F443676

General Info

Members Datasets Scaffolds Average Seq Length
437 223 433 178

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10039211|JGI24735J21928_100392112
Length 179
Sequence MASTQIANAAEHLRHVFERHPGAGMHDDAPATARWTDGLHVAITHANGHQVATDMPAEFGGTGDGALPSPGWLFRAGMASCLATCIVINAARQGIELTTLQVSAHSRSDTRGVLGMPDTEGQPVQAQPFECRLAVRIAACDASAAVLRELVEASRRSSPIPQAAQNAMVVGLDIDVSEG

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2842733646 Variovorax sp. R-72446 Isolate Unclassified
4 2842747753 Variovorax sp. R-72060 Isolate Unclassified
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
170 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
174 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
218 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.46
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 3.2
Rhizosphere 83.3
Stem 0
Stem Tuber 0
Unclassified 8.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10039211 3300002067 Bacteria 1385
2 Ga0070658_10000258 3300005327 Bacteria 46593
3 Ga0070676_10001400 3300005328 Bacteria 12178
4 Ga0070683_100219268 3300005329 Bacteria 1808
5 Ga0070690_100007299 3300005330 Bacteria 6328
6 Ga0070670_100018036 3300005331 Bacteria 6058
7 Ga0070670_100341976 3300005331 Bacteria 1313
8 Ga0070670_100532585 3300005331 Bacteria 1047
9 Ga0070677_10016688 3300005333 Bacteria 2618
10 Ga0070677_10079911 3300005333 Bacteria 1396
11 Ga0068869_100007174 3300005334 Bacteria 7104
12 Ga0068869_100574370 3300005334 Bacteria 950
13 Ga0070666_10000001 3300005335 Bacteria 543080
14 Ga0070666_10017335 3300005335 Bacteria 4616
15 Ga0070666_10020541 3300005335 Bacteria 4270
16 Ga0070666_10178731 3300005335 Bacteria 1488
17 Ga0070680_100323054 3300005336 Bacteria 1310
18 Ga0068868_100215659 3300005338 Bacteria 1605
19 Ga0068868_100750723 3300005338 Bacteria 877
20 Ga0068868_100945699 3300005338 Unclassified 785
21 Ga0070660_100206034 3300005339 Bacteria 1596
22 Ga0070689_100639089 3300005340 Bacteria 925
23 Ga0070687_100005132 3300005343 Bacteria 5279
24 Ga0070661_100004763 3300005344 Bacteria 9339
25 Ga0070661_100115322 3300005344 Bacteria 2009
26 Ga0070661_100153337 3300005344 Bacteria 1742
27 Ga0070661_100279353 3300005344 Bacteria 1295
28 Ga0070661_100329033 3300005344 Bacteria 1195
29 Ga0070668_100027257 3300005347 Bacteria 4337
30 Ga0070668_100907620 3300005347 Bacteria 788
31 Ga0070669_100016407 3300005353 Bacteria 5284
32 Ga0070669_100016623 3300005353 Bacteria 5251
33 Ga0070669_100231218 3300005353 Bacteria 1466
34 Ga0070675_100112437 3300005354 Bacteria 2306
35 Ga0070675_100177581 3300005354 Bacteria 1839
36 Ga0070671_100000285 3300005355 Bacteria 34428
37 Ga0070671_100196987 3300005355 Bacteria 1708
38 Ga0070671_100207314 3300005355 Bacteria 1662
39 Ga0070671_100230719 3300005355 Bacteria 1571
40 Ga0070671_100270838 3300005355 Bacteria 1443
41 Ga0070671_100549346 3300005355 Bacteria 996
42 Ga0070674_100027283 3300005356 Bacteria 3741
43 Ga0070674_100068343 3300005356 Bacteria 2502
44 Ga0070674_100191399 3300005356 Bacteria 1574
45 Ga0070674_100312333 3300005356 Bacteria 1257
46 Ga0070674_100402600 3300005356 Bacteria 1118
47 Ga0070673_100035254 3300005364 Bacteria 3792
48 Ga0070673_100104238 3300005364 Bacteria 2341
49 Ga0070673_100208499 3300005364 Bacteria 1686
50 Ga0070673_100216874 3300005364 Bacteria 1654
51 Ga0070673_100270738 3300005364 Bacteria 1486
52 Ga0070673_100390816 3300005364 Bacteria 1242
53 Ga0070688_100347442 3300005365 Bacteria 1085
54 Ga0070659_100065261 3300005366 Bacteria 2883
55 Ga0070659_100152146 3300005366 Bacteria 1888
56 Ga0070659_100280534 3300005366 Bacteria 1386
57 Ga0070667_100006045 3300005367 Bacteria 10059
58 Ga0070667_100021498 3300005367 Bacteria 5355
59 Ga0070667_100025256 3300005367 Bacteria 4938
60 Ga0070667_100061271 3300005367 Bacteria 3185
61 Ga0070667_100863838 3300005367 Bacteria 841
62 Ga0070709_10827364 3300005434 Bacteria 728
63 Ga0070710_10623848 3300005437 Bacteria 753
64 Ga0070711_100197030 3300005439 Bacteria 1552
65 Ga0070663_100288276 3300005455 Bacteria 1310
66 Ga0070663_100481811 3300005455 Bacteria 1027
67 Ga0070678_100044029 3300005456 Bacteria 3184
68 Ga0070678_100068096 3300005456 Bacteria 2652
69 Ga0070678_100099139 3300005456 Bacteria 2254
70 Ga0070678_100211051 3300005456 Bacteria 1609
71 Ga0070678_100293303 3300005456 Bacteria 1380
72 Ga0070678_100336477 3300005456 Bacteria 1294
73 Ga0070662_100035727 3300005457 Bacteria 3511
74 Ga0070662_100364404 3300005457 Bacteria 1186
75 Ga0070681_10042640 3300005458 Bacteria 4546
76 Ga0070681_10994720 3300005458 Bacteria 758
77 Ga0068867_100007895 3300005459 Bacteria 7522
78 Ga0068867_100286032 3300005459 Bacteria 1354
79 Ga0068867_100458710 3300005459 Bacteria 1088
80 Ga0070679_100018771 3300005530 Bacteria 6714
81 Ga0070679_101049638 3300005530 Bacteria 759
82 Ga0068853_100083709 3300005539 Bacteria 2795
83 Ga0068853_100553796 3300005539 Bacteria 1090
84 Ga0068853_100969008 3300005539 Bacteria 818
85 Ga0068853_101011676 3300005539 Bacteria 800
86 Ga0070672_100013611 3300005543 Bacteria 5751
87 Ga0070672_100144261 3300005543 Bacteria 1966
88 Ga0070672_100203802 3300005543 Bacteria 1655
89 Ga0070672_100247596 3300005543 Bacteria 1500
90 Ga0070672_100852115 3300005543 Bacteria 803
91 Ga0070672_101502367 3300005543 Bacteria 603
92 Ga0070693_100264660 3300005547 Unclassified 1145
93 Ga0070693_100524888 3300005547 Bacteria 844
94 Ga0070665_100019476 3300005548 Bacteria 6811
95 Ga0070665_100030037 3300005548 Bacteria 5469
