F443597

General Info

Members Datasets Scaffolds Average Seq Length
436 114 872 175

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0249256|Ga0395905_0249256_301_879
Length 192
Sequence MQGAEGDDGVIRGFLDAHGYDPGPSQRPLLAGAISGILATVPAIVVLLYFGSLEVEAEILGISWTATLALGCVAMAIAGAAYARFFGRAANAVKGGWLFGMSFGFALWAAGAVLVLPLLSGGRAPAGEAAAGLALSLIVWGFATGILVPFVHRPLHESLETASKAVAVGPNAALEESGPIRQRQDQAAQAKR

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0249256 3300037471 Bacteria 1659
2 JGI24736J21556_1014152 3300001904 Bacteria 1284
3 JGI24741J21665_1011145 3300001915 Bacteria 1583
4 JGI24739J22299_10098878 3300001989 Unclassified 882
5 JGI24737J22298_10087452 3300001990 Bacteria 925
6 JGI24735J21928_10030613 3300002067 Bacteria 1598
7 rootH2_10163316 3300003320 Bacteria 1131
8 rootL2_10234417 3300003322 Bacteria 1813
9 rootH1_10229702 3300003323 Bacteria 1424
10 Ga0070658_10021494 3300005327 Bacteria 5171
11 Ga0070658_10022513 3300005327 Bacteria 5057
12 Ga0070658_10048824 3300005327 Bacteria 3428
13 Ga0070658_10093650 3300005327 Bacteria 2478
14 Ga0070658_10114399 3300005327 Bacteria 2237
15 Ga0070658_10124793 3300005327 Bacteria 2142
16 Ga0070658_10177014 3300005327 Bacteria 1794
17 Ga0070658_10201295 3300005327 Bacteria 1680
18 Ga0070658_10221588 3300005327 Bacteria 1600
19 Ga0070658_10224228 3300005327 Bacteria 1590
20 Ga0070658_10339656 3300005327 Unclassified 1284
21 Ga0070658_10397614 3300005327 Bacteria 1183
22 Ga0070658_10952556 3300005327 Unclassified 746
23 Ga0070676_10053477 3300005328 Bacteria 2379
24 Ga0070683_100015262 3300005329 Bacteria 6745
25 Ga0070683_100119460 3300005329 Bacteria 2490
26 Ga0070683_100207506 3300005329 Bacteria 1861
27 Ga0070683_100409781 3300005329 Bacteria 1293
28 Ga0070680_100031189 3300005336 Bacteria 4285
29 Ga0070680_100079490 3300005336 Bacteria 2703
30 Ga0070680_100650084 3300005336 Unclassified 906
31 Ga0070682_100019282 3300005337 Bacteria 3998
32 Ga0070660_100008662 3300005339 Bacteria 7125
33 Ga0070660_100020733 3300005339 Bacteria 4837
34 Ga0070660_100026741 3300005339 Bacteria 4299
35 Ga0070660_100210755 3300005339 Bacteria 1577
36 Ga0070660_100244875 3300005339 Bacteria 1461
37 Ga0070660_100310006 3300005339 Unclassified 1295
38 Ga0070660_100374081 3300005339 Bacteria 1176
39 Ga0070691_10009897 3300005341 Bacteria 4343
40 Ga0070691_10012494 3300005341 Bacteria 3889
41 Ga0070661_100040792 3300005344 Bacteria 3387
42 Ga0070661_100055385 3300005344 Bacteria 2904
43 Ga0070661_100122429 3300005344 Bacteria 1949
44 Ga0070661_100618352 3300005344 Bacteria 877
45 Ga0070692_10006461 3300005345 Bacteria 5091
46 Ga0070692_10059754 3300005345 Bacteria 2005
47 Ga0070692_10107831 3300005345 Bacteria 1536
48 Ga0070692_10488034 3300005345 Bacteria 796
49 Ga0070671_100077149 3300005355 Bacteria 2784
50 Ga0070673_100175745 3300005364 Bacteria 1830
51 Ga0070659_100008587 3300005366 Bacteria 7468
52 Ga0070659_100009865 3300005366 Bacteria 7024
53 Ga0070659_100010686 3300005366 Bacteria 6762
54 Ga0070659_100019577 3300005366 Bacteria 5131
55 Ga0070659_100037843 3300005366 Bacteria 3762
56 Ga0070659_100050500 3300005366 Bacteria 3269
57 Ga0070659_100082666 3300005366 Bacteria 2565
58 Ga0070659_100656492 3300005366 Bacteria 905
59 Ga0070714_100201219 3300005435 Bacteria 1822
60 Ga0070714_100263435 3300005435 Bacteria 1597
61 Ga0070714_100691605 3300005435 Bacteria 984
62 Ga0070714_101021148 3300005435 Bacteria 805
63 Ga0070714_101480389 3300005435 Bacteria 663
64 Ga0070663_100003022 3300005455 Bacteria 9606
65 Ga0070663_100081129 3300005455 Bacteria 2383
66 Ga0070662_100021286 3300005457 Bacteria 4427
67 Ga0070662_100550974 3300005457 Bacteria 966
68 Ga0070681_10038064 3300005458 Bacteria 4823
69 Ga0070681_10100282 3300005458 Bacteria 2841
70 Ga0070681_10164269 3300005458 Bacteria 2143
71 Ga0070681_10364200 3300005458 Bacteria 1356
72 Ga0070679_100039431 3300005530 Bacteria 4694
73 Ga0070679_100045779 3300005530 Bacteria 4359
74 Ga0070679_100063973 3300005530 Bacteria 3666
75 Ga0070679_100111563 3300005530 Bacteria 2721
76 Ga0070679_100278096 3300005530 Bacteria 1627
77 Ga0070684_100010629 3300005535 Bacteria 7298
