria 367015
77 Ga0105244_10002760 3300009036 Bacteria 13093
78 Ga0105240_10037980 3300009093 Bacteria 6183
79 Ga0105245_10349216 3300009098 Bacteria 1465
80 Ga0105243_10006107 3300009148 Bacteria 9311
81 Ga0105243_10337581 3300009148 Bacteria 1379
82 Ga0105243_10399714 3300009148 Bacteria 1276
83 Ga0105241_10633953 3300009174 Bacteria 969
84 Ga0105242_11722143 3300009176 Bacteria 663
85 Ga0105248_10019809 3300009177 Bacteria 7451
86 Ga0105237_10094066 3300009545 Bacteria 2986
87 Ga0105237_10134140 3300009545 Bacteria 2471
88 Ga0105238_10027392 3300009551 Bacteria 5806
89 Ga0105249_10860957 3300009553 Bacteria 972
90 Ga0105239_10003315 3300010375 Bacteria 19821
91 Ga0105239_10501203 3300010375 Bacteria 1380
92 Ga0105239_10658809 3300010375 Bacteria 1196
93 Ga0105246_10030209 3300011119 Bacteria 3576
94 Ga0157373_10139671 3300013100 Bacteria 1704
95 Ga0157373_10338017 3300013100 Bacteria 1073
96 Ga0157371_10108524 3300013102 Bacteria 1970
97 Ga0157370_10019208 3300013104 Bacteria 6864
98 Ga0157369_10018926 3300013105 Bacteria 7715
99 Ga0157378_10773928 3300013297 Bacteria 984
100 Ga0163162_10892183 3300013306 Bacteria 1003
101 Ga0163162_11320088 3300013306 Bacteria 820
102 Ga0157372_10308630 3300013307 Bacteria 1841
103 Ga0182008_10001649 3300014497 Bacteria 14746
104 Ga0182008_10001712 3300014497 Bacteria 14391
105 Ga0182008_10055512 3300014497 Bacteria 1958
106 Ga0157379_10064955 3300014968 Bacteria 3262
107 Ga0157376_10101543 3300014969 Bacteria 2514
108 Ga0157376_10656327 3300014969 Bacteria 1050
109 Ga0182006_1001315 3300015261 Bacteria 15262
110 Ga0182007_10000887 3300015262 Bacteria 16604
111 Ga0182007_10001546 3300015262 Bacteria 12259
112 Ga0182005_1087902 3300015265 Bacteria 862
113 Ga0182005_1100207 3300015265 Bacteria 811
114 Ga0183362_10007 3300015683 Bacteria 240101
115 Ga0163161_10146108 3300017792 Bacteria 1794
116 Ga0209436_104736 3300025208 Bacteria 3293
117 Ga0209672_101119 3300025228 Bacteria 11227
118 Ga0209147_100602 3300025229 Bacteria 19757
119 Ga0209258_100147 3300025242 Bacteria 162823
120 Ga0209258_110464 3300025242 Bacteria 1203
121 Ga0207425_1000231 3300025245 Bacteria 43311
122 Ga0207425_1003175 3300025245 Bacteria 5377
123 Ga0209148_1000122 3300025254 Bacteria 186071
124 Ga0209129_1000177 3300025258 Bacteria 93081
125 Ga0209129_1010256 3300025258 Bacteria 2361
126 Ga0209565_1000241 3300025263 Bacteria 58986
127 Ga0209673_1000377 3300025273 Bacteria 80360
128 Ga0209673_1000507 3300025273 Bacteria 64168
129 Ga0209130_1000218 3300025284 Bacteria 75339
130 Ga0209130_1013185 3300025284 Bacteria 2128
131 Ga0209675_1000893 3300025291 Bacteria 19163
132 Ga0209676_1000202 3300025292 Bacteria 133078
133 Ga0209676_1000375 3300025292 Bacteria 82420
134 Ga0209025_1000322 3300025294 Bacteria 106667
135 Ga0209564_1000223 3300025295 Bacteria 128117
136 Ga0209564_1000226 3300025295 Bacteria 125693
137 Ga0209758_1000142 3300025297 Bacteria 171779
138 Ga0209050_1000224 3300025298 Bacteria 125433
139 Ga0209050_1000243 3300025298 Bacteria 117715
140 Ga0209256_1000019 3300025299 Bacteria 558627
141 Ga0209256_1000114 3300025299 Bacteria 173999
142 Ga0209256_1000174 3300025299 Bacteria 128117
143 Ga0209256_1001174 3300025299 Bacteria 29515
144 Ga0207426_1000162 3300025302 Bacteria 172643
145 Ga0207426_1000232 3300025302 Bacteria 128117
146 Ga0209051_1000004 3300025303 Bacteria 1155596
147 Ga0209051_1000112 3300025303 Bacteria 152667
148 Ga0209051_1000263 3300025303 Bacteria 87839
149 Ga0209051_1000313 3300025303 Bacteria 75138