96 Ga0070665_100031567 3300005548 Bacteria 5332
97 Ga0070665_100070737 3300005548 Bacteria 3496
98 Ga0070665_100107278 3300005548 Bacteria 2795
99 Ga0070665_101266989 3300005548 Bacteria 747
100 Ga0068855_100128227 3300005563 Bacteria 2899
101 Ga0070664_100023554 3300005564 Bacteria 5086
102 Ga0070664_100120958 3300005564 Bacteria 2292
103 Ga0070664_100888078 3300005564 Bacteria 835
104 Ga0068857_100438261 3300005577 Bacteria 1220
105 Ga0068856_100549383 3300005614 Bacteria 1176
106 Ga0068852_100025497 3300005616 Bacteria 4791
107 Ga0068852_100126425 3300005616 Bacteria 2348
108 Ga0068852_100357524 3300005616 Bacteria 1428
109 Ga0068852_100424042 3300005616 Bacteria 1313
110 Ga0068852_100518926 3300005616 Bacteria 1188
111 Ga0068852_100890127 3300005616 Bacteria 907
112 Ga0068859_100048369 3300005617 Bacteria 4272
113 Ga0068864_100291560 3300005618 Bacteria 1525
114 Ga0068864_100451412 3300005618 Bacteria 1229
115 Ga0068864_101067178 3300005618 Bacteria 803
116 Ga0068866_10015110 3300005718 Bacteria 3425
117 Ga0068861_100001943 3300005719 Bacteria 13319
118 Ga0068851_10018655 3300005834 Bacteria 3344
119 Ga0068851_10074175 3300005834 Bacteria 1765
120 Ga0068870_10125091 3300005840 Bacteria 1486
121 Ga0068870_10310465 3300005840 Bacteria 998
122 Ga0068863_100008780 3300005841 Bacteria 9869
123 Ga0068863_100046661 3300005841 Bacteria 4112
124 Ga0068863_100437964 3300005841 Bacteria 1281
125 Ga0068863_100634772 3300005841 Bacteria 1058
126 Ga0068863_100764219 3300005841 Bacteria 963
127 Ga0068858_100001019 3300005842 Bacteria 28891
128 Ga0068858_100105362 3300005842 Bacteria 2631
129 Ga0068860_100000932 3300005843 Bacteria 32353
130 Ga0068860_100022760 3300005843 Bacteria 6060
131 Ga0068860_100160802 3300005843 Bacteria 2165
132 Ga0068860_101202663 3300005843 Bacteria 778
133 Ga0068862_100373066 3300005844 Bacteria 1329
134 Ga0075364_10607722 3300006051 Bacteria 747
135 Ga0070716_100170431 3300006173 Bacteria 1420
136 Ga0070712_101095858 3300006175 Bacteria 691
137 Ga0075367_10112402 3300006178 Bacteria 1673
138 Ga0075369_10190133 3300006186 Bacteria 946
139 Ga0075369_10218368 3300006186 Bacteria 882
140 Ga0075366_10703446 3300006195 Bacteria 627
141 Ga0097621_100637658 3300006237 Bacteria 977
142 Ga0097621_100962276 3300006237 Bacteria 797
143 Ga0075370_10111580 3300006353 Bacteria 1588
144 Ga0068871_100009304 3300006358 Bacteria 7110
145 Ga0068871_100472728 3300006358 Bacteria 1126
146 Ga0068871_101703576 3300006358 Bacteria 598
147 Ga0075434_100949654 3300006871 Bacteria 874
148 Ga0068865_100018809 3300006881 Bacteria 4464
149 Ga0068865_100852112 3300006881 Unclassified 790
150 Ga0097620_100048369 3300006931 Bacteria 4272
151 Ga0111539_10518307 3300009094 Bacteria 1389
152 Ga0105245_10353969 3300009098 Bacteria 1456
153 Ga0105243_10232348 3300009148 Bacteria 1637
154 Ga0105243_10746868 3300009148 Bacteria 959
155 Ga0105243_11319089 3300009148 Bacteria 739
156 Ga0105241_10067136 3300009174 Bacteria 2775
157 Ga0105241_10576362 3300009174 Bacteria 1014
158 Ga0105242_10262699 3300009176 Bacteria 1560
159 Ga0105248_10123629 3300009177 Bacteria 2919
160 Ga0105248_10143512 3300009177 Bacteria 2694
161 Ga0105248_10168980 3300009177 Bacteria 2465
162 Ga0105248_10351451 3300009177 Bacteria 1660
163 Ga0105248_11316160 3300009177 Unclassified 817
164 Ga0105238_10001010 3300009551 Bacteria 28718
165 Ga0105249_10035639 3300009553 Bacteria 4512
166 Ga0105249_10597095 3300009553 Bacteria 1158
167 Ga0105239_11008173 3300010375 Bacteria 957
168 Ga0105246_10670344 3300011119 Bacteria 905
169 Ga0157373_10014107 3300013100 Bacteria 5858
170 Ga0157370_10014887 3300013104 Bacteria 7936
171 Ga0157374_10243613 3300013296 Bacteria 1768
172 Ga0157374_10524676 3300013296 Bacteria 1190
173 Ga0157374_10532716 3300013296 Bacteria 1181
174 Ga0157374_10739386 3300013296 Bacteria 998
175 Ga0157378_10281230 3300013297 Bacteria 1604
176 Ga0163162_10001588 3300013306 Bacteria 21245
177 Ga0163162_10007006 3300013306 Bacteria 10935
178 Ga0157372_10113005 3300013307 Bacteria 3112
179 Ga0157375_10004636 3300013308 Bacteria 11946
180 Ga0157375_10006553 3300013308 Bacteria 10134
181 Ga0157375_10498849 3300013308 Bacteria 1381
182 Ga0157375_10675038 3300013308 Bacteria 1188
183 Ga0163163_10362747 3300014325 Bacteria 1505
184 Ga0163163_10433803 3300014325 Bacteria 1373
185 Ga0157380_10002941 3300014326 Bacteria 11583
186 Ga0157380_10269039 3300014326 Bacteria 1552
187 Ga0157380_10359897 3300014326 Bacteria 1365
188 Ga0157380_10416088 3300014326 Bacteria 1280
189 Ga0182008_10177303 3300014497 Bacteria 1077
190 Ga0157377_10788514 3300014745 Bacteria 699
191 Ga0157379_10012854 3300014968 Bacteria 7321
192 Ga0157379_10094340 3300014968 Bacteria 2685
193 Ga0157379_10607435 3300014968 Bacteria 1021
194 Ga0157376_10025467 3300014969 Bacteria 4660
195 Ga0157376_10082962 3300014969 Bacteria 2756
196 Ga0163161_10007488 3300017792 Bacteria 7545
197 Ga0163161_10395140 3300017792 Bacteria 1108
198 Ga0163161_10969402 3300017792 Bacteria 724
199 Ga0163161_11158292 3300017792 Unclassified 667
200 Ga0209257_1000046 3300025304 Bacteria 477765
201 Ga0207697_10099324 3300025315 Bacteria 1240
202 Ga0207656_10018688 3300025321 Bacteria 2731
203 Ga0207656_10043783 3300025321 Bacteria 1910
204 Ga0207656_10282131 3300025321 Bacteria 819
205 Ga0207682_10006258 3300025893 Bacteria 4807
206 Ga0207682_10026836 3300025893 Bacteria 2292
207 Ga0207682_10059828 3300025893 Bacteria 1592
208 Ga0207642_10014401 3300025899 Bacteria 2918
209 Ga0207688_10120804 3300025901 Bacteria 1529
