F443595

General Info

Members Datasets Scaffolds Average Seq Length
436 302 872 458

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0014462|Ga0395898_0014462_1292_2791
Length 499
Sequence MPRALCRGLHAAGFLPPVRLSLDQWTAPSGPDHFGGHVLAPKSQLDAIVSLAKRRGFVFQAGEIYGGSRSAWDYGPLGVELKENIKEQWWQTFVRSREDMVGLDSSVILPKQVWEASGHVATFTDPLVECLNCHKRHRQDHLIEAYEAKKGRAPEKGMESITCPDCGITGKWTEPQMFSGLMKTFLGPVDNEEGLHYMRPETAQGIFVNFNNVVTTSRRKPPFGIGQIGKAFRNEITPGNFIFRTREFEQMEIEYFTAPAEADEWFKHWVDACWNWFVDLGINPDNMRKFDVPEHERAHYSAGTIDLEYRFGFQGNEWGELMGIANRTDFDLGSHSKASGHELSYFDQTTNERYVPYVIEPSFGLTRSMMAFLVDAYSEDEAPNTKGGVDKRTVLRLDPRLAPVKAAVLPLSRNEDLSPKARDLGAQLRKHWNIEFDDAGAIGRRYRRQDEIGTPFCITVDFETLEDHAVTIRERDTMTQERVSLDKVQGYLFERLFKN

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
112 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
113 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
200 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
209 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
210 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
211 2643221546 Microbacterium sp. Root53 Isolate Unclassified
212 2643221553 Microbacterium sp. Root553 Isolate Unclassified
213 2643221566 Microbacterium sp. Root166 Isolate Unclassified
214 2643221575 Microbacterium sp. Root61 Isolate Unclassified
215 2643221597 Microbacterium sp. Root180 Isolate Unclassified
216 2643221616 Leifsonia sp. Root227 Isolate Unclassified
217 2643221630 Microbacterium sp. Root322 Isolate Unclassified
218 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
219 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
220 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
221 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
222 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
223 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
224 2739367653 Kocuria sp. OV113 Isolate Unclassified
225 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
226 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
227 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
228 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
229 2773857759 Microbacterium sp. 1294 Isolate Unclassified
230 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
231 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
232 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
233 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
234 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
235 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
236 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
237 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
238 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
239 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
240 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
241 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
242 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
243 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
244 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
245 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
246 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
247 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
248 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
249 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
250 2857727296 Kocuria sp. R-72562 Isolate Unclassified
251 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
252 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
253 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
254 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
255 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
256 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
257 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
258 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
259 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
260 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
261 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
262 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
263 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
264 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
265 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
266 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
267 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
268 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
269 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
270 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
271 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
272 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
273 2919069694 Microbacterium sp. 1154 Isolate Unclassified
274 2919395869 Microbacterium resistens 2980 Isolate Unclassified