150 Ga0209051_1001334 3300025303 Bacteria 21469
151 Ga0209051_1012091 3300025303 Bacteria 4200
152 Ga0209051_1019026 3300025303 Bacteria 3013
153 Ga0209051_1022982 3300025303 Bacteria 2606
154 Ga0209257_1000038 3300025304 Bacteria 609032
155 Ga0209257_1000044 3300025304 Bacteria 486709
156 Ga0209257_1000108 3300025304 Bacteria 240229
157 Ga0209257_1000163 3300025304 Bacteria 175355
158 Ga0209257_1001238 3300025304 Bacteria 31583
159 Ga0209257_1001286 3300025304 Bacteria 30635
160 Ga0209257_1004089 3300025304 Bacteria 11689
161 Ga0207656_10029021 3300025321 Bacteria 2275
162 Ga0207655_1006481 3300025728 Bacteria 7748
163 Ga0207688_10376871 3300025901 Bacteria 877
164 Ga0207654_10562271 3300025911 Bacteria 811
165 Ga0207695_10039579 3300025913 Bacteria 5066
166 Ga0207671_10005852 3300025914 Bacteria 11172
167 Ga0207671_10350438 3300025914 Bacteria 1171
168 Ga0207646_11578852 3300025922 Bacteria 566
169 Ga0207694_10024670 3300025924 Bacteria 4567
170 Ga0207694_11293220 3300025924 Bacteria 617
171 Ga0207659_10111310 3300025926 Bacteria 2082
172 Ga0207687_10045617 3300025927 Bacteria 3030
173 Ga0207644_10016180 3300025931 Bacteria 5018
174 Ga0207706_10001145 3300025933 Bacteria 27011
175 Ga0207706_10005320 3300025933 Bacteria 12002
176 Ga0207709_10184324 3300025935 Bacteria 1477
177 Ga0207691_10055120 3300025940 Bacteria 3625
178 Ga0207711_10020941 3300025941 Bacteria 5459
179 Ga0207711_11604689 3300025941 Bacteria 594
180 Ga0207689_10034859 3300025942 Bacteria 4179
181 Ga0207712_10417206 3300025961 Bacteria 1131
182 Ga0207712_10625708 3300025961 Bacteria 933
183 Ga0207668_10832180 3300025972 Bacteria 819
184 Ga0207640_10184546 3300025981 Bacteria 1567
185 Ga0207658_10147067 3300025986 Bacteria 1915
186 Ga0207677_10056002 3300026023 Bacteria 2699
187 Ga0207703_10236990 3300026035 Bacteria 1639
188 Ga0207639_10306647 3300026041 Bacteria 1405
189 Ga0207678_10510108 3300026067 Bacteria 1049
190 Ga0207641_10172411 3300026088 Bacteria 1976
191 Ga0207676_10198631 3300026095 Bacteria 1770
192 Ga0207675_100334721 3300026118 Bacteria 1481
193 Ga0207683_10039079 3300026121 Bacteria 4139
194 Ga0209281_1000023 3300027111 Bacteria 519955
195 Ga0209983_1035692 3300027665 Bacteria 1067
196 Ga0268266_10081511 3300028379 Bacteria 2822
197 Ga0268266_10820307 3300028379 Bacteria 899
198 Ga0268265_10120009 3300028380 Bacteria 2164
199 Ga0268265_11718360 3300028380 Bacteria 633
200 Ga0268264_11481762 3300028381 Bacteria 689
201 Ga0307517_10306488 3300028786 Bacteria 887
202 Ga0307515_10000013 3300028794 Bacteria 568456
203 Ga0307515_10000037 3300028794 Bacteria 331970
204 Ga0307515_10000664 3300028794 Bacteria 79458
205 Ga0307515_10050414 3300028794 Bacteria 6235
206 Ga0307515_10061369 3300028794 Bacteria 5335
207 Ga0307512_10366897 3300030522 Bacteria 624
208 Ga0265327_10006376 3300031251 Bacteria 9451
209 Ga0307513_10010779 3300031456 Bacteria 11423
210 Ga0307513_10017197 3300031456 Bacteria 8677
211 Ga0307513_10130976 3300031456 Bacteria 2454
212 Ga0307509_10183567 3300031507 Bacteria 1953
213 Ga0307408_100136508 3300031548 Bacteria 1920
214 Ga0307408_100226221 3300031548 Bacteria 1529
215 Ga0307408_100334522 3300031548 Bacteria 1280
216 Ga0307514_10000643 3300031649 Bacteria 63638
217 Ga0307514_10003196 3300031649 Bacteria 15997
218 Ga0265342_10026503 3300031712 Bacteria 3631
219 Ga0307405_10008037 3300031731 Bacteria 5320
220 Ga0307405_10291518 3300031731 Bacteria 1233
221 Ga0307413_10207937 3300031824 Bacteria 1419
222 Ga0307410_10531199 3300031852 Bacteria 972