210 Ga0207680_10000003 3300025903 Bacteria 925264
211 Ga0207680_10016768 3300025903 Bacteria 3854
212 Ga0207680_10037655 3300025903 Bacteria 2794
213 Ga0207680_10158204 3300025903 Bacteria 1517
214 Ga0207680_10832992 3300025903 Bacteria 661
215 Ga0207699_10450633 3300025906 Unclassified 923
216 Ga0207645_10001649 3300025907 Bacteria 18179
217 Ga0207643_10048849 3300025908 Bacteria 2397
218 Ga0207705_10018667 3300025909 Bacteria 4960
219 Ga0207705_10715711 3300025909 Unclassified 778
220 Ga0207654_10045232 3300025911 Bacteria 2504
221 Ga0207707_10064575 3300025912 Bacteria 3186
222 Ga0207693_10196570 3300025915 Bacteria 1586
223 Ga0207663_10066467 3300025916 Bacteria 2308
224 Ga0207660_10179454 3300025917 Bacteria 1644
225 Ga0207662_10009456 3300025918 Bacteria 5365
226 Ga0207649_10005585 3300025920 Bacteria 6803
227 Ga0207649_10035005 3300025920 Bacteria 3014
228 Ga0207652_10109568 3300025921 Bacteria 2448
229 Ga0207681_10000549 3300025923 Bacteria 25898
230 Ga0207681_10024438 3300025923 Bacteria 3878
231 Ga0207681_10066168 3300025923 Bacteria 2501
232 Ga0207681_10213844 3300025923 Bacteria 1488
233 Ga0207694_10000469 3300025924 Bacteria 36896
234 Ga0207650_10014959 3300025925 Bacteria 5398
235 Ga0207650_10228195 3300025925 Bacteria 1501
236 Ga0207650_10344262 3300025925 Bacteria 1225
237 Ga0207650_10483683 3300025925 Bacteria 1033
238 Ga0207659_10041467 3300025926 Bacteria 3224
239 Ga0207659_10145175 3300025926 Bacteria 1847
240 Ga0207687_10159948 3300025927 Bacteria 1727
241 Ga0207644_10000317 3300025931 Bacteria 31456
242 Ga0207644_10181513 3300025931 Bacteria 1650
243 Ga0207644_10229520 3300025931 Bacteria 1474
244 Ga0207644_10572360 3300025931 Bacteria 936
245 Ga0207690_10018529 3300025932 Bacteria 4270
246 Ga0207690_10056064 3300025932 Bacteria 2657
247 Ga0207706_10012035 3300025933 Bacteria 7883
248 Ga0207706_10384782 3300025933 Bacteria 1217
249 Ga0207706_10395808 3300025933 Bacteria 1198
250 Ga0207686_10008228 3300025934 Bacteria 5628
251 Ga0207686_10125571 3300025934 Bacteria 1753
252 Ga0207709_10009424 3300025935 Bacteria 5372
253 Ga0207709_10473713 3300025935 Bacteria 972
254 Ga0207709_10993571 3300025935 Bacteria 686
255 Ga0207670_11001262 3300025936 Bacteria 703
256 Ga0207669_10049484 3300025937 Bacteria 2505
257 Ga0207669_10110935 3300025937 Bacteria 1838
258 Ga0207669_10221646 3300025937 Bacteria 1388
259 Ga0207669_10341048 3300025937 Bacteria 1154
260 Ga0207669_10349570 3300025937 Bacteria 1141
261 Ga0207704_10009943 3300025938 Bacteria 4615
262 Ga0207704_10205455 3300025938 Bacteria 1445
263 Ga0207691_10042207 3300025940 Bacteria 4205
264 Ga0207691_10403837 3300025940 Bacteria 1165
265 Ga0207691_10434599 3300025940 Bacteria 1118
266 Ga0207691_10750668 3300025940 Bacteria 822
267 Ga0207711_10011417 3300025941 Bacteria 7384
268 Ga0207711_10016161 3300025941 Bacteria 6195
269 Ga0207711_10306905 3300025941 Bacteria 1465
270 Ga0207711_10611807 3300025941 Bacteria 1017
271 Ga0207711_10871841 3300025941 Bacteria 837
272 Ga0207689_10002306 3300025942 Bacteria 17864
273 Ga0207689_10455376 3300025942 Bacteria 1070
274 Ga0207667_10087907 3300025949 Bacteria 3215
275 Ga0207651_10005443 3300025960 Bacteria 6535
276 Ga0207651_10213428 3300025960 Bacteria 1555
277 Ga0207651_10234661 3300025960 Bacteria 1491
278 Ga0207651_10826156 3300025960 Bacteria 822
279 Ga0207651_10858174 3300025960 Unclassified 807
280 Ga0207651_10911141 3300025960 Bacteria 783
281 Ga0207712_10020366 3300025961 Bacteria 4343
282 Ga0207712_10334891 3300025961 Bacteria 1253
283 Ga0207668_10015991 3300025972 Bacteria 4673
284 Ga0207668_10765997 3300025972 Unclassified 852
285 Ga0207640_10208027 3300025981 Bacteria 1488
286 Ga0207640_10512907 3300025981 Bacteria 1001
287 Ga0207658_10000522 3300025986 Bacteria 35086
288 Ga0207658_10020408 3300025986 Bacteria 4589
289 Ga0207658_10441438 3300025986 Bacteria 1151
290 Ga0207677_10339204 3300026023 Bacteria 1255
291 Ga0207703_10000176 3300026035 Bacteria 74238
292 Ga0207703_10171066 3300026035 Bacteria 1911
293 Ga0207639_10779486 3300026041 Bacteria 890
294 Ga0207678_10020746 3300026067 Bacteria 5759
295 Ga0207678_11353618 3300026067 Unclassified 630
296 Ga0207641_10004775 3300026088 Bacteria 11689
297 Ga0207641_10072443 3300026088 Bacteria 2967
298 Ga0207641_10312054 3300026088 Bacteria 1489
299 Ga0207641_10495877 3300026088 Bacteria 1185
300 Ga0207641_10785337 3300026088 Bacteria 941
301 Ga0207648_10031627 3300026089 Bacteria 4678
302 Ga0207648_10323233 3300026089 Unclassified 1387
303 Ga0207648_10429004 3300026089 Bacteria 1201
304 Ga0207648_10801062 3300026089 Bacteria 877
305 Ga0207676_10026840 3300026095 Bacteria 4284
306 Ga0207676_10624987 3300026095 Bacteria 1037
307 Ga0207674_10165424 3300026116 Bacteria 2166
308 Ga0207675_100016813 3300026118 Bacteria 6834
309 Ga0207683_10001689 3300026121 Bacteria 19754
310 Ga0207683_10035625 3300026121 Bacteria 4329
311 Ga0207683_10075634 3300026121 Bacteria 2981
312 Ga0207683_10098464 3300026121 Bacteria 2609
313 Ga0207683_10145547 3300026121 Bacteria 2137
314 Ga0207683_10243479 3300026121 Bacteria 1641
315 Ga0207698_10008637 3300026142 Bacteria 6453
316 Ga0207698_10523110 3300026142 Bacteria 1158
317 Ga0207698_10551969 3300026142 Bacteria 1129
318 Ga0207698_10859462 3300026142 Bacteria 913
319 Ga0268266_10000011 3300028379 Bacteria 757403
320 Ga0268266_10027160 3300028379 Bacteria 4869
321 Ga0268266_10164625 3300028379 Bacteria 2008
322 Ga0268264_10000951 3300028381 Bacteria 29911
323 Ga0268264_10019693 3300028381 Bacteria 5513