78 Ga0070684_100050835 3300005535 Bacteria 3600
79 Ga0070684_100906957 3300005535 Bacteria 826
80 Ga0068853_100013457 3300005539 Bacteria 6680
81 Ga0068853_100022095 3300005539 Bacteria 5309
82 Ga0068853_100086075 3300005539 Bacteria 2756
83 Ga0068853_100149804 3300005539 Bacteria 2099
84 Ga0068853_100169080 3300005539 Unclassified 1977
85 Ga0068853_100243003 3300005539 Bacteria 1650
86 Ga0068853_101032242 3300005539 Unclassified 792
87 Ga0070693_100134170 3300005547 Bacteria 1551
88 Ga0068855_100013991 3300005563 Bacteria 9673
89 Ga0068855_100124351 3300005563 Bacteria 2951
90 Ga0068855_100223129 3300005563 Viruses 2112
91 Ga0068855_100634041 3300005563 Bacteria 1149
92 Ga0068855_101318622 3300005563 Unclassified 746
93 Ga0070664_100140432 3300005564 Bacteria 2127
94 Ga0070664_100186745 3300005564 Bacteria 1845
95 Ga0070664_100221555 3300005564 Bacteria 1693
96 Ga0070664_100306295 3300005564 Bacteria 1436
97 Ga0070664_100385283 3300005564 Bacteria 1280
98 Ga0068857_100034480 3300005577 Bacteria 4477
99 Ga0068857_100214837 3300005577 Bacteria 1755
100 Ga0068857_100226073 3300005577 Unclassified 1710
101 Ga0068857_100617291 3300005577 Bacteria 1026
102 Ga0068857_100862911 3300005577 Bacteria 867
103 Ga0068854_100020729 3300005578 Bacteria 4453
104 Ga0068854_100061863 3300005578 Bacteria 2712
105 Ga0068854_100143346 3300005578 Bacteria 1835
106 Ga0068854_100147870 3300005578 Bacteria 1809
107 Ga0068854_100232116 3300005578 Bacteria 1465
108 Ga0068854_100704973 3300005578 Unclassified 871
109 Ga0068856_100051551 3300005614 Bacteria 4057
110 Ga0068856_100078670 3300005614 Bacteria 3269
111 Ga0068856_100242258 3300005614 Bacteria 1818
112 Ga0068856_100564296 3300005614 Bacteria 1160
113 Ga0068856_100717015 3300005614 Unclassified 1020
114 Ga0068856_100789284 3300005614 Unclassified 969
115 Ga0068856_100945437 3300005614 Unclassified 880
116 Ga0068856_100973416 3300005614 Bacteria 867
117 Ga0068852_100002131 3300005616 Bacteria 13562
118 Ga0068852_100004781 3300005616 Bacteria 9620
119 Ga0068852_100017772 3300005616 Bacteria 5588
120 Ga0068852_100165063 3300005616 Bacteria 2071
121 Ga0068852_100386124 3300005616 Bacteria 1374
122 Ga0068852_100631349 3300005616 Unclassified 1077
123 Ga0068852_101279526 3300005616 Bacteria 755
124 Ga0068864_100004541 3300005618 Bacteria 11400
125 Ga0068851_10226784 3300005834 Bacteria 1052
126 Ga0068851_10375737 3300005834 Unclassified 832
127 Ga0068863_100733596 3300005841 Unclassified 983
128 Ga0105240_10019627 3300009093 Bacteria 9028
129 Ga0105240_10027587 3300009093 Bacteria 7433
130 Ga0105240_10034327 3300009093 Bacteria 6544
131 Ga0105240_10163852 3300009093 Bacteria 2638
132 Ga0105241_10363813 3300009174 Bacteria 1259
133 Ga0105248_10191805 3300009177 Bacteria 2303
134 Ga0105237_10008093 3300009545 Bacteria 11424
135 Ga0105237_10011326 3300009545 Bacteria 9434
136 Ga0105237_10522608 3300009545 Bacteria 1193
137 Ga0105238_10009347 3300009551 Bacteria 9819
138 Ga0105238_10009558 3300009551 Bacteria 9701
139 Ga0105238_10021258 3300009551 Bacteria 6613
140 Ga0105238_10048689 3300009551 Bacteria 4270
141 Ga0105238_10634536 3300009551 Unclassified 1078
142 Ga0105239_10148269 3300010375 Bacteria 2618
143 Ga0105239_11594278 3300010375 Unclassified 755
144 Ga0157373_10014309 3300013100 Bacteria 5816
145 Ga0157373_10015698 3300013100 Bacteria 5532
146 Ga0157373_10039048 3300013100 Bacteria 3400
147 Ga0157373_10093507 3300013100 Bacteria 2118
148 Ga0157373_10096057 3300013100 Bacteria 2086
149 Ga0157373_10186404 3300013100 Bacteria 1461
150 Ga0157373_10201173 3300013100 Bacteria 1404
151 Ga0157373_10224604 3300013100 Bacteria 1325
152 Ga0157371_10005979 3300013102 Bacteria 10151
153 Ga0157371_10020196 3300013102 Bacteria 4902
154 Ga0157371_10029868 3300013102 Bacteria 3935
155 Ga0157371_10058140 3300013102 Bacteria 2743
156 Ga0157371_10106704 3300013102 Bacteria 1988
157 Ga0157371_10240659 3300013102 Bacteria 1302
158 Ga0157371_10250455 3300013102 Bacteria 1275
159 Ga0157370_10020069 3300013104 Bacteria 6684
160 Ga0157370_10164352 3300013104 Bacteria 2064
161 Ga0157370_10165663 3300013104 Bacteria 2055
162 Ga0157370_10310047 3300013104 Unclassified 1456