275 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
276 2920879853 Kocuria salina CV6 Isolate Unclassified
277 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
278 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
279 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
280 2928153084 Leifsonia sp. 563 Isolate Unclassified
281 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
282 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
283 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
284 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
285 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
286 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
287 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
288 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
289 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
290 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
291 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
292 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
293 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
294 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
295 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
296 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
297 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
298 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
299 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
300 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
301 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
302 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.29
Metatranscriptomes 0.69
Isolates 22.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 12.16
Nodule 0
Rhizoplane 3.9
Rhizosphere 57.11
Stem 0
Stem Tuber 0.23
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0014462 3300037466 Bacteria 8105
2 JGI24740J21852_10002591 3300001979 Bacteria 8152
3 JGI24739J22299_10007264 3300001989 Bacteria 4163
4 JGI25154J39366_1002454 3300002738 Bacteria 4790
5 JGI25164J39214_1000769 3300002772 Bacteria 11753
6 JGI25406J46586_10020397 3300003203 Bacteria 2681
7 JGI25165J46597_1000005 3300003214 Bacteria 623702
8 JGI25407J50210_10000807 3300003373 Bacteria 6675
9 Ga0006562J51391_1010836 3300003578 Bacteria 7790
10 Ga0006562J51391_1018456 3300003578 Bacteria 13701
11 Ga0055533_1000002 3300003756 Bacteria 1196393
12 Ga0055525_1000142 3300003759 Bacteria 100877
13 Ga0055527_1000004 3300003760 Bacteria 570634
14 Ga0055542_1000307 3300003762 Bacteria 53734
15 Ga0055529_1000008 3300003763 Bacteria 394786
16 Ga0070658_10000122 3300005327 Bacteria 69245
17 Ga0070658_10046640 3300005327 Bacteria 3506
18 Ga0070658_10046819 3300005327 Bacteria 3499
19 Ga0070660_100115474 3300005339 Bacteria 2140
20 Ga0070661_100035007 3300005344 Bacteria 3644
21 Ga0070668_100022791 3300005347 Bacteria 4734
22 Ga0070685_10010635 3300005466 Bacteria 4788
23 Ga0070698_100025796 3300005471 Bacteria 6125
24 Ga0068853_100046635 3300005539 Bacteria 3717
25 Ga0068855_100190954 3300005563 Bacteria 2310
26 Ga0068856_100071645 3300005614 Bacteria 3431
27 Ga0068856_100114260 3300005614 Bacteria 2699
28 Ga0068852_100024812 3300005616 Bacteria 4850
29 Ga0068861_100024602 3300005719 Bacteria 4356
30 Ga0068851_10000003 3300005834 Bacteria 293018
31 Ga0081455_10028260 3300005937 Bacteria 5126
32 Ga0081455_10060708 3300005937 Bacteria 3185
33 Ga0081538_10000522 3300005981 Bacteria 42868
34 Ga0081538_10007704 3300005981 Bacteria 9277
35 Ga0081538_10007868 3300005981 Bacteria 9136
36 Ga0081538_10008017 3300005981 Bacteria 9031
37 Ga0081539_10019374 3300005985 Bacteria 4662
38 Ga0075365_10010379 3300006038 Bacteria 5420
39 Ga0075363_100100412 3300006048 Bacteria 1601
40 Ga0075364_10126388 3300006051 Bacteria 1714
41 Ga0075432_10006490 3300006058 Bacteria 3980
42 Ga0075369_10009837 3300006186 Bacteria 3728
43 Ga0075427_10000733 3300006194 Bacteria 3939
44 Ga0075430_100003482 3300006846 Bacteria 13168
45 Ga0075431_100029335 3300006847 Bacteria 5662
46 Ga0075433_10100452 3300006852 Bacteria 2561
47 Ga0075429_100029277 3300006880 Bacteria 4783
48 Ga0105244_10086575 3300009036 Bacteria 1545
49 Ga0105240_10006064 3300009093 Bacteria 17858
50 Ga0105240_10060054 3300009093 Bacteria 4741
51 Ga0111539_10068868 3300009094 Bacteria 4178
52 Ga0105243_10061474 3300009148 Bacteria 3004
53 Ga0105241_10001064 3300009174 Bacteria 20907
54 Ga0105241_10090732 3300009174 Bacteria 2410
55 Ga0105248_10003592 3300009177 Bacteria 17186
56 Ga0105237_10000131 3300009545 Bacteria 105010
57 Ga0105238_10031598 3300009551 Bacteria 5390
58 Ga0105249_10005067 3300009553 Bacteria 11353
59 Ga0157371_10000825 3300013102 Bacteria 35495
60 Ga0157370_10096766 3300013104 Bacteria 2769
61 Ga0157369_10072999 3300013105 Bacteria 3681