324 Ga0268264_10408821 3300028381 Bacteria 1306
325 Ga0307515_10003606 3300028794 Bacteria 32510
326 Ga0307515_10005576 3300028794 Bacteria 25454
327 Ga0307515_10033717 3300028794 Bacteria 8414
328 Ga0307512_10087715 3300030522 Bacteria 2189
329 Ga0265763_1002732 3300030763 Bacteria 1365
330 Ga0265770_1012811 3300030878 Bacteria 1246
331 Ga0265327_10000267 3300031251 Bacteria 103094
332 Ga0307513_10013890 3300031456 Bacteria 9867
333 Ga0307513_10058561 3300031456 Bacteria 4093
334 Ga0307513_10418856 3300031456 Bacteria 1070
335 Ga0307509_10032771 3300031507 Bacteria 5724
336 Ga0307509_10173469 3300031507 Bacteria 2032
337 Ga0307509_10554061 3300031507 Bacteria 827
338 Ga0307508_10000142 3300031616 Bacteria 85288
339 Ga0307508_10033738 3300031616 Bacteria 4619
340 Ga0307516_10008998 3300031730 Bacteria 11187
341 Ga0307516_10014615 3300031730 Bacteria 8298
342 Ga0307405_11419666 3300031731 Unclassified 607
343 Ga0307507_10306566 3300033179 Bacteria 968
344 Ga0307510_10014730 3300033180 Bacteria 9252
345 Ga0307510_10108124 3300033180 Bacteria 2536
346 Ga0373923_0088165 3300035111 Bacteria 1354
347 Ga0373956_0103527 3300035119 Bacteria 1322
348 Ga0373957_0032089 3300035120 Bacteria 1933
349 Ga0373957_0044807 3300035120 Bacteria 1675
350 Ga0373943_0016860 3300035170 Bacteria 3338
351 Ga0373946_0429817 3300035171 Unclassified 670
352 Ga0373924_0017407 3300035410 Bacteria 2757
353 Ga0373937_0032278 3300036401 Bacteria 4749
354 Ga0373937_0256567 3300036401 Bacteria 1648
355 Ga0373925_0074878 3300037068 Bacteria 2565
356 Ga0373925_0076419 3300037068 Bacteria 2539
357 Ga0436365_1683483 3300039437 Bacteria 986
358 Ga0451789_0940944 3300041443 Bacteria 1504
359 Ga0451791_0291145 3300041451 Bacteria 746
360 Ga0451791_1632641 3300041451 Bacteria 2073
361 Ga0451793_1188857 3300041452 Bacteria 876
362 Ga0451800_0442614 3300041459 Bacteria 1476
363 Ga0451807_0724946 3300041486 Bacteria 572
364 Ga0451839_0190781 3300041496 Bacteria 1261
365 Ga0451841_0910525 3300041498 Bacteria 1707
366 Ga0451849_0881121 3300041505 Bacteria 722
367 Ga0451843_0388019 3300041509 Bacteria 1520
368 Ga0451843_0693181 3300041509 Unclassified 1040
369 Ga0451843_1580135 3300041509 Bacteria 983
370 Ga0451853_0576393 3300041512 Bacteria 918
371 Ga0451853_2490713 3300041512 Bacteria 1190
372 Ga0451853_2546863 3300041512 Bacteria 714
373 Ga0439449_0046127 3300042007 Unclassified 1614
374 Ga0451576_0051826 3300045051 Bacteria 4301
375 Ga0451576_0672347 3300045051 Bacteria 1088
376 Ga0495629_0110232 3300046459 Bacteria 1919
377 Ga0495629_0171948 3300046459 Bacteria 1503
378 Ga0495650_0000222 3300046471 Bacteria 118200
379 Ga0495650_0027263 3300046471 Bacteria 2643
380 Ga0495606_0057674 3300046507 Bacteria 2500
381 Ga0495632_0113526 3300046519 Bacteria 1270
382 Ga0495598_0008475 3300046537 Bacteria 2397
383 Ga0495621_0014337 3300046539 Bacteria 2506
384 Ga0495621_0167944 3300046539 Bacteria 871
385 Ga0495656_0216456 3300046615 Bacteria 956
386 Ga0495625_0031657 3300046660 Bacteria 3931
387 Ga0495625_0116762 3300046660 Bacteria 1820
388 Ga0495647_0045321 3300046681 Bacteria 1689
389 Ga0495647_0370210 3300046681 Bacteria 655
390 Ga0495658_0007763 3300046683 Bacteria 5311
391 Ga0495658_0078496 3300046683 Bacteria 1933
392 Ga0495658_0188855 3300046683 Bacteria 1280
393 Ga0496102_0008802 3300048905 Bacteria 8659
394 Ga0496105_0109802 3300048908 Bacteria 2277
395 Ga0496106_0008247 3300048909 Bacteria 7702
396 Ga0496108_0319824 3300048911 Bacteria 1353
397 Ga0496109_0891436 3300048912 Bacteria 827
398 Ga0496110_1280348 3300048913 Bacteria 642
399 Ga0496112_0379389 3300048915 Bacteria 1355
400 Ga0496114_0015985 3300048917 Bacteria 6039
401 Ga0496121_0214223 3300048924 Bacteria 1362
402 Ga0496122_0000324 3300048925 Bacteria 104220
403 Ga0496123_0000160 3300048926 Bacteria 135310
404 Ga0496124_0020885 3300048927 Bacteria 6041
405 Ga0496126_0046169 3300048929 Bacteria 3998
406 Ga0496126_0305872 3300048929 Bacteria 1310
407 Ga0501034_0059094 3300049571 Bacteria 3852
408 Ga0501034_0139234 3300049571 Bacteria 2407
409 Ga0501047_0177067 3300049581 Bacteria 2000
410 Ga0501067_0084256 3300049583 Bacteria 1763
411 Ga0501073_0046361 3300049589 Bacteria 3057
412 Ga0501074_0377328 3300049590 Bacteria 1006
413 Ga0501080_0031013 3300049742 Bacteria 4981
414 Ga0501083_0163326 3300049744 Bacteria 1456
415 nmdc:mga0k408_201177_c1 3300050493 Bacteria 1189
416 nmdc:mga0k408_287799_c1 3300050493 Bacteria 981
417 nmdc:mga0k408_42194_c1 3300050493 Bacteria 2627
418 nmdc:mga0sz30_466679_c1 3300050516 Bacteria 567
419 Ga0495601_0319911 3300053077 Bacteria 1010
420 Ga0495601_0511835 3300053077 Bacteria 774
421 Ga0500578_0064542 3300053086 Bacteria 2335
422 Ga0500578_0316597 3300053086 Unclassified 921
423 Ga0500646_0081475 3300053090 Bacteria 988
424 Ga0500651_0294197 3300053093 Bacteria 933
425 Ga0500594_0028482 3300053118 Bacteria 1454
426 Ga0500607_109246 3300053121 Bacteria 1359
427 Ga0500652_017265 3300053131 Bacteria 2643
428 Ga0500658_0025366 3300053134 Bacteria 2278
429 Ga0500559_0003344 3300053136 Bacteria 7937
430 Ga0500645_002844 3300053730 Bacteria 7448
431 Ga0500587_006227 3300053739 Bacteria 1588
432 Ga0500587_017434 3300053739 Bacteria 921
433 Ga0501082_0222515 3300060353 Bacteria 1642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585428062 2587759052 171
2 iso_pu_bacteria 2842747753 2842752645 171
3 iso_pu_bacteria 2842733646 2842737518 172
4 iso_pu_bacteria 2643221654 2644305102 173
5 3300005548 Ga0070665_100070737 Ga0070665_1000707375 174