163 Ga0157370_10310061 3300013104 Bacteria 1456
164 Ga0157370_10390707 3300013104 Bacteria 1281
165 Ga0157369_10000239 3300013105 Bacteria 76144
166 Ga0157369_10006870 3300013105 Bacteria 13128
167 Ga0157369_10009620 3300013105 Bacteria 11052
168 Ga0157369_10020994 3300013105 Bacteria 7302
169 Ga0157369_10033449 3300013105 Bacteria 5649
170 Ga0157369_10060860 3300013105 Bacteria 4071
171 Ga0157369_10105760 3300013105 Bacteria 2996
172 Ga0157369_10144757 3300013105 Bacteria 2513
173 Ga0157369_10286852 3300013105 Bacteria 1714
174 Ga0157369_10692277 3300013105 Bacteria 1050
175 Ga0157369_10739088 3300013105 Bacteria 1013
176 Ga0157369_10771140 3300013105 Bacteria 989
177 Ga0157369_11793695 3300013105 Unclassified 623
178 Ga0157374_10617838 3300013296 Unclassified 1094
179 Ga0157372_10002183 3300013307 Bacteria 21305
180 Ga0157372_10024533 3300013307 Bacteria 6553
181 Ga0157372_10241611 3300013307 Unclassified 2095
182 Ga0157372_10335615 3300013307 Bacteria 1760
183 Ga0157372_10346894 3300013307 Bacteria 1730
184 Ga0157372_11250907 3300013307 Bacteria 857
185 Ga0157372_11710842 3300013307 Unclassified 724
186 Ga0206356_11610832 3300020070 Bacteria 574
187 Ga0206354_11178944 3300020081 Bacteria 1405
188 Ga0206353_10021007 3300020082 Unclassified 744
189 Ga0206353_10359675 3300020082 Bacteria 2307
190 Ga0206353_10647615 3300020082 Bacteria 666
191 Ga0206353_11059437 3300020082 Bacteria 958
192 Ga0206353_11369007 3300020082 Unclassified 779
193 Ga0207656_10201788 3300025321 Bacteria 961
194 Ga0207647_10002445 3300025904 Bacteria 14083
195 Ga0207647_10038137 3300025904 Bacteria 3040
196 Ga0207647_10098494 3300025904 Bacteria 1737
197 Ga0207645_10072000 3300025907 Bacteria 2213
198 Ga0207705_10000003 3300025909 Bacteria 709270
199 Ga0207705_10004766 3300025909 Bacteria 10217
200 Ga0207705_10007786 3300025909 Bacteria 7868
201 Ga0207705_10047591 3300025909 Bacteria 3084
202 Ga0207705_10053649 3300025909 Bacteria 2905
203 Ga0207705_10082178 3300025909 Bacteria 2349
204 Ga0207705_10115188 3300025909 Bacteria 1989
205 Ga0207705_10139071 3300025909 Bacteria 1812
206 Ga0207705_10151756 3300025909 Bacteria 1736
207 Ga0207705_10166390 3300025909 Bacteria 1658
208 Ga0207705_10166470 3300025909 Bacteria 1658
209 Ga0207705_10168910 3300025909 Bacteria 1646
210 Ga0207705_10241329 3300025909 Bacteria 1376
211 Ga0207705_10520481 3300025909 Bacteria 924
212 Ga0207705_10525885 3300025909 Unclassified 919
213 Ga0207705_10867447 3300025909 Bacteria 700
214 Ga0207654_10199829 3300025911 Bacteria 1316
215 Ga0207707_10020591 3300025912 Bacteria 5762
216 Ga0207707_10064921 3300025912 Bacteria 3179
217 Ga0207707_10136167 3300025912 Bacteria 2147
218 Ga0207707_11097382 3300025912 Bacteria 649
219 Ga0207695_10004994 3300025913 Bacteria 17834
220 Ga0207695_10014252 3300025913 Bacteria 9430
221 Ga0207695_10044125 3300025913 Bacteria 4745
222 Ga0207695_10079694 3300025913 Bacteria 3318
223 Ga0207660_10043156 3300025917 Bacteria 3168
224 Ga0207660_10136548 3300025917 Bacteria 1872
225 Ga0207660_10216166 3300025917 Bacteria 1503
226 Ga0207660_10537131 3300025917 Unclassified 950
227 Ga0207660_10563989 3300025917 Unclassified 926
228 Ga0207657_10000468 3300025919 Bacteria 42779
229 Ga0207657_10003049 3300025919 Bacteria 17918
230 Ga0207657_10010104 3300025919 Bacteria 9436
231 Ga0207657_10011223 3300025919 Bacteria 8904
232 Ga0207657_10024738 3300025919 Bacteria 5551
233 Ga0207657_10053759 3300025919 Bacteria 3487
234 Ga0207657_10058596 3300025919 Bacteria 3313
235 Ga0207657_10077594 3300025919 Bacteria 2799
236 Ga0207657_10190226 3300025919 Bacteria 1656
237 Ga0207649_10001056 3300025920 Bacteria 16892
238 Ga0207649_10008289 3300025920 Bacteria 5663
239 Ga0207649_10056635 3300025920 Bacteria 2449
240 Ga0207649_10081990 3300025920 Bacteria 2090
241 Ga0207649_10253620 3300025920 Unclassified 1268
242 Ga0207649_10378804 3300025920 Bacteria 1054
243 Ga0207652_10014254 3300025921 Bacteria 6438
244 Ga0207652_10257804 3300025921 Bacteria 1573
245 Ga0207652_10420221 3300025921 Bacteria 1206
246 Ga0207652_10482626 3300025921 Bacteria 1116
247 Ga0207652_10788517 3300025921 Unclassified 844