223 Ga0307406_10003259 3300031901 Bacteria 8845
224 Ga0307406_10094548 3300031901 Bacteria 2021
225 Ga0307412_10013804 3300031911 Bacteria 4747
226 Ga0307412_10100279 3300031911 Bacteria 2046
227 Ga0307412_10161819 3300031911 Bacteria 1664
228 Ga0307412_10547416 3300031911 Bacteria 971
229 Ga0307412_10548315 3300031911 Bacteria 971
230 Ga0307416_100142997 3300032002 Bacteria 2178
231 Ga0307416_100319442 3300032002 Bacteria 1554
232 Ga0307416_101176997 3300032002 Bacteria 872
233 Ga0307414_10179159 3300032004 Bacteria 1703
234 Ga0307414_10270534 3300032004 Bacteria 1423
235 Ga0307510_10064671 3300033180 Bacteria 3713
236 Ga0373939_0241882 3300035114 Bacteria 699
237 Ga0373943_0611815 3300035170 Bacteria 642
238 Ga0373927_0538822 3300035695 Bacteria 771
239 Ga0373937_0415535 3300036401 Bacteria 1276
240 Ga0373925_0010141 3300037068 Bacteria 6840
241 Ga0395899_0007482 3300037312 Bacteria 8437
242 Ga0395900_0392535 3300037418 Bacteria 1353
243 Ga0395898_0001914 3300037466 Bacteria 26511
244 Ga0395898_0027416 3300037466 Bacteria 5719
245 Ga0395898_1006534 3300037466 Bacteria 769
246 Ga0395905_0008680 3300037471 Bacteria 10006
247 Ga0395905_0010956 3300037471 Bacteria 8775
248 Ga0395905_0014537 3300037471 Bacteria 7510
249 Ga0395905_0300725 3300037471 Bacteria 1492
250 Ga0395905_0484940 3300037471 Bacteria 1136
251 Ga0395901_0154107 3300038443 Bacteria 2413
252 Ga0395901_0183470 3300038443 Bacteria 2195
253 Ga0395901_0952119 3300038443 Bacteria 837
254 Ga0450911_031888 3300042115 Bacteria 684
255 Ga0450898_062295 3300042134 Bacteria 735
256 Ga0450903_059374 3300042138 Bacteria 555
257 Ga0439446_0044790 3300042156 Bacteria 1310
258 Ga0439464_0168650 3300042439 Bacteria 690
259 Ga0451577_0003657 3300042876 Bacteria 16861
260 Ga0451577_0005117 3300042876 Bacteria 13510
261 Ga0451577_0019275 3300042876 Bacteria 6274
262 Ga0451577_0164507 3300042876 Bacteria 1999
263 Ga0451577_0682084 3300042876 Bacteria 931
264 Ga0451577_1709865 3300042876 Bacteria 553
265 Ga0466969_0000487 3300044656 Bacteria 21758
266 Ga0466969_0091648 3300044656 Bacteria 1439
267 Ga0466972_0002886 3300044658 Bacteria 8507
268 Ga0466972_0061692 3300044658 Bacteria 1797
269 Ga0453683_0112751 3300044673 Bacteria 1710
270 Ga0466965_0011989 3300044683 Bacteria 4069
271 Ga0466965_0026941 3300044683 Bacteria 2788
272 Ga0466965_0057311 3300044683 Bacteria 1941
273 Ga0466965_0072496 3300044683 Bacteria 1733
274 Ga0466965_0321857 3300044683 Bacteria 842
275 Ga0466966_0043592 3300044684 Bacteria 2875
276 Ga0466961_0001040 3300044693 Bacteria 17129
277 Ga0466961_0172173 3300044693 Bacteria 1346
278 Ga0466961_0227246 3300044693 Bacteria 1149
279 Ga0466963_0007576 3300044694 Bacteria 6477
280 Ga0466963_0362288 3300044694 Bacteria 1021
281 Ga0466964_0343702 3300044706 Bacteria 764
282 Ga0453684_0011857 3300044712 Bacteria 14518
283 Ga0453684_0069622 3300044712 Bacteria 4461
284 Ga0453684_0247875 3300044712 Bacteria 2047
285 Ga0453684_1477641 3300044712 Bacteria 702
286 Ga0466971_0078241 3300044719 Bacteria 1506
287 Ga0466971_0245803 3300044719 Bacteria 852
288 Ga0466968_0285362 3300044735 Bacteria 791
289 Ga0466970_0110836 3300044765 Bacteria 1498
290 Ga0466957_0075506 3300044842 Bacteria 2091
291 Ga0466960_0088429 3300044901 Bacteria 1575
292 Ga0466960_0144627 3300044901 Bacteria 1265
293 Ga0466959_0000128 3300045049 Bacteria 48803
294 Ga0451576_0004788 3300045051 Bacteria 17348
295 Ga0451576_0040220 3300045051 Bacteria 4950
296 Ga0451576_1263900 3300045051 Bacteria 770
297 Ga0466967_0187887 3300045976 Bacteria 1951