6 3300028379 Ga0268266_10164625 Ga0268266_101646253 174
7 3300031251 Ga0265327_10000267 Ga0265327_1000026787 174
8 3300005344 Ga0070661_100279353 Ga0070661_1002793532 175
9 3300005353 Ga0070669_100016623 Ga0070669_1000166236 175
10 3300005355 Ga0070671_100230719 Ga0070671_1002307192 175
11 3300005356 Ga0070674_100191399 Ga0070674_1001913992 175
12 3300005366 Ga0070659_100065261 Ga0070659_1000652613 175
13 3300005434 Ga0070709_10827364 Ga0070709_108273641 175
14 3300005437 Ga0070710_10623848 Ga0070710_106238481 175
15 3300005439 Ga0070711_100197030 Ga0070711_1001970301 175
16 3300005456 Ga0070678_100044029 Ga0070678_1000440292 175
17 3300005458 Ga0070681_10994720 Ga0070681_109947201 175
18 3300005539 Ga0068853_100969008 Ga0068853_1009690081 175
19 3300005539 Ga0068853_101011676 Ga0068853_1010116761 175
20 3300005548 Ga0070665_100031567 Ga0070665_1000315675 175
21 3300005548 Ga0070665_100107278 Ga0070665_1001072783 175
22 3300005563 Ga0068855_100128227 Ga0068855_1001282272 175
23 3300005564 Ga0070664_100888078 Ga0070664_1008880781 175
24 3300006051 Ga0075364_10607722 Ga0075364_106077221 175
25 3300006173 Ga0070716_100170431 Ga0070716_1001704312 175
26 3300006175 Ga0070712_101095858 Ga0070712_1010958582 175
27 3300006178 Ga0075367_10112402 Ga0075367_101124023 175
28 3300006186 Ga0075369_10190133 Ga0075369_101901332 175
29 3300006186 Ga0075369_10218368 Ga0075369_102183682 175
30 3300006195 Ga0075366_10703446 Ga0075366_107034461 175
31 3300006237 Ga0097621_100962276 Ga0097621_1009622761 175
32 3300006353 Ga0075370_10111580 Ga0075370_101115803 175
33 3300006358 Ga0068871_101703576 Ga0068871_1017035761 175
34 3300009177 Ga0105248_10351451 Ga0105248_103514512 175
35 3300010375 Ga0105239_11008173 Ga0105239_110081732 175
36 3300013296 Ga0157374_10243613 Ga0157374_102436132 175
37 3300014326 Ga0157380_10269039 Ga0157380_102690392 175
38 3300014497 Ga0182008_10177303 Ga0182008_101773032 175
39 3300017792 Ga0163161_10395140 Ga0163161_103951402 175
40 3300025321 Ga0207656_10282131 Ga0207656_102821311 175
41 3300025915 Ga0207693_10196570 Ga0207693_101965701 175
42 3300025916 Ga0207663_10066467 Ga0207663_100664672 175
43 3300025923 Ga0207681_10024438 Ga0207681_100244386 175
44 3300025931 Ga0207644_10181513 Ga0207644_101815132 175
45 3300025932 Ga0207690_10018529 Ga0207690_100185294 175
46 3300025937 Ga0207669_10110935 Ga0207669_101109353 175
47 3300025941 Ga0207711_10611807 Ga0207711_106118072 175
48 3300025949 Ga0207667_10087907 Ga0207667_100879074 175
49 3300026121 Ga0207683_10098464 Ga0207683_100984642 175
50 3300028379 Ga0268266_10027160 Ga0268266_100271604 175
51 3300028794 Ga0307515_10003606 Ga0307515_1000360612 175
52 3300028794 Ga0307515_10005576 Ga0307515_1000557624 175
53 3300028794 Ga0307515_10033717 Ga0307515_100337173 175
54 3300031456 Ga0307513_10013890 Ga0307513_100138905 175
55 3300031456 Ga0307513_10058561 Ga0307513_100585612 175
56 3300031616 Ga0307508_10000142 Ga0307508_1000014245 175
57 3300031730 Ga0307516_10008998 Ga0307516_100089986 175
58 3300031731 Ga0307405_11419666 Ga0307405_114196661 175
59 3300035119 Ga0373956_0103527 Ga0373956_0103527_236_826 175
60 3300035120 Ga0373957_0032089 Ga0373957_0032089_216_743 175
61 3300036401 Ga0373937_0032278 Ga0373937_0032278_1233_1823 175
62 3300037068 Ga0373925_0074878 Ga0373925_0074878_673_1200 175
63 3300041451 Ga0451791_0291145 Ga0451791_0291145_92_619 175
64 3300041452 Ga0451793_1188857 Ga0451793_1188857_45_572 175
65 3300041459 Ga0451800_0442614 Ga0451800_0442614_802_1329 175
66 3300041496 Ga0451839_0190781 Ga0451839_0190781_407_934 175
67 3300041498 Ga0451841_0910525 Ga0451841_0910525_614_1141 175
68 3300041509 Ga0451843_0388019 Ga0451843_0388019_233_760 175
69 3300041512 Ga0451853_0576393 Ga0451853_0576393_315_842 175
70 3300041512 Ga0451853_2490713 Ga0451853_2490713_44_571 175
71 3300041512 Ga0451853_2546863 Ga0451853_2546863_82_609 175
72 3300046459 Ga0495629_0171948 Ga0495629_0171948_47_637 175
73 3300046471 Ga0495650_0027263 Ga0495650_0027263_1713_2240 175
74 3300046519 Ga0495632_0113526 Ga0495632_0113526_477_1004 175
75 3300046660 Ga0495625_0031657 Ga0495625_0031657_2211_2738 175
76 3300046660 Ga0495625_0116762 Ga0495625_0116762_926_1453 175
77 3300046683 Ga0495658_0078496 Ga0495658_0078496_659_1249 175
78 3300048909 Ga0496106_0008247 Ga0496106_0008247_4716_5243 175
79 3300048925 Ga0496122_0000324 Ga0496122_0000324_17149_17676 175
80 3300048926 Ga0496123_0000160 Ga0496123_0000160_124478_125005 175
81 3300048927 Ga0496124_0020885 Ga0496124_0020885_857_1384 175
82 3300048929 Ga0496126_0305872 Ga0496126_0305872_445_972 175
83 3300050493 nmdc:mga0k408_201177_c1 nmdc:mga0k408_201177_c1_252_779 175
84 3300050493 nmdc:mga0k408_287799_c1 nmdc:mga0k408_287799_c1_70_597 175
85 3300050516 nmdc:mga0sz30_466679_c1 nmdc:mga0sz30_466679_c1_20_547 175
86 3300053077 Ga0495601_0511835 Ga0495601_0511835_234_761 175
87 3300053086 Ga0500578_0064542 Ga0500578_0064542_350_877 175
88 3300053090 Ga0500646_0081475 Ga0500646_0081475_119_646 175
89 3300053093 Ga0500651_0294197 Ga0500651_0294197_276_803 175
90 3300053118 Ga0500594_0028482 Ga0500594_0028482_519_1046 175
91 3300053134 Ga0500658_0025366 Ga0500658_0025366_1265_1792 175
92 3300053136 Ga0500559_0003344 Ga0500559_0003344_6904_7431 175
93 3300053730 Ga0500645_002844 Ga0500645_002844_5800_6327 175
94 3300053739 Ga0500587_006227 Ga0500587_006227_571_1098 175
95 3300053739 Ga0500587_017434 Ga0500587_017434_306_833 175
96 3300005328 Ga0070676_10001400 Ga0070676_100014008 176