248 Ga0207694_10008960 3300025924 Bacteria 7555
249 Ga0207694_10011624 3300025924 Bacteria 6642
250 Ga0207694_10141856 3300025924 Bacteria 1932
251 Ga0207694_10261693 3300025924 Unclassified 1417
252 Ga0207694_10431177 3300025924 Unclassified 1099
253 Ga0207664_10023434 3300025929 Bacteria 4625
254 Ga0207664_10344751 3300025929 Bacteria 1318
255 Ga0207664_10798800 3300025929 Unclassified 849
256 Ga0207664_10852252 3300025929 Unclassified 819
257 Ga0207644_10753624 3300025931 Bacteria 813
258 Ga0207690_10006163 3300025932 Bacteria 7101
259 Ga0207690_10006615 3300025932 Bacteria 6866
260 Ga0207690_10022192 3300025932 Bacteria 3945
261 Ga0207690_10040848 3300025932 Bacteria 3035
262 Ga0207690_10138680 3300025932 Bacteria 1789
263 Ga0207690_10278948 3300025932 Bacteria 1301
264 Ga0207690_10872772 3300025932 Bacteria 745
265 Ga0207706_10084694 3300025933 Bacteria 2787
266 Ga0207706_10242002 3300025933 Bacteria 1577
267 Ga0207706_10503838 3300025933 Bacteria 1045
268 Ga0207711_10008307 3300025941 Bacteria 8692
269 Ga0207661_10011736 3300025944 Bacteria 6359
270 Ga0207661_10028936 3300025944 Bacteria 4249
271 Ga0207679_10015933 3300025945 Bacteria 4982
272 Ga0207679_10277045 3300025945 Bacteria 1437
273 Ga0207679_10587102 3300025945 Bacteria 1003
274 Ga0207679_10910123 3300025945 Unclassified 805
275 Ga0207667_10029381 3300025949 Bacteria 5962
276 Ga0207667_10238197 3300025949 Bacteria 1863
277 Ga0207667_10319902 3300025949 Bacteria 1584
278 Ga0207667_10398574 3300025949 Bacteria 1401
279 Ga0207640_10001282 3300025981 Bacteria 13662
280 Ga0207640_10002216 3300025981 Bacteria 10455
281 Ga0207640_10113058 3300025981 Bacteria 1929
282 Ga0207640_10212600 3300025981 Unclassified 1474
283 Ga0207640_10364844 3300025981 Bacteria 1165
284 Ga0207639_10001539 3300026041 Bacteria 15489
285 Ga0207639_10023074 3300026041 Bacteria 4489
286 Ga0207639_10038968 3300026041 Bacteria 3538
287 Ga0207639_10060519 3300026041 Unclassified 2921
288 Ga0207678_10002336 3300026067 Bacteria 17192
289 Ga0207678_10016782 3300026067 Bacteria 6431
290 Ga0207678_10051448 3300026067 Bacteria 3556
291 Ga0207678_10136470 3300026067 Bacteria 2093
292 Ga0207678_10456058 3300026067 Bacteria 1112
293 Ga0207702_10009071 3300026078 Bacteria 8372
294 Ga0207702_10022689 3300026078 Bacteria 5205
295 Ga0207702_10025533 3300026078 Bacteria 4904
296 Ga0207702_10090579 3300026078 Bacteria 2676
297 Ga0207702_10114715 3300026078 Bacteria 2401
298 Ga0207702_10149324 3300026078 Bacteria 2124
299 Ga0207702_10744121 3300026078 Bacteria 968
300 Ga0207702_11147019 3300026078 Bacteria 771
301 Ga0207676_10051784 3300026095 Bacteria 3206
302 Ga0207674_10001151 3300026116 Bacteria 34261
303 Ga0207674_10005788 3300026116 Bacteria 14661
304 Ga0207674_10010596 3300026116 Bacteria 10430
305 Ga0207674_10044847 3300026116 Bacteria 4553
306 Ga0207674_10534832 3300026116 Bacteria 1132
307 Ga0207698_10000912 3300026142 Bacteria 17183
308 Ga0207698_10004967 3300026142 Bacteria 8153
309 Ga0207698_10011656 3300026142 Bacteria 5712
310 Ga0207698_10014443 3300026142 Bacteria 5250
311 Ga0207698_10137001 3300026142 Bacteria 2102
312 Ga0207698_10159994 3300026142 Unclassified 1968
313 Ga0207698_10242122 3300026142 Bacteria 1645
314 Ga0307408_100357473 3300031548 Bacteria 1241
315 Ga0307405_10348263 3300031731 Bacteria 1142
316 Ga0307413_10038458 3300031824 Bacteria 2773
317 Ga0307410_10057648 3300031852 Bacteria 2645
318 Ga0307406_10229825 3300031901 Bacteria 1384
319 Ga0307406_10538336 3300031901 Bacteria 953
320 Ga0307407_10119791 3300031903 Bacteria 1666
321 Ga0307407_10199617 3300031903 Bacteria 1339
322 Ga0307407_10300278 3300031903 Unclassified 1119
323 Ga0307412_10710888 3300031911 Unclassified 863
324 Ga0307409_100027602 3300031995 Bacteria 4026
325 Ga0307409_100253129 3300031995 Bacteria 1611
326 Ga0307409_100358095 3300031995 Bacteria 1379
327 Ga0307416_100358365 3300032002 Bacteria 1479
328 Ga0307416_101361402 3300032002 Unclassified 815
329 Ga0307414_10021793 3300032004 Bacteria 4030
330 Ga0307414_10987675 3300032004 Unclassified 774
331 Ga0307415_100084074 3300032126 Unclassified 2282