298 Ga0495650_0003470 3300046471 Bacteria 11465
299 Ga0495618_0285708 3300046514 Bacteria 1028
300 Ga0495618_0389446 3300046514 Bacteria 854
301 Ga0495654_0000774 3300046530 Bacteria 24689
302 Ga0495654_0049763 3300046530 Bacteria 2051
303 Ga0495640_0674456 3300046533 Bacteria 621
304 Ga0495621_0019992 3300046539 Bacteria 2193
305 Ga0495621_0036442 3300046539 Bacteria 1707
306 Ga0495621_0090599 3300046539 Bacteria 1152
307 Ga0495597_0131793 3300046542 Bacteria 1036
308 Ga0495633_0274903 3300046558 Bacteria 767
309 Ga0495667_0352242 3300046559 Bacteria 930
310 Ga0495656_0088739 3300046615 Bacteria 1410
311 Ga0495611_0356548 3300046648 Bacteria 671
312 Ga0495625_0169136 3300046660 Bacteria 1460
313 Ga0495588_0025280 3300046674 Bacteria 2958
314 Ga0495588_0164235 3300046674 Bacteria 1174
315 Ga0495657_0207521 3300046675 Bacteria 1192
316 Ga0495658_0023506 3300046683 Bacteria 3272
317 Ga0495669_0075781 3300046684 Bacteria 1539
318 Ga0495670_0213883 3300046691 Bacteria 1023
319 Ga0495671_0017006 3300046692 Bacteria 3874
320 Ga0495671_0160907 3300046692 Bacteria 1092
321 Ga0495600_0077793 3300046809 Bacteria 2167
322 Ga0495660_0040122 3300046810 Bacteria 2596
323 Ga0495604_0180759 3300047317 Bacteria 1476
324 Ga0495636_0124937 3300047318 Bacteria 1141
325 Ga0495676_0053244 3300047321 Bacteria 3226
326 Ga0495680_0155977 3300047322 Bacteria 1661
327 Ga0495687_129333 3300047443 Bacteria 897
328 Ga0495677_0158467 3300047445 Bacteria 873
329 Ga0495685_013342 3300047447 Bacteria 2789
330 Ga0495593_0023280 3300047673 Bacteria 3444
331 Ga0495602_0188984 3300048088 Bacteria 1581
332 Ga0495614_0004090 3300048089 Bacteria 6564
333 Ga0495614_0477982 3300048089 Bacteria 591
334 Ga0495615_0011391 3300048090 Bacteria 1806
335 Ga0495615_0080907 3300048090 Bacteria 890
336 Ga0496100_0064111 3300048903 Bacteria 2430
337 Ga0496101_0001235 3300048904 Bacteria 15279
338 Ga0496101_0010997 3300048904 Bacteria 5996
339 Ga0496102_0002241 3300048905 Bacteria 16581
340 Ga0496102_0002615 3300048905 Bacteria 15311
341 Ga0496102_0035295 3300048905 Bacteria 4501
342 Ga0496104_0015589 3300048907 Bacteria 6888
343 Ga0496105_0003031 3300048908 Bacteria 12350
344 Ga0496106_0007856 3300048909 Bacteria 7892
345 Ga0496107_0092530 3300048910 Bacteria 2211
346 Ga0496108_0111789 3300048911 Bacteria 2337
347 Ga0496108_0231268 3300048911 Bacteria 1607
348 Ga0496109_0219224 3300048912 Bacteria 1789
349 Ga0496109_1721690 3300048912 Bacteria 560
350 Ga0496110_0152107 3300048913 Bacteria 2095
351 Ga0496111_0318798 3300048914 Bacteria 1151
352 Ga0496112_0078517 3300048915 Bacteria 3264
353 Ga0496113_0145129 3300048916 Bacteria 1869
354 Ga0496114_0019669 3300048917 Bacteria 5472
355 Ga0496114_0077346 3300048917 Bacteria 2805
356 Ga0496117_0017144 3300048920 Bacteria 6062
357 Ga0496118_0018823 3300048921 Bacteria 6201
358 Ga0496118_0068888 3300048921 Bacteria 2567
359 Ga0496121_0081724 3300048924 Bacteria 2556
360 Ga0496121_0124741 3300048924 Bacteria 1938
361 Ga0496122_0040367 3300048925 Bacteria 3710
362 Ga0496122_0054814 3300048925 Bacteria 2990
363 Ga0496123_0052157 3300048926 Bacteria 2717
364 Ga0496123_0149576 3300048926 Bacteria 1262
365 Ga0496124_0029932 3300048927 Bacteria 4843
366 Ga0496124_0038976 3300048927 Bacteria 4122
367 Ga0496124_0048986 3300048927 Bacteria 3606
368 Ga0496124_0083127 3300048927 Bacteria 2627
369 Ga0496124_0649637 3300048927 Bacteria 677
370 Ga0496124_0703385 3300048927 Bacteria 640
371 Ga0496125_0027658 3300048928 Bacteria 5136
372 Ga0496125_0214502 3300048928 Bacteria 1246