62 Ga0157369_10379899 3300013105 Bacteria 1466
63 Ga0171462_1002 3300013250 Bacteria 1052134
64 Ga0163162_10218555 3300013306 Bacteria 2036
65 Ga0157372_10123812 3300013307 Bacteria 2972
66 Ga0157375_10134435 3300013308 Bacteria 2595
67 Ga0163161_10061892 3300017792 Bacteria 2725
68 Ga0197907_10480862 3300020069 Bacteria 2824
69 Ga0209566_100013 3300025225 Bacteria 474033
70 Ga0209674_100001 3300025226 Bacteria 4013750
71 Ga0209672_100011 3300025228 Bacteria 856297
72 Ga0209147_101041 3300025229 Bacteria 11812
73 Ga0209563_100001 3300025230 Bacteria 4013775
74 Ga0209563_100165 3300025230 Bacteria 50808
75 Ga0207427_100325 3300025231 Bacteria 32046
76 Ga0209437_101278 3300025233 Bacteria 6814
77 Ga0209258_101076 3300025242 Bacteria 11745
78 Ga0209646_1000014 3300025246 Bacteria 550484
79 Ga0209677_100001 3300025253 Bacteria 4013787
80 Ga0209677_101085 3300025253 Bacteria 12818
81 Ga0209148_1000023 3300025254 Bacteria 680511
82 Ga0209233_1000001 3300025261 Bacteria 2992747
83 Ga0209455_1000023 3300025272 Bacteria 680449
84 Ga0207656_10000002 3300025321 Bacteria 792178
85 Ga0207655_1002720 3300025728 Bacteria 13828
86 Ga0207705_10000006 3300025909 Bacteria 657147
87 Ga0207654_10000001 3300025911 Bacteria 1816198
88 Ga0207695_10006059 3300025913 Bacteria 15782
89 Ga0207695_10013887 3300025913 Bacteria 9574
90 Ga0207671_10000002 3300025914 Bacteria 1144816
91 Ga0207694_10000092 3300025924 Bacteria 100605
92 Ga0207690_10001146 3300025932 Bacteria 16853
93 Ga0207690_10014454 3300025932 Bacteria 4769
94 Ga0207706_10009133 3300025933 Bacteria 9114
95 Ga0207711_10004780 3300025941 Bacteria 11496
96 Ga0207667_10006393 3300025949 Bacteria 14282
97 Ga0207667_10240240 3300025949 Bacteria 1854
98 Ga0207712_10059472 3300025961 Bacteria 2705
99 Ga0207668_10077968 3300025972 Bacteria 2391
100 Ga0207658_10009467 3300025986 Bacteria 6609
101 Ga0207703_10000031 3300026035 Bacteria 196940
102 Ga0207639_10107199 3300026041 Bacteria 2269
103 Ga0207678_10031516 3300026067 Bacteria 4625
104 Ga0207702_10264739 3300026078 Bacteria 1620
105 Ga0207674_10004399 3300026116 Bacteria 16981
106 Ga0207675_100013381 3300026118 Bacteria 7655
107 Ga0207698_10000277 3300026142 Bacteria 31170
108 Ga0207698_10135901 3300026142 Bacteria 2109
109 Ga0207428_10007161 3300027907 Bacteria 10204
110 Ga0307514_10033590 3300031649 Bacteria 4094
111 Ga0307405_10109082 3300031731 Bacteria 1871
112 Ga0307410_10006276 3300031852 Bacteria 6402
113 Ga0307410_10007489 3300031852 Bacteria 5979
114 Ga0307410_10082538 3300031852 Bacteria 2261
115 Ga0307406_10000040 3300031901 Bacteria 76020
116 Ga0307406_10000541 3300031901 Bacteria 21782
117 Ga0307406_10004111 3300031901 Bacteria 7924
118 Ga0307406_10004408 3300031901 Bacteria 7654
119 Ga0307407_10003100 3300031903 Bacteria 6717
120 Ga0307412_10007073 3300031911 Bacteria 6368
121 Ga0307412_10072203 3300031911 Bacteria 2358
122 Ga0307412_10089037 3300031911 Bacteria 2154
123 Ga0307412_10137416 3300031911 Bacteria 1785
124 Ga0307409_100080012 3300031995 Bacteria 2635
125 Ga0307416_100008846 3300032002 Bacteria 6534
126 Ga0307416_100008967 3300032002 Bacteria 6504
127 Ga0307416_100012622 3300032002 Bacteria 5702
128 Ga0307415_100002964 3300032126 Bacteria 8530
129 Ga0307415_100006120 3300032126 Bacteria 6456
130 Ga0307415_100006787 3300032126 Bacteria 6209
131 Ga0307415_100076931 3300032126 Bacteria 2367
132 Ga0395899_0002887 3300037312 Bacteria 13806
133 Ga0395900_0001268 3300037418 Bacteria 30876
134 Ga0395898_0000270 3300037466 Bacteria 127152
135 Ga0395898_0002175 3300037466 Bacteria 24008
136 Ga0395898_0145080 3300037466 Bacteria 2272
137 Ga0395905_0132496 3300037471 Bacteria 2344
138 Ga0395901_0036962 3300038443 Bacteria 5049
139 Ga0395901_0076757 3300038443 Bacteria 3486
140 Ga0395901_0121716 3300038443 Bacteria 2742
141 Ga0395901_0309169 3300038443 Bacteria 1637
142 Ga0439466_0011593 3300041411 Bacteria 3259
143 Ga0451833_0342895 3300041491 Bacteria 7928
144 Ga0451837_0314787 3300041494 Bacteria 5627
145 Ga0439442_000440 3300042002 Bacteria 9412
146 Ga0439442_002606 3300042002 Bacteria 3540
147 Ga0439449_0001421 3300042007 Bacteria 9359
148 Ga0439450_000036 3300042008 Bacteria 11234
149 Ga0439444_0000340 3300042437 Bacteria 4935
150 Ga0450916_000455 3300042530 Bacteria 3531
151 Ga0466972_0006508 3300044658 Bacteria 5867
152 Ga0466972_0036994 3300044658 Bacteria 2386
153 Ga0466965_0000007 3300044683 Bacteria 131940
154 Ga0466966_0010378 3300044684 Bacteria 6184
155 Ga0466966_0019666 3300044684 Bacteria 4442
156 Ga0466966_0164451 3300044684 Bacteria 1350
157 Ga0466961_0057634 3300044693 Bacteria 2472
158 Ga0466971_0013331 3300044719 Bacteria 3609
159 Ga0466970_0000121 3300044765 Bacteria 35105
160 Ga0466970_0010547 3300044765 Bacteria 4692