332 Ga0307415_100260578 3300032126 Bacteria 1414
333 Ga0395899_0005013 3300037312 Bacteria 10302
334 Ga0395899_0010954 3300037312 Bacteria 6946
335 Ga0395899_0023244 3300037312 Bacteria 4699
336 Ga0395899_0051702 3300037312 Bacteria 3048
337 Ga0395899_0062453 3300037312 Unclassified 2743
338 Ga0395899_0082978 3300037312 Bacteria 2330
339 Ga0395899_0086077 3300037312 Bacteria 2283
340 Ga0395899_0101001 3300037312 Bacteria 2082
341 Ga0395899_0296057 3300037312 Unclassified 1096
342 Ga0395899_0355054 3300037312 Unclassified 979
343 Ga0395899_0365182 3300037312 Unclassified 962
344 Ga0395900_0001734 3300037418 Bacteria 25160
345 Ga0395900_0019822 3300037418 Bacteria 6853
346 Ga0395900_0031503 3300037418 Bacteria 5449
347 Ga0395900_0043395 3300037418 Bacteria 4635
348 Ga0395900_0049551 3300037418 Bacteria 4327
349 Ga0395900_0056311 3300037418 Bacteria 4047
350 Ga0395900_0059241 3300037418 Bacteria 3941
351 Ga0395900_0061150 3300037418 Unclassified 3873
352 Ga0395900_0080210 3300037418 Bacteria 3353
353 Ga0395900_0103141 3300037418 Bacteria 2930
354 Ga0395900_0148768 3300037418 Bacteria 2393
355 Ga0395900_0171878 3300037418 Bacteria 2205
356 Ga0395900_0260435 3300037418 Unclassified 1732
357 Ga0395900_0352027 3300037418 Unclassified 1446
358 Ga0395900_0617153 3300037418 Unclassified 1023
359 Ga0395900_1548826 3300037418 Bacteria 575
360 Ga0395898_0001129 3300037466 Bacteria 40961
361 Ga0395898_0004355 3300037466 Bacteria 15496
362 Ga0395898_0011006 3300037466 Bacteria 9426
363 Ga0395898_0013237 3300037466 Bacteria 8499
364 Ga0395898_0027612 3300037466 Bacteria 5693
365 Ga0395898_0033031 3300037466 Bacteria 5165
366 Ga0395898_0048385 3300037466 Bacteria 4170
367 Ga0395898_0087191 3300037466 Bacteria 3007
368 Ga0395898_0189923 3300037466 Bacteria 1963
369 Ga0395898_0214652 3300037466 Bacteria 1835
370 Ga0395898_0404388 3300037466 Unclassified 1302
371 Ga0395898_0485191 3300037466 Bacteria 1176
372 Ga0395898_0638090 3300037466 Bacteria 1007
373 Ga0395898_0686617 3300037466 Bacteria 966
374 Ga0395905_0000109 3300037471 Bacteria 137754
375 Ga0395905_0035459 3300037471 Bacteria 4684
376 Ga0395905_0088207 3300037471 Bacteria 2908
377 Ga0395905_0119263 3300037471 Bacteria 2479
378 Ga0395905_0157292 3300037471 Bacteria 2137
379 Ga0395905_0168361 3300037471 Bacteria 2059
380 Ga0395905_0641650 3300037471 Unclassified 964
381 Ga0395905_0662961 3300037471 Bacteria 945
382 Ga0395901_0000140 3300038443 Bacteria 94487
383 Ga0395901_0000763 3300038443 Bacteria 36070
384 Ga0395901_0002327 3300038443 Bacteria 19364
385 Ga0395901_0022994 3300038443 Bacteria 6389
386 Ga0395901_0029574 3300038443 Bacteria 5641
387 Ga0395901_0067461 3300038443 Bacteria 3725
388 Ga0395901_0077874 3300038443 Bacteria 3460
389 Ga0395901_0250261 3300038443 Bacteria 1846
390 Ga0395901_0298487 3300038443 Bacteria 1670
391 Ga0395901_0412335 3300038443 Bacteria 1386
392 Ga0395901_0804864 3300038443 Bacteria 928
393 Ga0466969_0014738 3300044656 Bacteria 4109
394 Ga0466966_0000939 3300044684 Bacteria 18614
395 Ga0466966_0017112 3300044684 Bacteria 4796
396 Ga0466963_0008859 3300044694 Bacteria 6038
397 Ga0466963_0036527 3300044694 Bacteria 3205
398 Ga0466963_0203120 3300044694 Bacteria 1386
399 Ga0466963_0214842 3300044694 Bacteria 1346
400 Ga0466963_0739993 3300044694 Bacteria 694
401 Ga0466971_0001935 3300044719 Bacteria 8789
402 Ga0466971_0038164 3300044719 Bacteria 2155
403 Ga0466971_0085127 3300044719 Unclassified 1444
404 Ga0466970_0028135 3300044765 Bacteria 2952
405 Ga0466957_0000515 3300044842 Bacteria 19383
406 Ga0466957_0001777 3300044842 Bacteria 11344
407 Ga0466957_0033066 3300044842 Bacteria 3101
408 Ga0466957_0061617 3300044842 Bacteria 2303
409 Ga0466958_0023553 3300045836 Bacteria 3615
410 Ga0466958_0039109 3300045836 Bacteria 2848
411 Ga0466958_0105233 3300045836 Bacteria 1758
412 Ga0466958_0241364 3300045836 Bacteria 1155
413 Ga0466958_0287653 3300045836 Bacteria 1054
414 Ga0466958_0315315 3300045836 Bacteria 1005
415 Ga0466967_0007210 3300045976 Bacteria 7989
416 Ga0466967_0008683 3300045976 Bacteria 7476
417 Ga0466967_0035346 3300045976 Bacteria 4252
418 Ga0466967_0045677 3300045976 Bacteria 3807