373 Ga0501315_041552 3300049531 Bacteria 697
374 Ga0501036_0200422 3300049572 Bacteria 1679
375 Ga0501047_0577101 3300049581 Bacteria 948
376 Ga0501236_050634 3300049670 Bacteria 713
377 Ga0501249_043052 3300049679 Bacteria 1027
378 Ga0501253_106114 3300049683 Bacteria 664
379 Ga0501229_016605 3300049706 Bacteria 958
380 nmdc:mga03683_112029_c1 3300050489 Bacteria 1207
381 nmdc:mga0k408_263059_c1 3300050493 Bacteria 1030
382 nmdc:mga0k408_92276_c1 3300050493 Bacteria 1780
383 nmdc:mga07m45_210606_c1 3300050496 Bacteria 1131
384 nmdc:mga07m45_345200_c1 3300050496 Bacteria 865
385 nmdc:mga07m45_50590_c1 3300050496 Bacteria 2342
386 nmdc:mga09592_197319_c1 3300050508 Bacteria 1743
387 nmdc:mga0qj67_539594_c1 3300050509 Bacteria 936
388 nmdc:mga0qj67_59219_c1 3300050509 Bacteria 3037
389 Ga0500643_008343 3300053087 Bacteria 4075
390 Ga0500651_0001059 3300053093 Bacteria 13571
391 Ga0500566_0079539 3300053094 Bacteria 1827
392 Ga0500562_063500 3300053108 Bacteria 993
393 Ga0500569_068908 3300053109 Bacteria 1109
394 Ga0500571_000368 3300053110 Bacteria 17744
395 Ga0500572_112459 3300053111 Bacteria 877
396 Ga0500597_121867 3300053120 Bacteria 1129
397 Ga0500607_014791 3300053121 Bacteria 4515
398 Ga0500626_056202 3300053128 Bacteria 1765
399 Ga0500655_000755 3300053133 Bacteria 6411
400 Ga0500658_0000190 3300053134 Bacteria 29332
401 Ga0500568_0002616 3300053139 Bacteria 10470
402 Ga0500573_0169024 3300053140 Bacteria 1184
403 Ga0500574_015378 3300053141 Bacteria 1827
404 Ga0500574_159004 3300053141 Bacteria 656
405 Ga0500616_0214185 3300053153 Bacteria 844
406 Ga0500619_000234 3300053154 Bacteria 12338
407 Ga0500634_0008195 3300053161 Bacteria 5210
408 Ga0500638_004264 3300053162 Bacteria 5473
409 Ga0500636_0312428 3300053177 Bacteria 768
410 Ga0500596_029722 3300053735 Bacteria 844
411 Ga0590071_067477 3300059421 Bacteria 879
412 Ga0466962_0008196 3300061719 Bacteria 5012
413 2513227646 2513020051 Bacteria 6053213
414 2599626758 2599185214 Bacteria 8209958
415 2599676004 2599185226 Bacteria 8233575
416 2599684295 2599185227 Bacteria 8246414
417 2599696309 2599185229 Bacteria 8216126
418 2644326001 2643221658 Bacteria 6064537
419 2644397378 2643221672 Bacteria 6322190
420 2738723229 2738541277 Bacteria 7458140
421 2738885555 2738541307 Bacteria 8606193
422 2739283960 2738543019 Bacteria 7459457
423 2819601817 2818991446 Bacteria 7757362
424 2831268168 2831265667 Bacteria 7184833
425 2838061018 2838054893 Bacteria 7451788
426 2885199889 2885198086 Bacteria 7212419
427 2885213590 2885211737 Bacteria 7212420
428 2899926543 2899924645 Bacteria 7487985
429 2928039879 2928037797 Bacteria 7273642
430 2928047372 2928044640 Bacteria 7271509
431 2928057424 2928051484 Bacteria 7773759
432 2928070453 2928064002 Bacteria 7419480
433 2928072786 2928070936 Bacteria 8062541
434 2928085951 2928084124 Bacteria 7159212
435 2945914680 2945909444 Bacteria 7065066
436 2945989918 2945984333 Bacteria 7358892
437 Ga0395900_0000224
438 JGI25152J39213_1010091
439 JGI25150J39212_1001540
440 JGI25159J45721_1017175
441 JGI25151J46595_10013609
442 JGI25151J46595_10030788
443 JGI25153J46596_10011476
444 JGI25153J46596_10014634
445 rootH2_10086219
446 JGI25160J50197_1008785
447 Ga0006562J51391_1072711
448 Ga0055527_1008538
449 Ga0055535_1002945
450 Ga0055542_1000058
451 Ga0055526_1013675
452 Ga0055526_1021643
453 Ga0055537_1007943
454 Ga0055524_1000307
455 Ga0055524_1010619
456 Ga0055524_1011714
457 Ga0055536_1010585
458 Ga0055534_1005592
459 Ga0055534_1007874
460 Ga0055528_1009990