161 Ga0466970_0024309 3300044765 Bacteria 3167
162 Ga0495627_000312 3300046453 Bacteria 47799
163 Ga0495590_0000329 3300046457 Bacteria 24701
164 Ga0495644_0016521 3300046523 Bacteria 2825
165 Ga0495609_0052098 3300046538 Bacteria 1821
166 Ga0495656_0003282 3300046615 Bacteria 5457
167 Ga0495659_0019230 3300046664 Bacteria 2285
168 Ga0495661_0093857 3300046665 Bacteria 1702
169 Ga0495671_0075960 3300046692 Bacteria 1648
170 Ga0495677_0026611 3300047445 Bacteria 2098
171 Ga0496100_0012480 3300048903 Bacteria 4873
172 Ga0496102_0060300 3300048905 Bacteria 3470
173 Ga0496103_0010300 3300048906 Bacteria 5530
174 Ga0496104_0003233 3300048907 Bacteria 14030
175 Ga0496104_0089339 3300048907 Bacteria 2943
176 Ga0496105_0017470 3300048908 Bacteria 5753
177 Ga0496107_0047279 3300048910 Bacteria 3099
178 Ga0496109_0086210 3300048912 Bacteria 2900
179 Ga0496110_0092839 3300048913 Bacteria 2701
180 Ga0496111_0023834 3300048914 Bacteria 4300
181 Ga0496112_0167003 3300048915 Bacteria 2166
182 Ga0496114_0038195 3300048917 Bacteria 3972
183 Ga0496114_0059432 3300048917 Bacteria 3193
184 Ga0496114_0216085 3300048917 Bacteria 1682
185 Ga0496115_0036408 3300048918 Bacteria 3896
186 Ga0496115_0071800 3300048918 Bacteria 2808
187 Ga0496115_0135959 3300048918 Bacteria 2027
188 Ga0496116_0027774 3300048919 Bacteria 4111
189 Ga0496117_0000014 3300048920 Bacteria 584427
190 Ga0496117_0000808 3300048920 Bacteria 48592
191 Ga0496117_0001925 3300048920 Bacteria 27694
192 Ga0496117_0006325 3300048920 Bacteria 12050
193 Ga0496117_0006847 3300048920 Bacteria 11327
194 Ga0496117_0014300 3300048920 Bacteria 6847
195 Ga0496118_0000601 3300048921 Bacteria 59471
196 Ga0496118_0014034 3300048921 Bacteria 7523
197 Ga0496118_0038477 3300048921 Bacteria 3833
198 Ga0496119_0001243 3300048922 Bacteria 31699
199 Ga0496119_0002674 3300048922 Bacteria 19260
200 Ga0496119_0002944 3300048922 Bacteria 18108
201 Ga0496119_0006163 3300048922 Bacteria 11216
202 Ga0496119_0007487 3300048922 Bacteria 9815
203 Ga0496119_0013750 3300048922 Bacteria 6409
204 Ga0496119_0023820 3300048922 Bacteria 4327
205 Ga0496119_0029470 3300048922 Bacteria 3721
206 Ga0496119_0035518 3300048922 Bacteria 3265
207 Ga0496119_0063512 3300048922 Bacteria 2196
208 Ga0496120_0000655 3300048923 Bacteria 50898
209 Ga0496120_0001070 3300048923 Bacteria 36178
210 Ga0496120_0001359 3300048923 Bacteria 30036
211 Ga0496120_0003745 3300048923 Bacteria 13474
212 Ga0496120_0095036 3300048923 Bacteria 1585
213 Ga0496121_0000277 3300048924 Bacteria 107014
214 Ga0496121_0053372 3300048924 Bacteria 3387
215 Ga0496121_0175996 3300048924 Bacteria 1549
216 Ga0496122_0000358 3300048925 Bacteria 98103
217 Ga0496122_0000475 3300048925 Bacteria 83356
218 Ga0496122_0003643 3300048925 Bacteria 20024
219 Ga0496122_0004671 3300048925 Bacteria 16822
220 Ga0496122_0015130 3300048925 Bacteria 7395
221 Ga0496122_0058642 3300048925 Bacteria 2847
222 Ga0496123_0000011 3300048926 Bacteria 493925
223 Ga0496123_0000280 3300048926 Bacteria 100544
224 Ga0496123_0001137 3300048926 Bacteria 39763
225 Ga0496123_0053449 3300048926 Bacteria 2669
226 Ga0496124_0000899 3300048927 Bacteria 48070
227 Ga0496124_0011327 3300048927 Bacteria 8920
228 Ga0496124_0015407 3300048927 Bacteria 7328
229 Ga0496124_0087223 3300048927 Bacteria 2552
230 Ga0496125_0000444 3300048928 Bacteria 75459
231 Ga0496125_0002089 3300048928 Bacteria 26891
232 Ga0496125_0009474 3300048928 Bacteria 9997
233 Ga0496125_0020834 3300048928 Bacteria 6138
234 Ga0496125_0030397 3300048928 Bacteria 4833
235 Ga0496125_0048354 3300048928 Bacteria 3548
236 Ga0496126_0000912 3300048929 Bacteria 51111
237 Ga0496126_0007451 3300048929 Bacteria 11999
238 Ga0496126_0008290 3300048929 Bacteria 11224
239 Ga0496126_0014990 3300048929 Bacteria 7815
240 Ga0496126_0015932 3300048929 Bacteria 7541
241 Ga0496126_0044700 3300048929 Bacteria 4077
242 Ga0496126_0053916 3300048929 Bacteria 3645
243 Ga0496126_0069136 3300048929 Bacteria 3151
244 Ga0501031_0124278 3300049568 Bacteria 1685
245 Ga0501032_0073041 3300049569 Bacteria 2286
246 Ga0501033_0015202 3300049570 Bacteria 5842
247 Ga0501033_0025171 3300049570 Bacteria 4483
248 Ga0501034_0001656 3300049571 Bacteria 28757
249 Ga0501034_0051673 3300049571 Bacteria 4144
250 Ga0501034_0051679 3300049571 Bacteria 4144
251 Ga0501034_0113297 3300049571 Bacteria 2702
252 Ga0501034_0122520 3300049571 Bacteria 2586
253 Ga0501036_0001354 3300049572 Bacteria 18784
254 Ga0501037_0006742 3300049573 Bacteria 8401
255 Ga0501038_0004443 3300049574 Bacteria 13032
256 Ga0501038_0005477 3300049574 Bacteria 11792
257 Ga0501038_0043374 3300049574 Bacteria 3911
258 Ga0501038_0049611 3300049574 Bacteria 3629
259 Ga0501038_0071265 3300049574 Bacteria 2948
260 Ga0501040_0019707 3300049576 Bacteria 4489
261 Ga0501041_0000506 3300049577 Bacteria 20074