419 Ga0466967_0079713 3300045976 Bacteria 2952
420 Ga0466967_0248670 3300045976 Bacteria 1698
421 Ga0466967_0430920 3300045976 Unclassified 1286
422 Ga0466967_0647603 3300045976 Bacteria 1045
423 Ga0466967_2336892 3300045976 Bacteria 530
424 Ga0496100_0239845 3300048903 Bacteria 1337
425 Ga0496101_0110747 3300048904 Bacteria 2066
426 Ga0496102_0385389 3300048905 Bacteria 1319
427 Ga0496106_0260632 3300048909 Bacteria 1387
428 Ga0496107_0055558 3300048910 Bacteria 2859
429 Ga0496108_0094568 3300048911 Bacteria 2544
430 Ga0496109_0001322 3300048912 Bacteria 20436
431 Ga0496110_0068517 3300048913 Bacteria 3141
432 Ga0496112_0001301 3300048915 Bacteria 18983
433 Ga0496112_0007807 3300048915 Bacteria 9523
434 Ga0496113_0003389 3300048916 Bacteria 9534
435 Ga0496113_0241076 3300048916 Bacteria 1443
436 Ga0466962_0035202 3300061719 Bacteria 2397
437 Ga0395905_0249256
438 JGI24736J21556_1014152
439 JGI24741J21665_1011145
440 JGI24739J22299_10098878
441 JGI24737J22298_10087452
442 JGI24735J21928_10030613
443 rootH2_10163316
444 rootL2_10234417
445 rootH1_10229702
446 Ga0070658_10021494
447 Ga0070658_10022513
448 Ga0070658_10048824
449 Ga0070658_10093650
450 Ga0070658_10114399
451 Ga0070658_10124793
452 Ga0070658_10177014
453 Ga0070658_10201295
454 Ga0070658_10221588
455 Ga0070658_10224228
456 Ga0070658_10339656
457 Ga0070658_10397614
458 Ga0070658_10952556
459 Ga0070676_10053477
460 Ga0070683_100015262
461 Ga0070683_100119460
462 Ga0070683_100207506
463 Ga0070683_100409781
464 Ga0070680_100031189
465 Ga0070680_100079490
466 Ga0070680_100650084
467 Ga0070682_100019282
468 Ga0070660_100008662
469 Ga0070660_100020733
470 Ga0070660_100026741
471 Ga0070660_100210755
472 Ga0070660_100244875
473 Ga0070660_100310006
474 Ga0070660_100374081
475 Ga0070691_10009897
476 Ga0070691_10012494
477 Ga0070661_100040792
478 Ga0070661_100055385
479 Ga0070661_100122429
480 Ga0070661_100618352
481 Ga0070692_10006461
482 Ga0070692_10059754
483 Ga0070692_10107831
484 Ga0070692_10488034
485 Ga0070671_100077149
486 Ga0070673_100175745
487 Ga0070659_100008587
488 Ga0070659_100009865
489 Ga0070659_100010686
490 Ga0070659_100019577
491 Ga0070659_100037843
492 Ga0070659_100050500
493 Ga0070659_100082666
494 Ga0070659_100656492
495 Ga0070714_100201219
496 Ga0070714_100263435
497 Ga0070714_100691605
498 Ga0070714_101021148
499 Ga0070714_101480389
500 Ga0070663_100003022
501 Ga0070663_100081129
502 Ga0070662_100021286
503 Ga0070662_100550974
504 Ga0070681_10038064
505 Ga0070681_10100282
506 Ga0070681_10164269
507 Ga0070681_10364200
508 Ga0070679_100039431
509 Ga0070679_100045779
510 Ga0070679_100063973
511 Ga0070679_100111563
512 Ga0070679_100278096
513 Ga0070684_100010629
514 Ga0070684_100050835
515 Ga0070684_100906957
516 Ga0068853_100013457
517 Ga0068853_100022095
518 Ga0068853_100086075
519 Ga0068853_100149804
520 Ga0068853_100169080
521 Ga0068853_100243003
522 Ga0068853_101032242
523 Ga0070693_100134170
524 Ga0068855_100013991
525 Ga0068855_100124351
526 Ga0068855_100223129
527 Ga0068855_100634041
528 Ga0068855_101318622
529 Ga0070664_100140432
530 Ga0070664_100186745
531 Ga0070664_100221555
532 Ga0070664_100306295
533 Ga0070664_100385283
534 Ga0068857_100034480
535 Ga0068857_100214837
536 Ga0068857_100226073
537 Ga0068857_100617291
538 Ga0068857_100862911
539 Ga0068854_100020729
540 Ga0068854_100061863
541 Ga0068854_100143346
542 Ga0068854_100147870
543 Ga0068854_100232116
544 Ga0068854_100704973
545 Ga0068856_100051551
546 Ga0068856_100078670
547 Ga0068856_100242258
548 Ga0068856_100564296
549 Ga0068856_100717015
550 Ga0068856_100789284
551 Ga0068856_100945437
552 Ga0068856_100973416
553 Ga0068852_100002131
554 Ga0068852_100004781
555 Ga0068852_100017772
556 Ga0068852_100165063
557 Ga0068852_100386124
558 Ga0068852_100631349
559 Ga0068852_101279526
560 Ga0068864_100004541
561 Ga0068851_10226784
562 Ga0068851_10375737
563 Ga0068863_100733596
564 Ga0105240_10019627
565 Ga0105240_10027587
566 Ga0105240_10034327
567 Ga0105240_10163852
568 Ga0105241_10363813
569 Ga0105248_10191805
570 Ga0105237_10008093
571 Ga0105237_10011326
572 Ga0105237_10522608
573 Ga0105238_10009347
574 Ga0105238_10009558