97 3300005329 Ga0070683_100219268 Ga0070683_1002192683 176
98 3300005330 Ga0070690_100007299 Ga0070690_1000072994 176
99 3300005331 Ga0070670_100018036 Ga0070670_1000180363 176
100 3300005331 Ga0070670_100341976 Ga0070670_1003419762 176
101 3300005331 Ga0070670_100532585 Ga0070670_1005325852 176
102 3300005333 Ga0070677_10079911 Ga0070677_100799112 176
103 3300005334 Ga0068869_100007174 Ga0068869_1000071744 176
104 3300005334 Ga0068869_100574370 Ga0068869_1005743702 176
105 3300005335 Ga0070666_10017335 Ga0070666_100173354 176
106 3300005335 Ga0070666_10020541 Ga0070666_100205414 176
107 3300005335 Ga0070666_10178731 Ga0070666_101787311 176
108 3300005338 Ga0068868_100215659 Ga0068868_1002156592 176
109 3300005338 Ga0068868_100750723 Ga0068868_1007507232 176
110 3300005338 Ga0068868_100945699 Ga0068868_1009456991 176
111 3300005340 Ga0070689_100639089 Ga0070689_1006390891 176
112 3300005343 Ga0070687_100005132 Ga0070687_1000051325 176
113 3300005344 Ga0070661_100153337 Ga0070661_1001533372 176
114 3300005344 Ga0070661_100329033 Ga0070661_1003290331 176
115 3300005347 Ga0070668_100027257 Ga0070668_1000272572 176
116 3300005353 Ga0070669_100016407 Ga0070669_1000164072 176
117 3300005354 Ga0070675_100177581 Ga0070675_1001775811 176
118 3300005355 Ga0070671_100000285 Ga0070671_10000028514 176
119 3300005355 Ga0070671_100196987 Ga0070671_1001969872 176
120 3300005355 Ga0070671_100207314 Ga0070671_1002073142 176
121 3300005355 Ga0070671_100270838 Ga0070671_1002708382 176
122 3300005356 Ga0070674_100027283 Ga0070674_1000272833 176
123 3300005356 Ga0070674_100068343 Ga0070674_1000683433 176
124 3300005356 Ga0070674_100312333 Ga0070674_1003123331 176
125 3300005356 Ga0070674_100402600 Ga0070674_1004026002 176
126 3300005364 Ga0070673_100035254 Ga0070673_1000352545 176
127 3300005364 Ga0070673_100104238 Ga0070673_1001042382 176
128 3300005364 Ga0070673_100208499 Ga0070673_1002084992 176
129 3300005364 Ga0070673_100216874 Ga0070673_1002168741 176
130 3300005364 Ga0070673_100270738 Ga0070673_1002707382 176
131 3300005365 Ga0070688_100347442 Ga0070688_1003474422 176
132 3300005366 Ga0070659_100152146 Ga0070659_1001521462 176
133 3300005366 Ga0070659_100280534 Ga0070659_1002805342 176
134 3300005367 Ga0070667_100006045 Ga0070667_1000060459 176
135 3300005367 Ga0070667_100021498 Ga0070667_1000214982 176
136 3300005367 Ga0070667_100025256 Ga0070667_1000252565 176
137 3300005455 Ga0070663_100288276 Ga0070663_1002882762 176
138 3300005455 Ga0070663_100481811 Ga0070663_1004818111 176
139 3300005456 Ga0070678_100068096 Ga0070678_1000680963 176
140 3300005456 Ga0070678_100211051 Ga0070678_1002110512 176
141 3300005456 Ga0070678_100336477 Ga0070678_1003364772 176
142 3300005457 Ga0070662_100035727 Ga0070662_1000357272 176
143 3300005457 Ga0070662_100364404 Ga0070662_1003644042 176
144 3300005459 Ga0068867_100007895 Ga0068867_1000078954 176
145 3300005459 Ga0068867_100286032 Ga0068867_1002860322 176
146 3300005459 Ga0068867_100458710 Ga0068867_1004587102 176
147 3300005530 Ga0070679_101049638 Ga0070679_1010496381 176
148 3300005539 Ga0068853_100553796 Ga0068853_1005537962 176
149 3300005543 Ga0070672_100013611 Ga0070672_1000136112 176
150 3300005543 Ga0070672_100144261 Ga0070672_1001442612 176
151 3300005543 Ga0070672_100203802 Ga0070672_1002038022 176
152 3300005543 Ga0070672_100247596 Ga0070672_1002475962 176
153 3300005543 Ga0070672_100852115 Ga0070672_1008521152 176
154 3300005543 Ga0070672_101502367 Ga0070672_1015023671 176
155 3300005547 Ga0070693_100524888 Ga0070693_1005248881 176
156 3300005548 Ga0070665_100019476 Ga0070665_1000194765 176
157 3300005548 Ga0070665_101266989 Ga0070665_1012669891 176
158 3300005564 Ga0070664_100023554 Ga0070664_1000235543 176
159 3300005564 Ga0070664_100120958 Ga0070664_1001209582 176
160 3300005616 Ga0068852_100025497 Ga0068852_1000254972 176
161 3300005616 Ga0068852_100126425 Ga0068852_1001264253 176
162 3300005616 Ga0068852_100357524 Ga0068852_1003575242 176
163 3300005616 Ga0068852_100424042 Ga0068852_1004240422 176
164 3300005616 Ga0068852_100518926 Ga0068852_1005189262 176
165 3300005617 Ga0068859_100048369 Ga0068859_1000483692 176
166 3300005618 Ga0068864_100291560 Ga0068864_1002915602 176
167 3300005618 Ga0068864_100451412 Ga0068864_1004514122 176
168 3300005618 Ga0068864_101067178 Ga0068864_1010671782 176
169 3300005718 Ga0068866_10015110 Ga0068866_100151103 176
170 3300005719 Ga0068861_100001943 Ga0068861_10000194311 176
171 3300005834 Ga0068851_10018655 Ga0068851_100186553 176
172 3300005834 Ga0068851_10074175 Ga0068851_100741751 176
173 3300005840 Ga0068870_10310465 Ga0068870_103104652 176
174 3300005841 Ga0068863_100008780 Ga0068863_1000087804 176
175 3300005841 Ga0068863_100046661 Ga0068863_1000466614 176
176 3300005841 Ga0068863_100437964 Ga0068863_1004379642 176
177 3300005841 Ga0068863_100634772 Ga0068863_1006347722 176
178 3300005841 Ga0068863_100764219 Ga0068863_1007642191 176
179 3300005842 Ga0068858_100001019 Ga0068858_10000101911 176
180 3300005843 Ga0068860_100000932 Ga0068860_10000093220 176
181 3300005843 Ga0068860_100160802 Ga0068860_1001608023 176
182 3300006237 Ga0097621_100637658 Ga0097621_1006376581 176
183 3300006358 Ga0068871_100009304 Ga0068871_1000093043 176
184 3300006358 Ga0068871_100472728 Ga0068871_1004727282 176
185 3300006881 Ga0068865_100018809 Ga0068865_1000188091 176
186 3300006881 Ga0068865_100852112 Ga0068865_1008521121 176
187 3300006931 Ga0097620_100048369 Ga0097620_1000483694 176
188 3300009094 Ga0111539_10518307 Ga0111539_105183071 176