262 Ga0501042_0034185 3300049578 Bacteria 3605
263 Ga0501042_0052649 3300049578 Bacteria 2903
264 Ga0501043_0002084 3300049579 Bacteria 17078
265 Ga0501043_0005043 3300049579 Bacteria 10680
266 Ga0501046_0189329 3300049580 Bacteria 1535
267 Ga0501047_0006712 3300049581 Bacteria 10821
268 Ga0501047_0128913 3300049581 Bacteria 2410
269 Ga0501048_0002335 3300049582 Bacteria 14481
270 Ga0501048_0003348 3300049582 Bacteria 12191
271 Ga0501068_0081290 3300049584 Bacteria 1989
272 Ga0501070_0000098 3300049586 Bacteria 75579
273 Ga0501070_0001718 3300049586 Bacteria 19376
274 Ga0501070_0003134 3300049586 Bacteria 14398
275 Ga0501070_0024230 3300049586 Bacteria 5089
276 Ga0501071_0027455 3300049587 Bacteria 4005
277 Ga0501072_0006748 3300049588 Bacteria 8719
278 Ga0501072_0151003 3300049588 Bacteria 1852
279 Ga0501072_0187237 3300049588 Bacteria 1651
280 Ga0501073_0001325 3300049589 Bacteria 18227
281 Ga0501074_0000608 3300049590 Bacteria 22237
282 Ga0501074_0002170 3300049590 Bacteria 13599
283 Ga0501076_0000984 3300049592 Bacteria 18631
284 Ga0501076_0005274 3300049592 Bacteria 9264
285 Ga0501077_0001005 3300049593 Bacteria 17012
286 Ga0501079_0000901 3300049741 Bacteria 20360
287 Ga0501079_0005409 3300049741 Bacteria 9510
288 Ga0501079_0021276 3300049741 Bacteria 4961
289 Ga0501080_0003872 3300049742 Bacteria 13239
290 Ga0501080_0023742 3300049742 Bacteria 5682
291 Ga0501081_0000387 3300049743 Bacteria 24281
292 Ga0501081_0035491 3300049743 Bacteria 3394
293 Ga0501083_0000495 3300049744 Bacteria 25187
294 Ga0501083_0028230 3300049744 Bacteria 3870
295 Ga0501035_0005181 3300049822 Bacteria 12332
296 Ga0501035_0082816 3300049822 Bacteria 2831
297 Ga0501044_0007396 3300049823 Bacteria 12079
298 Ga0501045_0000201 3300049824 Bacteria 33911
299 Ga0501045_0009117 3300049824 Bacteria 6930
300 nmdc:mga00v17_33771_c1 3300050491 Bacteria 3034
301 nmdc:mga00v17_39890_c1 3300050491 Bacteria 2814
302 nmdc:mga00v17_43942_c1 3300050491 Bacteria 2692
303 nmdc:mga0yw44_86377_c1 3300050492 Bacteria 1976
304 nmdc:mga05p37_17532_c2 3300050507 Bacteria 5177
305 nmdc:mga05p37_4336_c1 3300050507 Bacteria 16567
306 nmdc:mga09592_9942_c1 3300050508 Bacteria 7740
307 nmdc:mga06r32_3863_c1 3300050510 Bacteria 13409
308 nmdc:mga08y16_5916_c1 3300050511 Bacteria 12823
309 nmdc:mga0a205_2648_c1 3300050515 Bacteria 15825
310 nmdc:mga0sz30_49439_c1 3300050516 Bacteria 1781
311 Ga0500635_0000038 3300053080 Bacteria 93707
312 Ga0500643_000487 3300053087 Bacteria 28865
313 Ga0500651_0000300 3300053093 Bacteria 28581
314 Ga0500650_0052841 3300053098 Bacteria 1889
315 Ga0500556_0000001 3300053104 Bacteria 1135060
316 Ga0500556_0000140 3300053104 Bacteria 60381
317 Ga0500562_000303 3300053108 Bacteria 12023
318 Ga0500655_004464 3300053133 Bacteria 2522
319 Ga0500559_0000156 3300053136 Bacteria 53941
320 Ga0500559_0000372 3300053136 Bacteria 33038
321 Ga0500559_0002090 3300053136 Bacteria 10658
322 Ga0500559_0006409 3300053136 Bacteria 5317
323 Ga0500568_0000006 3300053139 Bacteria 522235
324 Ga0500568_0000026 3300053139 Bacteria 165582
325 Ga0500568_0000172 3300053139 Bacteria 56463
326 Ga0500568_0012873 3300053139 Bacteria 3832
327 Ga0500573_0000013 3300053140 Bacteria 196637
328 Ga0500573_0002394 3300053140 Bacteria 9351
329 Ga0500577_0002423 3300053142 Bacteria 4769
330 Ga0500590_011687 3300053148 Bacteria 4455
331 Ga0500616_0000156 3300053153 Bacteria 114514
332 Ga0500616_0000523 3300053153 Bacteria 48569
333 Ga0500620_000060 3300053155 Bacteria 20194
334 Ga0501084_0001057 3300054114 Bacteria 21384
335 Ga0501084_0021715 3300054114 Bacteria 5352
336 Ga0590075_001202 3300059424 Bacteria 6547
337 Ga0501082_0030912 3300060353 Bacteria 4616
338 Ga0466962_0019234 3300061719 Bacteria 3280
339 Ga0530510_0000116 3300061734 Bacteria 45075
340 Ga0530510_0002578 3300061734 Bacteria 12452
341 2555229786 2554235227 Bacteria 3637389
342 2588107312 2585428157 Bacteria 3018951
343 2643732931 2643221542 Bacteria 3563959
344 2643751641 2643221546 Bacteria 2910897
345 2643784744 2643221553 Bacteria 3544260
346 2643847143 2643221566 Bacteria 3460379
347 2643887932 2643221575 Bacteria 4022601
348 2643997088 2643221597 Bacteria 3347721
349 2644097215 2643221616 Bacteria 4066575
350 2644171721 2643221630 Bacteria 3601215
351 2644199115 2643221635 Bacteria 2632343
352 2644681518 2643221724 Bacteria 3593515
353 2655031827 2654587600 Bacteria 3911798
354 2723640170 2721755702 Bacteria 4373124
355 2729905885 2728369276 Bacteria 5610032
356 2730231078 2728369380 Bacteria 3620317
357 2739604180 2739367653 Bacteria 2780952
358 2747953261 2747842429 Bacteria 3914386
359 2753301728 2751185788 Bacteria 4541048
360 2758225559 2757320536 Bacteria 3629334
361 2774379666 2773857758 Bacteria 3592392
362 2774382113 2773857759 Bacteria 2963774