575 Ga0105238_10021258
576 Ga0105238_10048689
577 Ga0105238_10634536
578 Ga0105239_10148269
579 Ga0105239_11594278
580 Ga0157373_10014309
581 Ga0157373_10015698
582 Ga0157373_10039048
583 Ga0157373_10093507
584 Ga0157373_10096057
585 Ga0157373_10186404
586 Ga0157373_10201173
587 Ga0157373_10224604
588 Ga0157371_10005979
589 Ga0157371_10020196
590 Ga0157371_10029868
591 Ga0157371_10058140
592 Ga0157371_10106704
593 Ga0157371_10240659
594 Ga0157371_10250455
595 Ga0157370_10020069
596 Ga0157370_10164352
597 Ga0157370_10165663
598 Ga0157370_10310047
599 Ga0157370_10310061
600 Ga0157370_10390707
601 Ga0157369_10000239
602 Ga0157369_10006870
603 Ga0157369_10009620
604 Ga0157369_10020994
605 Ga0157369_10033449
606 Ga0157369_10060860
607 Ga0157369_10105760
608 Ga0157369_10144757
609 Ga0157369_10286852
610 Ga0157369_10692277
611 Ga0157369_10739088
612 Ga0157369_10771140
613 Ga0157369_11793695
614 Ga0157374_10617838
615 Ga0157372_10002183
616 Ga0157372_10024533
617 Ga0157372_10241611
618 Ga0157372_10335615
619 Ga0157372_10346894
620 Ga0157372_11250907
621 Ga0157372_11710842
622 Ga0206356_11610832
623 Ga0206354_11178944
624 Ga0206353_10021007
625 Ga0206353_10359675
626 Ga0206353_10647615
627 Ga0206353_11059437
628 Ga0206353_11369007
629 Ga0207656_10201788
630 Ga0207647_10002445
631 Ga0207647_10038137
632 Ga0207647_10098494
633 Ga0207645_10072000
634 Ga0207705_10000003
635 Ga0207705_10004766
636 Ga0207705_10007786
637 Ga0207705_10047591
638 Ga0207705_10053649
639 Ga0207705_10082178
640 Ga0207705_10115188
641 Ga0207705_10139071
642 Ga0207705_10151756
643 Ga0207705_10166390
644 Ga0207705_10166470
645 Ga0207705_10168910
646 Ga0207705_10241329
647 Ga0207705_10520481
648 Ga0207705_10525885
649 Ga0207705_10867447
650 Ga0207654_10199829
651 Ga0207707_10020591
652 Ga0207707_10064921
653 Ga0207707_10136167
654 Ga0207707_11097382
655 Ga0207695_10004994
656 Ga0207695_10014252
657 Ga0207695_10044125
658 Ga0207695_10079694
659 Ga0207660_10043156
660 Ga0207660_10136548
661 Ga0207660_10216166
662 Ga0207660_10537131
663 Ga0207660_10563989
664 Ga0207657_10000468
665 Ga0207657_10003049
666 Ga0207657_10010104
667 Ga0207657_10011223
668 Ga0207657_10024738
669 Ga0207657_10053759
670 Ga0207657_10058596
671 Ga0207657_10077594
672 Ga0207657_10190226
673 Ga0207649_10001056
674 Ga0207649_10008289
675 Ga0207649_10056635
676 Ga0207649_10081990
677 Ga0207649_10253620
678 Ga0207649_10378804
679 Ga0207652_10014254
680 Ga0207652_10257804
681 Ga0207652_10420221
682 Ga0207652_10482626
683 Ga0207652_10788517
684 Ga0207694_10008960
685 Ga0207694_10011624
686 Ga0207694_10141856
687 Ga0207694_10261693
688 Ga0207694_10431177
689 Ga0207664_10023434
690 Ga0207664_10344751
691 Ga0207664_10798800
692 Ga0207664_10852252
693 Ga0207644_10753624
694 Ga0207690_10006163
695 Ga0207690_10006615
696 Ga0207690_10022192
697 Ga0207690_10040848
698 Ga0207690_10138680
699 Ga0207690_10278948
700 Ga0207690_10872772
701 Ga0207706_10084694
702 Ga0207706_10242002
703 Ga0207706_10503838
704 Ga0207711_10008307
705 Ga0207661_10011736
706 Ga0207661_10028936
707 Ga0207679_10015933
708 Ga0207679_10277045
709 Ga0207679_10587102
710 Ga0207679_10910123
711 Ga0207667_10029381
712 Ga0207667_10238197
713 Ga0207667_10319902
714 Ga0207667_10398574
715 Ga0207640_10001282
716 Ga0207640_10002216
717 Ga0207640_10113058
718 Ga0207640_10212600
719 Ga0207640_10364844
720 Ga0207639_10001539
721 Ga0207639_10023074
722 Ga0207639_10038968
723 Ga0207639_10060519
724 Ga0207678_10002336
725 Ga0207678_10016782
726 Ga0207678_10051448
727 Ga0207678_10136470
728 Ga0207678_10456058
729 Ga0207702_10009071
730 Ga0207702_10022689
731 Ga0207702_10025533
732 Ga0207702_10090579
733 Ga0207702_10114715
734 Ga0207702_10149324
735 Ga0207702_10744121
736 Ga0207702_11147019
737 Ga0207676_10051784
738 Ga0207674_10001151
739 Ga0207674_10005788
740 Ga0207674_10010596
741 Ga0207674_10044847
742 Ga0207674_10534832
743 Ga0207698_10000912
744 Ga0207698_10004967
745 Ga0207698_10011656
746 Ga0207698_10014443
747 Ga0207698_10137001
748 Ga0207698_10159994
749 Ga0207698_10242122
750 Ga0307408_100357473
751 Ga0307405_10348263
752 Ga0307413_10038458
753 Ga0307410_10057648