189 3300009098 Ga0105245_10353969 Ga0105245_103539691 176
190 3300009148 Ga0105243_10232348 Ga0105243_102323482 176
191 3300009148 Ga0105243_10746868 Ga0105243_107468681 176
192 3300009174 Ga0105241_10067136 Ga0105241_100671363 176
193 3300009176 Ga0105242_10262699 Ga0105242_102626992 176
194 3300009177 Ga0105248_10123629 Ga0105248_101236292 176
195 3300009177 Ga0105248_10143512 Ga0105248_101435123 176
196 3300009177 Ga0105248_10168980 Ga0105248_101689803 176
197 3300009553 Ga0105249_10035639 Ga0105249_100356393 176
198 3300011119 Ga0105246_10670344 Ga0105246_106703441 176
199 3300013296 Ga0157374_10524676 Ga0157374_105246762 176
200 3300013296 Ga0157374_10532716 Ga0157374_105327162 176
201 3300013296 Ga0157374_10739386 Ga0157374_107393862 176
202 3300013297 Ga0157378_10281230 Ga0157378_102812302 176
203 3300013306 Ga0163162_10007006 Ga0163162_100070065 176
204 3300013308 Ga0157375_10004636 Ga0157375_100046369 176
205 3300013308 Ga0157375_10006553 Ga0157375_100065532 176
206 3300013308 Ga0157375_10498849 Ga0157375_104988492 176
207 3300013308 Ga0157375_10675038 Ga0157375_106750382 176
208 3300014325 Ga0163163_10362747 Ga0163163_103627472 176
209 3300014325 Ga0163163_10433803 Ga0163163_104338032 176
210 3300014326 Ga0157380_10002941 Ga0157380_100029414 176
211 3300014326 Ga0157380_10359897 Ga0157380_103598972 176
212 3300014745 Ga0157377_10788514 Ga0157377_107885141 176
213 3300014968 Ga0157379_10012854 Ga0157379_100128544 176
214 3300014968 Ga0157379_10094340 Ga0157379_100943401 176
215 3300014968 Ga0157379_10607435 Ga0157379_106074352 176
216 3300014969 Ga0157376_10025467 Ga0157376_100254675 176
217 3300014969 Ga0157376_10082962 Ga0157376_100829622 176
218 3300017792 Ga0163161_10007488 Ga0163161_100074884 176
219 3300017792 Ga0163161_11158292 Ga0163161_111582921 176
220 3300025304 Ga0209257_1000046 Ga0209257_100004661 176
221 3300025315 Ga0207697_10099324 Ga0207697_100993242 176
222 3300025321 Ga0207656_10018688 Ga0207656_100186882 176
223 3300025321 Ga0207656_10043783 Ga0207656_100437832 176
224 3300025893 Ga0207682_10026836 Ga0207682_100268363 176
225 3300025893 Ga0207682_10059828 Ga0207682_100598282 176
226 3300025899 Ga0207642_10014401 Ga0207642_100144012 176
227 3300025901 Ga0207688_10120804 Ga0207688_101208042 176
228 3300025903 Ga0207680_10016768 Ga0207680_100167683 176
229 3300025903 Ga0207680_10037655 Ga0207680_100376553 176
230 3300025903 Ga0207680_10158204 Ga0207680_101582042 176
231 3300025903 Ga0207680_10832992 Ga0207680_108329921 176
232 3300025906 Ga0207699_10450633 Ga0207699_104506332 176
233 3300025907 Ga0207645_10001649 Ga0207645_1000164910 176
234 3300025908 Ga0207643_10048849 Ga0207643_100488492 176
235 3300025909 Ga0207705_10715711 Ga0207705_107157111 176
236 3300025918 Ga0207662_10009456 Ga0207662_100094565 176
237 3300025923 Ga0207681_10000549 Ga0207681_1000054918 176
238 3300025923 Ga0207681_10213844 Ga0207681_102138442 176
239 3300025925 Ga0207650_10014959 Ga0207650_100149592 176
240 3300025925 Ga0207650_10228195 Ga0207650_102281952 176
241 3300025925 Ga0207650_10483683 Ga0207650_104836832 176
242 3300025926 Ga0207659_10145175 Ga0207659_101451752 176
243 3300025927 Ga0207687_10159948 Ga0207687_101599482 176
244 3300025931 Ga0207644_10000317 Ga0207644_1000031714 176
245 3300025931 Ga0207644_10229520 Ga0207644_102295202 176
246 3300025931 Ga0207644_10572360 Ga0207644_105723601 176
247 3300025932 Ga0207690_10056064 Ga0207690_100560642 176
248 3300025933 Ga0207706_10012035 Ga0207706_100120357 176
249 3300025933 Ga0207706_10384782 Ga0207706_103847822 176
250 3300025934 Ga0207686_10008228 Ga0207686_100082282 176
251 3300025934 Ga0207686_10125571 Ga0207686_101255712 176
252 3300025935 Ga0207709_10009424 Ga0207709_100094243 176
253 3300025935 Ga0207709_10993571 Ga0207709_109935711 176
254 3300025936 Ga0207670_11001262 Ga0207670_110012622 176
255 3300025937 Ga0207669_10049484 Ga0207669_100494842 176
256 3300025937 Ga0207669_10221646 Ga0207669_102216462 176
257 3300025937 Ga0207669_10341048 Ga0207669_103410482 176
258 3300025937 Ga0207669_10349570 Ga0207669_103495702 176
259 3300025938 Ga0207704_10009943 Ga0207704_100099432 176
260 3300025940 Ga0207691_10042207 Ga0207691_100422072 176
261 3300025940 Ga0207691_10403837 Ga0207691_104038372 176
262 3300025940 Ga0207691_10434599 Ga0207691_104345992 176
263 3300025940 Ga0207691_10750668 Ga0207691_107506682 176
264 3300025941 Ga0207711_10011417 Ga0207711_100114175 176
265 3300025941 Ga0207711_10016161 Ga0207711_100161617 176
266 3300025941 Ga0207711_10306905 Ga0207711_103069052 176
267 3300025941 Ga0207711_10871841 Ga0207711_108718411 176
268 3300025942 Ga0207689_10002306 Ga0207689_100023064 176
269 3300025942 Ga0207689_10455376 Ga0207689_104553761 176
270 3300025960 Ga0207651_10005443 Ga0207651_100054437 176
271 3300025960 Ga0207651_10213428 Ga0207651_102134281 176
272 3300025960 Ga0207651_10234661 Ga0207651_102346612 176
273 3300025960 Ga0207651_10826156 Ga0207651_108261561 176
274 3300025960 Ga0207651_10858174 Ga0207651_108581741 176
275 3300025960 Ga0207651_10911141 Ga0207651_109111412 176
276 3300025961 Ga0207712_10020366 Ga0207712_100203663 176
277 3300025972 Ga0207668_10015991 Ga0207668_100159912 176
278 3300025972 Ga0207668_10765997 Ga0207668_107659971 176
279 3300025981 Ga0207640_10208027 Ga0207640_102080272 176
280 3300025981 Ga0207640_10512907 Ga0207640_105129071 176
281 3300025986 Ga0207658_10000522 Ga0207658_100005229 176
282 3300025986 Ga0207658_10020408 Ga0207658_100204084 176