363 2774397765 2773857763 Bacteria 4180068
364 2808629234 2808606306 Bacteria 3608896
365 2808884036 2808606368 Bacteria 3174172
366 2809226159 2808606447 Bacteria 3572005
367 2812324907 2811994872 Bacteria 4121241
368 2817509568 2816332305 Bacteria 2697803
369 2821271458 2821268502 Bacteria 3750023
370 2833712668 2833709550 Bacteria 4008291
371 2844844452 2844841374 Bacteria 3917147
372 2848552571 2848551377 Bacteria 3720646
373 2852632416 2852632344 Bacteria 3463163
374 2852645672 2852643534 Bacteria 3013378
375 2852647961 2852646457 Bacteria 3408613
376 2852663685 2852663356 Bacteria 4090475
377 2852679137 2852677369 Bacteria 3768884
378 2857480310 2857479173 Bacteria 2469263
379 2857634294 2857632687 Bacteria 2448521
380 2857711558 2857710386 Bacteria 3186771
381 2857721315 2857720070 Bacteria 3189373
382 2857726416 2857723135 Bacteria 4217853
383 2857729124 2857727296 Bacteria 2745552
384 2857731070 2857729791 Bacteria 4040535
385 2857735868 2857733635 Bacteria 3532004
386 2857739684 2857737099 Bacteria 3104305
387 2862995849 2862993130 Bacteria 3860849
388 2870623776 2870622029 Bacteria 3643329
389 2870629118 2870628048 Bacteria 3696012
390 2870803106 2870801768 Bacteria 2710986
391 2870805163 2870804320 Bacteria 2552467
392 2884763589 2884763398 Bacteria 4091164
393 2893684981 2893684298 Bacteria 2897960
394 2904433123 2904430863 Bacteria 3486923
395 2904502756 2904501621 Bacteria 3401437
396 2904512458 2904509784 Bacteria 3520416
397 2905927546 2905926851 Bacteria 4423176
398 2905929005 2905926851 Bacteria 4423176
399 2906802358 2906799679 Bacteria 4031749
400 2908677561 2908674828 Bacteria 3382763
401 2908679302 2908678064 Bacteria 3482747
402 2909075129 2909074476 Bacteria 3436050
403 2919040543 2919039151 Bacteria 3391018
404 2919043671 2919042368 Bacteria 3905917
405 2919053314 2919051321 Bacteria 4210889
406 2919056409 2919055335 Bacteria 3875751
407 2919069949 2919069694 Bacteria 3622919
408 2919397376 2919395869 Bacteria 3704152
409 2919526402 2919523602 Bacteria 3788128
410 2920883633 2920879853 Bacteria 4216831
411 2928093052 2928090899 Bacteria 3158267
412 2928106555 2928104781 Bacteria 3877447
413 2928122370 2928121344 Bacteria 3972376
414 2928155212 2928153084 Bacteria 4020257
415 2928501629 2928500415 Bacteria 3384541
416 2939658267 2939657138 Bacteria 3740283
417 2945969208 2945968032 Bacteria 4111363
418 2946025131 2946024296 Bacteria 3508095
419 2946041664 2946041624 Bacteria 4191385
420 2946083634 2946080515 Bacteria 4310960
421 2966923004 2966921586 Bacteria 3092803
422 2974295837 2974294766 Bacteria 3767688
423 2974327899 2974324384 Bacteria 3750535
424 2977229506 2977228692 Bacteria 3450105
425 2977238446 2977236895 Bacteria 3569373
426 2977264714 2977264416 Bacteria 3750737
427 2984543774 2984542743 Bacteria 3569378
428 2984553891 2984551494 Bacteria 3877562
429 2984583348 2984580707 Bacteria 3351387
430 3001119155 3001119090 Bacteria 3449530
431 8004024036 8004021418 Bacteria 4313954
432 8004029215 8004025490 Bacteria 4327753
433 8004184076 8004182704 Bacteria 3391155
434 8004215170 8004212874 Bacteria 2861420
435 8016256061 8016254467 Bacteria 3797036
436 8045833470 8045830549 Bacteria 4444727
437 Ga0395898_0014462
438 JGI24740J21852_10002591
439 JGI24739J22299_10007264
440 JGI25154J39366_1002454
441 JGI25164J39214_1000769
442 JGI25406J46586_10020397
443 JGI25165J46597_1000005
444 JGI25407J50210_10000807
445 Ga0006562J51391_1010836
446 Ga0006562J51391_1018456
447 Ga0055533_1000002
448 Ga0055525_1000142
449 Ga0055527_1000004
450 Ga0055542_1000307
451 Ga0055529_1000008
452 Ga0070658_10000122
453 Ga0070658_10046640
454 Ga0070658_10046819
455 Ga0070660_100115474
456 Ga0070661_100035007
457 Ga0070668_100022791
458 Ga0070685_10010635
459 Ga0070698_100025796
460 Ga0068853_100046635
461 Ga0068855_100190954
462 Ga0068856_100071645
463 Ga0068856_100114260
464 Ga0068852_100024812
465 Ga0068861_100024602
466 Ga0068851_10000003
467 Ga0081455_10028260
468 Ga0081455_10060708
469 Ga0081538_10000522
470 Ga0081538_10007704
471 Ga0081538_10007868
472 Ga0081538_10008017
473 Ga0081539_10019374
474 Ga0075365_10010379
475 Ga0075363_100100412
476 Ga0075364_10126388
477 Ga0075432_10006490
478 Ga0075369_10009837
479 Ga0075427_10000733
480 Ga0075430_100003482
481 Ga0075431_100029335
482 Ga0075433_10100452
483 Ga0075429_100029277
484 Ga0105244_10086575
485 Ga0105240_10006064
486 Ga0105240_10060054
487 Ga0111539_10068868
488 Ga0105243_10061474
489 Ga0105241_10001064
490 Ga0105241_10090732
491 Ga0105248_10003592
492 Ga0105237_10000131
493 Ga0105238_10031598
494 Ga0105249_10005067
495 Ga0157371_10000825
496 Ga0157370_10096766
497 Ga0157369_10072999
498 Ga0157369_10379899
499 Ga0171462_1002
500 Ga0163162_10218555
501 Ga0157372_10123812
502 Ga0157375_10134435
503 Ga0163161_10061892