461 Ga0055528_1012365
462 Ga0055530_10001026
463 Ga0055530_10012229
464 Ga0055540_1000007
465 Ga0055540_1002001
466 Ga0055540_1010517
467 Ga0055540_1016293
468 Ga0055540_1028848
469 Ga0055531_10000958
470 Ga0055531_10001023
471 Ga0055531_10004026
472 Ga0055531_10010342
473 Ga0055531_10017845
474 Ga0055543_1001446
475 Ga0055543_1004435
476 Ga0065165_1010613
477 Ga0065165_1023346
478 Ga0065714_10084751
479 Ga0070675_100312317
480 Ga0070667_100018221
481 Ga0070662_100037630
482 Ga0070706_100026455
483 Ga0070707_101563050
484 Ga0068853_101272027
485 Ga0070672_101566072
486 Ga0070693_100550486
487 Ga0070665_100772631
488 Ga0070665_100791132
489 Ga0070664_100057519
490 Ga0068854_100455167
491 Ga0068852_100631054
492 Ga0068859_100080772
493 Ga0068861_100444799
494 Ga0068851_10004457
495 Ga0068863_100113868
496 Ga0068858_100226901
497 Ga0068860_100070513
498 Ga0068860_100071283
499 Ga0068862_101078153
500 Ga0068862_101820027
501 Ga0068862_101994169
502 Ga0075362_10050052
503 Ga0075362_10461564
504 Ga0075366_10630964
505 Ga0075366_10634827
506 Ga0075370_10194268
507 Ga0075370_10884263
508 Ga0075430_100042206
509 Ga0075430_100434982
510 Ga0075429_100001832
511 Ga0097620_100080778
512 Ga0079104_1000009
513 Ga0105244_10002760
514 Ga0105240_10037980
515 Ga0105245_10349216
516 Ga0105243_10006107
517 Ga0105243_10337581
518 Ga0105243_10399714
519 Ga0105241_10633953
520 Ga0105242_11722143
521 Ga0105248_10019809
522 Ga0105237_10094066
523 Ga0105237_10134140
524 Ga0105238_10027392
525 Ga0105249_10860957
526 Ga0105239_10003315
527 Ga0105239_10501203
528 Ga0105239_10658809
529 Ga0105246_10030209
530 Ga0157373_10139671
531 Ga0157373_10338017
532 Ga0157371_10108524
533 Ga0157370_10019208
534 Ga0157369_10018926
535 Ga0157378_10773928
536 Ga0163162_10892183
537 Ga0163162_11320088
538 Ga0157372_10308630
539 Ga0182008_10001649
540 Ga0182008_10001712
541 Ga0182008_10055512
542 Ga0157379_10064955
543 Ga0157376_10101543
544 Ga0157376_10656327
545 Ga0182006_1001315
546 Ga0182007_10000887
547 Ga0182007_10001546
548 Ga0182005_1087902
549 Ga0182005_1100207
550 Ga0183362_10007
551 Ga0163161_10146108
552 Ga0209436_104736
553 Ga0209672_101119
554 Ga0209147_100602
555 Ga0209258_100147
556 Ga0209258_110464
557 Ga0207425_1000231
558 Ga0207425_1003175
559 Ga0209148_1000122
560 Ga0209129_1000177
561 Ga0209129_1010256
562 Ga0209565_1000241
563 Ga0209673_1000377
564 Ga0209673_1000507
565 Ga0209130_1000218
566 Ga0209130_1013185
567 Ga0209675_1000893
568 Ga0209676_1000202
569 Ga0209676_1000375
570 Ga0209025_1000322
571 Ga0209564_1000223
572 Ga0209564_1000226
573 Ga0209758_1000142
574 Ga0209050_1000224
575 Ga0209050_1000243
576 Ga0209256_1000019
577 Ga0209256_1000114
578 Ga0209256_1000174
579 Ga0209256_1001174
580 Ga0207426_1000162
581 Ga0207426_1000232
582 Ga0209051_1000004
583 Ga0209051_1000112
584 Ga0209051_1000263
585 Ga0209051_1000313
586 Ga0209051_1001334
587 Ga0209051_1012091
588 Ga0209051_1019026
589 Ga0209051_1022982
590 Ga0209257_1000038
591 Ga0209257_1000044
592 Ga0209257_1000108
593 Ga0209257_1000163
594 Ga0209257_1001238
595 Ga0209257_1001286
596 Ga0209257_1004089
597 Ga0207656_10029021
598 Ga0207655_1006481
599 Ga0207688_10376871
600 Ga0207654_10562271
601 Ga0207695_10039579
602 Ga0207671_10005852
603 Ga0207671_10350438
604 Ga0207646_11578852
605 Ga0207694_10024670
606 Ga0207694_11293220
607 Ga0207659_10111310
608 Ga0207687_10045617
609 Ga0207644_10016180
610 Ga0207706_10001145
611 Ga0207706_10005320
612 Ga0207709_10184324
613 Ga0207691_10055120
614 Ga0207711_10020941