754 Ga0307406_10229825
755 Ga0307406_10538336
756 Ga0307407_10119791
757 Ga0307407_10199617
758 Ga0307407_10300278
759 Ga0307412_10710888
760 Ga0307409_100027602
761 Ga0307409_100253129
762 Ga0307409_100358095
763 Ga0307416_100358365
764 Ga0307416_101361402
765 Ga0307414_10021793
766 Ga0307414_10987675
767 Ga0307415_100084074
768 Ga0307415_100260578
769 Ga0395899_0005013
770 Ga0395899_0010954
771 Ga0395899_0023244
772 Ga0395899_0051702
773 Ga0395899_0062453
774 Ga0395899_0082978
775 Ga0395899_0086077
776 Ga0395899_0101001
777 Ga0395899_0296057
778 Ga0395899_0355054
779 Ga0395899_0365182
780 Ga0395900_0001734
781 Ga0395900_0019822
782 Ga0395900_0031503
783 Ga0395900_0043395
784 Ga0395900_0049551
785 Ga0395900_0056311
786 Ga0395900_0059241
787 Ga0395900_0061150
788 Ga0395900_0080210
789 Ga0395900_0103141
790 Ga0395900_0148768
791 Ga0395900_0171878
792 Ga0395900_0260435
793 Ga0395900_0352027
794 Ga0395900_0617153
795 Ga0395900_1548826
796 Ga0395898_0001129
797 Ga0395898_0004355
798 Ga0395898_0011006
799 Ga0395898_0013237
800 Ga0395898_0027612
801 Ga0395898_0033031
802 Ga0395898_0048385
803 Ga0395898_0087191
804 Ga0395898_0189923
805 Ga0395898_0214652
806 Ga0395898_0404388
807 Ga0395898_0485191
808 Ga0395898_0638090
809 Ga0395898_0686617
810 Ga0395905_0000109
811 Ga0395905_0035459
812 Ga0395905_0088207
813 Ga0395905_0119263
814 Ga0395905_0157292
815 Ga0395905_0168361
816 Ga0395905_0641650
817 Ga0395905_0662961
818 Ga0395901_0000140
819 Ga0395901_0000763
820 Ga0395901_0002327
821 Ga0395901_0022994
822 Ga0395901_0029574
823 Ga0395901_0067461
824 Ga0395901_0077874
825 Ga0395901_0250261
826 Ga0395901_0298487
827 Ga0395901_0412335
828 Ga0395901_0804864
829 Ga0466969_0014738
830 Ga0466966_0000939
831 Ga0466966_0017112
832 Ga0466963_0008859
833 Ga0466963_0036527
834 Ga0466963_0203120
835 Ga0466963_0214842
836 Ga0466963_0739993
837 Ga0466971_0001935
838 Ga0466971_0038164
839 Ga0466971_0085127
840 Ga0466970_0028135
841 Ga0466957_0000515
842 Ga0466957_0001777
843 Ga0466957_0033066
844 Ga0466957_0061617
845 Ga0466958_0023553
846 Ga0466958_0039109
847 Ga0466958_0105233
848 Ga0466958_0241364
849 Ga0466958_0287653
850 Ga0466958_0315315
851 Ga0466967_0007210
852 Ga0466967_0008683
853 Ga0466967_0035346
854 Ga0466967_0045677
855 Ga0466967_0079713
856 Ga0466967_0248670
857 Ga0466967_0430920
858 Ga0466967_0647603
859 Ga0466967_2336892
860 Ga0496100_0239845
861 Ga0496101_0110747
862 Ga0496102_0385389
863 Ga0496106_0260632
864 Ga0496107_0055558
865 Ga0496108_0094568
866 Ga0496109_0001322
867 Ga0496110_0068517
868 Ga0496112_0001301
869 Ga0496112_0007807
870 Ga0496113_0003389
871 Ga0496113_0241076
872 Ga0466962_0035202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vov-assembly1.cif.gz_H structure of ampa receptor-tarp complex 0.4174 65 152
5vot-assembly1.cif.gz_F structure of ampa receptor-tarp complex 0.4128 65 152
5weo-assembly1.cif.gz_C activated glua2 complex bound to glutamate, cyclothiazide, and stz in digitonin 0.4117 62 150
8p3x-assembly1.cif.gz_F homomeric glua2 flip r/g-edited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 0.4071 62 150
5weo-assembly1.cif.gz_D activated glua2 complex bound to glutamate, cyclothiazide, and stz in digitonin 0.4069 62 150
ID Description Score Start End Superfamily
af_P31468_1_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5713 19 138 1.10.1760.20
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.495 29 143 1.20.120.550
af_P31468_1_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4593 19 138 1.10.1760.20
af_Q69JG4_17_246_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4112 21 141 1.20.1250.20
af_Q2G226_6_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4038 16 158 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0Q9MEZ4-F1-model_v4 Histidine kinase 0.875 16 144 GO:0016020
AF-A0A4Z0C368-F1-model_v4 DUF1440 domain-containing protein 0.8722 1 152 GO:0016020
AF-A0A0B2AIK5-F1-model_v4 Membrane protein 0.868 15 146 GO:0016020
AF-A0A257TDG7-F1-model_v4 DUF1440 domain-containing protein 0.8621 14 144 GO:0016020
AF-A0A6L7U8Y0-F1-model_v4 DUF1440 domain-containing protein 0.8618 14 143 GO:0016020

Map