504 Ga0197907_10480862
505 Ga0209566_100013
506 Ga0209674_100001
507 Ga0209672_100011
508 Ga0209147_101041
509 Ga0209563_100001
510 Ga0209563_100165
511 Ga0207427_100325
512 Ga0209437_101278
513 Ga0209258_101076
514 Ga0209646_1000014
515 Ga0209677_100001
516 Ga0209677_101085
517 Ga0209148_1000023
518 Ga0209233_1000001
519 Ga0209455_1000023
520 Ga0207656_10000002
521 Ga0207655_1002720
522 Ga0207705_10000006
523 Ga0207654_10000001
524 Ga0207695_10006059
525 Ga0207695_10013887
526 Ga0207671_10000002
527 Ga0207694_10000092
528 Ga0207690_10001146
529 Ga0207690_10014454
530 Ga0207706_10009133
531 Ga0207711_10004780
532 Ga0207667_10006393
533 Ga0207667_10240240
534 Ga0207712_10059472
535 Ga0207668_10077968
536 Ga0207658_10009467
537 Ga0207703_10000031
538 Ga0207639_10107199
539 Ga0207678_10031516
540 Ga0207702_10264739
541 Ga0207674_10004399
542 Ga0207675_100013381
543 Ga0207698_10000277
544 Ga0207698_10135901
545 Ga0207428_10007161
546 Ga0307514_10033590
547 Ga0307405_10109082
548 Ga0307410_10006276
549 Ga0307410_10007489
550 Ga0307410_10082538
551 Ga0307406_10000040
552 Ga0307406_10000541
553 Ga0307406_10004111
554 Ga0307406_10004408
555 Ga0307407_10003100
556 Ga0307412_10007073
557 Ga0307412_10072203
558 Ga0307412_10089037
559 Ga0307412_10137416
560 Ga0307409_100080012
561 Ga0307416_100008846
562 Ga0307416_100008967
563 Ga0307416_100012622
564 Ga0307415_100002964
565 Ga0307415_100006120
566 Ga0307415_100006787
567 Ga0307415_100076931
568 Ga0395899_0002887
569 Ga0395900_0001268
570 Ga0395898_0000270
571 Ga0395898_0002175
572 Ga0395898_0145080
573 Ga0395905_0132496
574 Ga0395901_0036962
575 Ga0395901_0076757
576 Ga0395901_0121716
577 Ga0395901_0309169
578 Ga0439466_0011593
579 Ga0451833_0342895
580 Ga0451837_0314787
581 Ga0439442_000440
582 Ga0439442_002606
583 Ga0439449_0001421
584 Ga0439450_000036
585 Ga0439444_0000340
586 Ga0450916_000455
587 Ga0466972_0006508
588 Ga0466972_0036994
589 Ga0466965_0000007
590 Ga0466966_0010378
591 Ga0466966_0019666
592 Ga0466966_0164451
593 Ga0466961_0057634
594 Ga0466971_0013331
595 Ga0466970_0000121
596 Ga0466970_0010547
597 Ga0466970_0024309
598 Ga0495627_000312
599 Ga0495590_0000329
600 Ga0495644_0016521
601 Ga0495609_0052098
602 Ga0495656_0003282
603 Ga0495659_0019230
604 Ga0495661_0093857
605 Ga0495671_0075960
606 Ga0495677_0026611
607 Ga0496100_0012480
608 Ga0496102_0060300
609 Ga0496103_0010300
610 Ga0496104_0003233
611 Ga0496104_0089339
612 Ga0496105_0017470
613 Ga0496107_0047279
614 Ga0496109_0086210
615 Ga0496110_0092839
616 Ga0496111_0023834
617 Ga0496112_0167003
618 Ga0496114_0038195
619 Ga0496114_0059432
620 Ga0496114_0216085
621 Ga0496115_0036408
622 Ga0496115_0071800
623 Ga0496115_0135959
624 Ga0496116_0027774
625 Ga0496117_0000014
626 Ga0496117_0000808
627 Ga0496117_0001925
628 Ga0496117_0006325
629 Ga0496117_0006847
630 Ga0496117_0014300
631 Ga0496118_0000601
632 Ga0496118_0014034
633 Ga0496118_0038477
634 Ga0496119_0001243
635 Ga0496119_0002674
636 Ga0496119_0002944
637 Ga0496119_0006163
638 Ga0496119_0007487
639 Ga0496119_0013750
640 Ga0496119_0023820
641 Ga0496119_0029470
642 Ga0496119_0035518
643 Ga0496119_0063512
644 Ga0496120_0000655
645 Ga0496120_0001070
646 Ga0496120_0001359
647 Ga0496120_0003745
648 Ga0496120_0095036
649 Ga0496121_0000277
650 Ga0496121_0053372
651 Ga0496121_0175996
652 Ga0496122_0000358
653 Ga0496122_0000475
654 Ga0496122_0003643
655 Ga0496122_0004671
656 Ga0496122_0015130
657 Ga0496122_0058642
658 Ga0496123_0000011
659 Ga0496123_0000280
660 Ga0496123_0001137
661 Ga0496123_0053449
662 Ga0496124_0000899
663 Ga0496124_0011327
664 Ga0496124_0015407
665 Ga0496124_0087223
666 Ga0496125_0000444
667 Ga0496125_0002089
668 Ga0496125_0009474
669 Ga0496125_0020834
670 Ga0496125_0030397
671 Ga0496125_0048354
672 Ga0496126_0000912
673 Ga0496126_0007451
674 Ga0496126_0008290
675 Ga0496126_0014990
676 Ga0496126_0015932
677 Ga0496126_0044700
678 Ga0496126_0053916
679 Ga0496126_0069136
680 Ga0501031_0124278
681 Ga0501032_0073041
682 Ga0501033_0015202
683 Ga0501033_0025171
684 Ga0501034_0001656
685 Ga0501034_0051673
686 Ga0501034_0051679
687 Ga0501034_0113297
688 Ga0501034_0122520
689 Ga0501036_0001354
690 Ga0501037_0006742
691 Ga0501038_0004443
692 Ga0501038_0005477
693 Ga0501038_0043374
694 Ga0501038_0049611
695 Ga0501038_0071265
696 Ga0501040_0019707
697 Ga0501041_0000506
698 Ga0501042_0034185
699 Ga0501042_0052649
700 Ga0501043_0002084
701 Ga0501043_0005043
702 Ga0501046_0189329
703 Ga0501047_0006712
704 Ga0501047_0128913
705 Ga0501048_0002335
706 Ga0501048_0003348
707 Ga0501068_0081290
708 Ga0501070_0000098
709 Ga0501070_0001718
710 Ga0501070_0003134
711 Ga0501070_0024230
712 Ga0501071_0027455
713 Ga0501072_0006748
714 Ga0501072_0151003
715 Ga0501072_0187237
716 Ga0501073_0001325
717 Ga0501074_0000608