615 Ga0207711_11604689
616 Ga0207689_10034859
617 Ga0207712_10417206
618 Ga0207712_10625708
619 Ga0207668_10832180
620 Ga0207640_10184546
621 Ga0207658_10147067
622 Ga0207677_10056002
623 Ga0207703_10236990
624 Ga0207639_10306647
625 Ga0207678_10510108
626 Ga0207641_10172411
627 Ga0207676_10198631
628 Ga0207675_100334721
629 Ga0207683_10039079
630 Ga0209281_1000023
631 Ga0209983_1035692
632 Ga0268266_10081511
633 Ga0268266_10820307
634 Ga0268265_10120009
635 Ga0268265_11718360
636 Ga0268264_11481762
637 Ga0307517_10306488
638 Ga0307515_10000013
639 Ga0307515_10000037
640 Ga0307515_10000664
641 Ga0307515_10050414
642 Ga0307515_10061369
643 Ga0307512_10366897
644 Ga0265327_10006376
645 Ga0307513_10010779
646 Ga0307513_10017197
647 Ga0307513_10130976
648 Ga0307509_10183567
649 Ga0307408_100136508
650 Ga0307408_100226221
651 Ga0307408_100334522
652 Ga0307514_10000643
653 Ga0307514_10003196
654 Ga0265342_10026503
655 Ga0307405_10008037
656 Ga0307405_10291518
657 Ga0307413_10207937
658 Ga0307410_10531199
659 Ga0307406_10003259
660 Ga0307406_10094548
661 Ga0307412_10013804
662 Ga0307412_10100279
663 Ga0307412_10161819
664 Ga0307412_10547416
665 Ga0307412_10548315
666 Ga0307416_100142997
667 Ga0307416_100319442
668 Ga0307416_101176997
669 Ga0307414_10179159
670 Ga0307414_10270534
671 Ga0307510_10064671
672 Ga0373939_0241882
673 Ga0373943_0611815
674 Ga0373927_0538822
675 Ga0373937_0415535
676 Ga0373925_0010141
677 Ga0395899_0007482
678 Ga0395900_0392535
679 Ga0395898_0001914
680 Ga0395898_0027416
681 Ga0395898_1006534
682 Ga0395905_0008680
683 Ga0395905_0010956
684 Ga0395905_0014537
685 Ga0395905_0300725
686 Ga0395905_0484940
687 Ga0395901_0154107
688 Ga0395901_0183470
689 Ga0395901_0952119
690 Ga0450911_031888
691 Ga0450898_062295
692 Ga0450903_059374
693 Ga0439446_0044790
694 Ga0439464_0168650
695 Ga0451577_0003657
696 Ga0451577_0005117
697 Ga0451577_0019275
698 Ga0451577_0164507
699 Ga0451577_0682084
700 Ga0451577_1709865
701 Ga0466969_0000487
702 Ga0466969_0091648
703 Ga0466972_0002886
704 Ga0466972_0061692
705 Ga0453683_0112751
706 Ga0466965_0011989
707 Ga0466965_0026941
708 Ga0466965_0057311
709 Ga0466965_0072496
710 Ga0466965_0321857
711 Ga0466966_0043592
712 Ga0466961_0001040
713 Ga0466961_0172173
714 Ga0466961_0227246
715 Ga0466963_0007576
716 Ga0466963_0362288
717 Ga0466964_0343702
718 Ga0453684_0011857
719 Ga0453684_0069622
720 Ga0453684_0247875
721 Ga0453684_1477641
722 Ga0466971_0078241
723 Ga0466971_0245803
724 Ga0466968_0285362
725 Ga0466970_0110836
726 Ga0466957_0075506
727 Ga0466960_0088429
728 Ga0466960_0144627
729 Ga0466959_0000128
730 Ga0451576_0004788
731 Ga0451576_0040220
732 Ga0451576_1263900
733 Ga0466967_0187887
734 Ga0495650_0003470
735 Ga0495618_0285708
736 Ga0495618_0389446
737 Ga0495654_0000774
738 Ga0495654_0049763
739 Ga0495640_0674456
740 Ga0495621_0019992
741 Ga0495621_0036442
742 Ga0495621_0090599
743 Ga0495597_0131793
744 Ga0495633_0274903
745 Ga0495667_0352242
746 Ga0495656_0088739
747 Ga0495611_0356548
748 Ga0495625_0169136
749 Ga0495588_0025280
750 Ga0495588_0164235
751 Ga0495657_0207521
752 Ga0495658_0023506
753 Ga0495669_0075781
754 Ga0495670_0213883
755 Ga0495671_0017006
756 Ga0495671_0160907
757 Ga0495600_0077793
758 Ga0495660_0040122
759 Ga0495604_0180759
760 Ga0495636_0124937
761 Ga0495676_0053244
762 Ga0495680_0155977
763 Ga0495687_129333
764 Ga0495677_0158467
765 Ga0495685_013342
766 Ga0495593_0023280
767 Ga0495602_0188984
768 Ga0495614_0004090
769 Ga0495614_0477982
770 Ga0495615_0011391
771 Ga0495615_0080907