718 Ga0501074_0002170
719 Ga0501076_0000984
720 Ga0501076_0005274
721 Ga0501077_0001005
722 Ga0501079_0000901
723 Ga0501079_0005409
724 Ga0501079_0021276
725 Ga0501080_0003872
726 Ga0501080_0023742
727 Ga0501081_0000387
728 Ga0501081_0035491
729 Ga0501083_0000495
730 Ga0501083_0028230
731 Ga0501035_0005181
732 Ga0501035_0082816
733 Ga0501044_0007396
734 Ga0501045_0000201
735 Ga0501045_0009117
736 nmdc:mga00v17_33771_c1
737 nmdc:mga00v17_39890_c1
738 nmdc:mga00v17_43942_c1
739 nmdc:mga0yw44_86377_c1
740 nmdc:mga05p37_17532_c2
741 nmdc:mga05p37_4336_c1
742 nmdc:mga09592_9942_c1
743 nmdc:mga06r32_3863_c1
744 nmdc:mga08y16_5916_c1
745 nmdc:mga0a205_2648_c1
746 nmdc:mga0sz30_49439_c1
747 Ga0500635_0000038
748 Ga0500643_000487
749 Ga0500651_0000300
750 Ga0500650_0052841
751 Ga0500556_0000001
752 Ga0500556_0000140
753 Ga0500562_000303
754 Ga0500655_004464
755 Ga0500559_0000156
756 Ga0500559_0000372
757 Ga0500559_0002090
758 Ga0500559_0006409
759 Ga0500568_0000006
760 Ga0500568_0000026
761 Ga0500568_0000172
762 Ga0500568_0012873
763 Ga0500573_0000013
764 Ga0500573_0002394
765 Ga0500577_0002423
766 Ga0500590_011687
767 Ga0500616_0000156
768 Ga0500616_0000523
769 Ga0500620_000060
770 Ga0501084_0001057
771 Ga0501084_0021715
772 Ga0590075_001202
773 Ga0501082_0030912
774 Ga0466962_0019234
775 Ga0530510_0000116
776 Ga0530510_0002578
777 2555229786
778 2588107312
779 2643732931
780 2643751641
781 2643784744
782 2643847143
783 2643887932
784 2643997088
785 2644097215
786 2644171721
787 2644199115
788 2644681518
789 2655031827
790 2723640170
791 2729905885
792 2730231078
793 2739604180
794 2747953261
795 2753301728
796 2758225559
797 2774379666
798 2774382113
799 2774397765
800 2808629234
801 2808884036
802 2809226159
803 2812324907
804 2817509568
805 2821271458
806 2833712668
807 2844844452
808 2848552571
809 2852632416
810 2852645672
811 2852647961
812 2852663685
813 2852679137
814 2857480310
815 2857634294
816 2857711558
817 2857721315
818 2857726416
819 2857729124
820 2857731070
821 2857735868
822 2857739684
823 2862995849
824 2870623776
825 2870629118
826 2870803106
827 2870805163
828 2884763589
829 2893684981
830 2904433123
831 2904502756
832 2904512458
833 2905927546
834 2905929005
835 2906802358
836 2908677561
837 2908679302
838 2909075129
839 2919040543
840 2919043671
841 2919053314
842 2919056409
843 2919069949
844 2919397376
845 2919526402
846 2920883633
847 2928093052
848 2928106555
849 2928122370
850 2928155212
851 2928501629
852 2939658267
853 2945969208
854 2946025131
855 2946041664
856 2946083634
857 2966923004
858 2974295837
859 2974327899
860 2977229506
861 2977238446
862 2977264714
863 2984543774
864 2984553891
865 2984583348
866 3001119155
867 8004024036
868 8004029215
869 8004184076
870 8004215170
871 8016256061
872 8045833470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03129

HGTP_anticodon

Anticodon binding domain

405

495

0.94

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

185

377

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sld-assembly1.cif.gz_A-2 crystal structure of glycine trna ligase from mycobacterium thermoresistibile (apo) 0.9239 18 451
8slh-assembly1.cif.gz_A-2 crystal structure of glycine trna ligase from mycobacterium thermoresistibile (amp bound, hexagonal form) 0.8998 18 451
8u2q-assembly1.cif.gz_A crystal structure of glycine--trna ligase active site chimera from mycobacterium thermoresistibile/tuberculosis (g5a bound) 0.8971 18 451
8slf-assembly1.cif.gz_A crystal structure of glycine trna ligase from mycobacterium thermoresistibile (amp bound) 0.8938 18 451
8u2p-assembly1.cif.gz_A-2 crystal structure of glycine--trna ligase from mycobacterium tuberculosis (g5a bound) 0.8909 18 451
ID Description Score Start End Superfamily
af_Q57681_481_577_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9485 379 451 3.40.50.800
af_Q2FY08_370_463_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9348 380 451 3.40.50.800
af_Q54PF9_562_677_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9152 379 451 3.40.50.800
af_Q58406_325_416_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9144 379 449 3.40.50.800
af_Q9VUK8_646_762_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9142 379 451 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A3D0RVW4-F1-model_v4 Glycine--tRNA ligase 0.9809 225 339 GO:0004820
GO:0005737
GO:0006426
AF-A0A2V7KIP6-F1-model_v4 Glycine--tRNA ligase 0.9699 374 450 GO:0004820
GO:0005737
GO:0006426
AF-A0A2W4ZJP8-F1-model_v4 Glycine--tRNA ligase 0.9649 380 449 GO:0004820
GO:0005737
GO:0006426
AF-A0A3D0RVW4-F1-model_v4 Glycine--tRNA ligase 0.9644 225 339 GO:0004820
GO:0005737
GO:0006426
AF-A0A7J4MMH8-F1-model_v4 Anticodon-binding domain-containing protein 0.9616 376 450 GO:0004820
GO:0005737
GO:0006426

Map