772 Ga0496100_0064111
773 Ga0496101_0001235
774 Ga0496101_0010997
775 Ga0496102_0002241
776 Ga0496102_0002615
777 Ga0496102_0035295
778 Ga0496104_0015589
779 Ga0496105_0003031
780 Ga0496106_0007856
781 Ga0496107_0092530
782 Ga0496108_0111789
783 Ga0496108_0231268
784 Ga0496109_0219224
785 Ga0496109_1721690
786 Ga0496110_0152107
787 Ga0496111_0318798
788 Ga0496112_0078517
789 Ga0496113_0145129
790 Ga0496114_0019669
791 Ga0496114_0077346
792 Ga0496117_0017144
793 Ga0496118_0018823
794 Ga0496118_0068888
795 Ga0496121_0081724
796 Ga0496121_0124741
797 Ga0496122_0040367
798 Ga0496122_0054814
799 Ga0496123_0052157
800 Ga0496123_0149576
801 Ga0496124_0029932
802 Ga0496124_0038976
803 Ga0496124_0048986
804 Ga0496124_0083127
805 Ga0496124_0649637
806 Ga0496124_0703385
807 Ga0496125_0027658
808 Ga0496125_0214502
809 Ga0501315_041552
810 Ga0501036_0200422
811 Ga0501047_0577101
812 Ga0501236_050634
813 Ga0501249_043052
814 Ga0501253_106114
815 Ga0501229_016605
816 nmdc:mga03683_112029_c1
817 nmdc:mga0k408_263059_c1
818 nmdc:mga0k408_92276_c1
819 nmdc:mga07m45_210606_c1
820 nmdc:mga07m45_345200_c1
821 nmdc:mga07m45_50590_c1
822 nmdc:mga09592_197319_c1
823 nmdc:mga0qj67_539594_c1
824 nmdc:mga0qj67_59219_c1
825 Ga0500643_008343
826 Ga0500651_0001059
827 Ga0500566_0079539
828 Ga0500562_063500
829 Ga0500569_068908
830 Ga0500571_000368
831 Ga0500572_112459
832 Ga0500597_121867
833 Ga0500607_014791
834 Ga0500626_056202
835 Ga0500655_000755
836 Ga0500658_0000190
837 Ga0500568_0002616
838 Ga0500573_0169024
839 Ga0500574_015378
840 Ga0500574_159004
841 Ga0500616_0214185
842 Ga0500619_000234
843 Ga0500634_0008195
844 Ga0500638_004264
845 Ga0500636_0312428
846 Ga0500596_029722
847 Ga0590071_067477
848 Ga0466962_0008196
849 2513227646
850 2599626758
851 2599676004
852 2599684295
853 2599696309
854 2644326001
855 2644397378
856 2738723229
857 2738885555
858 2739283960
859 2819601817
860 2831268168
861 2838061018
862 2885199889
863 2885213590
864 2899926543
865 2928039879
866 2928047372
867 2928057424
868 2928070453
869 2928072786
870 2928085951
871 2945914680
872 2945989918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04536

TPM_phosphatase

TPM domain

46

174

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8959 35 180
5anp-assembly1.cif.gz_A crystal structure of the ba41 protein from bizionia argentinensis 0.8539 35 162
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8448 35 180
7tbr-assembly1.cif.gz_A crystal structure of the tpm domain from the rhodothermus marinus protein rhom172_1776 0.8173 34 162
5anp-assembly2.cif.gz_B crystal structure of the ba41 protein from bizionia argentinensis 0.7991 35 162
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8959 35 180 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8448 35 180 3.10.310.50
af_P55140_17_164_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8383 34 172 3.10.310.50
af_P9WLA7_26_161_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.813 36 154 3.10.310.50
af_Q19280_39_210_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.805 57 158 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A848F5Z4-F1-model_v4 TPM domain-containing protein 0.9916 16 181 GO:0016020
AF-K0HU01-F1-model_v4 TPM domain-containing protein 0.9874 38 181 GO:0016020
AF-A0A1W2BGM6-F1-model_v4 TLP18.3, Psb32 and MOLO-1 founding protein of phosphatase 0.9835 18 181 GO:0016020
AF-A0A1F4HII3-F1-model_v4 deleted 0.9816 14 181
AF-A0A521Z2V1-F1-model_v4 TPM domain-containing protein 0.9815 16 181 GO:0016020

Map