283 3300026023 Ga0207677_10339204 Ga0207677_103392042 176
284 3300026035 Ga0207703_10000176 Ga0207703_1000017643 176
285 3300026041 Ga0207639_10779486 Ga0207639_107794861 176
286 3300026067 Ga0207678_10020746 Ga0207678_100207464 176
287 3300026088 Ga0207641_10004775 Ga0207641_100047756 176
288 3300026088 Ga0207641_10072443 Ga0207641_100724433 176
289 3300026088 Ga0207641_10495877 Ga0207641_104958772 176
290 3300026088 Ga0207641_10785337 Ga0207641_107853372 176
291 3300026089 Ga0207648_10031627 Ga0207648_100316274 176
292 3300026089 Ga0207648_10323233 Ga0207648_103232332 176
293 3300026089 Ga0207648_10429004 Ga0207648_104290042 176
294 3300026089 Ga0207648_10801062 Ga0207648_108010621 176
295 3300026095 Ga0207676_10026840 Ga0207676_100268402 176
296 3300026095 Ga0207676_10624987 Ga0207676_106249872 176
297 3300026118 Ga0207675_100016813 Ga0207675_1000168134 176
298 3300026121 Ga0207683_10001689 Ga0207683_1000168912 176
299 3300026121 Ga0207683_10035625 Ga0207683_100356254 176
300 3300026121 Ga0207683_10145547 Ga0207683_101455472 176
301 3300026121 Ga0207683_10243479 Ga0207683_102434792 176
302 3300026142 Ga0207698_10008637 Ga0207698_100086373 176
303 3300026142 Ga0207698_10523110 Ga0207698_105231102 176
304 3300026142 Ga0207698_10551969 Ga0207698_105519691 176
305 3300026142 Ga0207698_10859462 Ga0207698_108594621 176
306 3300028381 Ga0268264_10000951 Ga0268264_1000095116 176
307 3300028381 Ga0268264_10408821 Ga0268264_104088211 176
308 3300030522 Ga0307512_10087715 Ga0307512_100877151 176
309 3300030763 Ga0265763_1002732 Ga0265763_10027322 176
310 3300030878 Ga0265770_1012811 Ga0265770_10128112 176
311 3300031456 Ga0307513_10418856 Ga0307513_104188562 176
312 3300031507 Ga0307509_10032771 Ga0307509_100327713 176
313 3300031507 Ga0307509_10173469 Ga0307509_101734693 176
314 3300031507 Ga0307509_10554061 Ga0307509_105540611 176
315 3300031616 Ga0307508_10033738 Ga0307508_100337384 176
316 3300031730 Ga0307516_10014615 Ga0307516_100146156 176
317 3300033179 Ga0307507_10306566 Ga0307507_103065662 176
318 3300033180 Ga0307510_10014730 Ga0307510_100147302 176
319 3300035111 Ga0373923_0088165 Ga0373923_0088165_360_893 176
320 3300035120 Ga0373957_0044807 Ga0373957_0044807_276_809 176
321 3300035170 Ga0373943_0016860 Ga0373943_0016860_1861_2394 176
322 3300035171 Ga0373946_0429817 Ga0373946_0429817_88_621 176
323 3300035410 Ga0373924_0017407 Ga0373924_0017407_632_1165 176
324 3300036401 Ga0373937_0256567 Ga0373937_0256567_257_790 176
325 3300037068 Ga0373925_0076419 Ga0373925_0076419_1916_2449 176
326 3300039437 Ga0436365_1683483 Ga0436365_1683483_189_722 176
327 3300041443 Ga0451789_0940944 Ga0451789_0940944_817_1350 176
328 3300041451 Ga0451791_1632641 Ga0451791_1632641_626_1159 176
329 3300041486 Ga0451807_0724946 Ga0451807_0724946_13_546 176
330 3300041505 Ga0451849_0881121 Ga0451849_0881121_97_630 176
331 3300041509 Ga0451843_0693181 Ga0451843_0693181_44_577 176
332 3300041509 Ga0451843_1580135 Ga0451843_1580135_242_775 176
333 3300042007 Ga0439449_0046127 Ga0439449_0046127_855_1388 176
334 3300045051 Ga0451576_0051826 Ga0451576_0051826_2003_2533 176
335 3300046459 Ga0495629_0110232 Ga0495629_0110232_1243_1776 176
336 3300046537 Ga0495598_0008475 Ga0495598_0008475_615_1148 176
337 3300046539 Ga0495621_0167944 Ga0495621_0167944_25_558 176
338 3300046615 Ga0495656_0216456 Ga0495656_0216456_78_611 176
339 3300046681 Ga0495647_0045321 Ga0495647_0045321_939_1472 176
340 3300046681 Ga0495647_0370210 Ga0495647_0370210_49_582 176
341 3300046683 Ga0495658_0007763 Ga0495658_0007763_2526_3059 176
342 3300046683 Ga0495658_0188855 Ga0495658_0188855_548_1186 176
343 3300048905 Ga0496102_0008802 Ga0496102_0008802_3194_3727 176
344 3300048908 Ga0496105_0109802 Ga0496105_0109802_1035_1568 176
345 3300048911 Ga0496108_0319824 Ga0496108_0319824_341_874 176
346 3300048912 Ga0496109_0891436 Ga0496109_0891436_212_745 176
347 3300048913 Ga0496110_1280348 Ga0496110_1280348_20_553 176
348 3300048915 Ga0496112_0379389 Ga0496112_0379389_295_828 176
349 3300048917 Ga0496114_0015985 Ga0496114_0015985_2521_3054 176
350 3300050493 nmdc:mga0k408_42194_c1 nmdc:mga0k408_42194_c1_35_565 176
351 3300053077 Ga0495601_0319911 Ga0495601_0319911_94_627 176
352 3300053086 Ga0500578_0316597 Ga0500578_0316597_118_684 176
353 3300053121 Ga0500607_109246 Ga0500607_109246_205_771 176
354 3300053131 Ga0500652_017265 Ga0500652_017265_937_1503 176
355 3300005333 Ga0070677_10016688 Ga0070677_100166883 177
356 3300005336 Ga0070680_100323054 Ga0070680_1003230542 177
357 3300005339 Ga0070660_100206034 Ga0070660_1002060342 177
358 3300005344 Ga0070661_100115322 Ga0070661_1001153221 177
359 3300005347 Ga0070668_100907620 Ga0070668_1009076201 177
360 3300005353 Ga0070669_100231218 Ga0070669_1002312182 177
361 3300005354 Ga0070675_100112437 Ga0070675_1001124372 177
362 3300005355 Ga0070671_100549346 Ga0070671_1005493461 177
363 3300005364 Ga0070673_100390816 Ga0070673_1003908162 177
364 3300005367 Ga0070667_100863838 Ga0070667_1008638381 177
365 3300005456 Ga0070678_100293303 Ga0070678_1002933032 177
366 3300005458 Ga0070681_10042640 Ga0070681_100426402 177
367 3300005530 Ga0070679_100018771 Ga0070679_1000187715 177
368 3300005539 Ga0068853_100083709 Ga0068853_1000837092 177
369 3300005547 Ga0070693_100264660 Ga0070693_1002646602 177
370 3300005577 Ga0068857_100438261 Ga0068857_1004382612 177
371 3300005614 Ga0068856_100549383 Ga0068856_1005493832 177
372 3300005616 Ga0068852_100890127 Ga0068852_1008901271 177
373 3300005840 Ga0068870_10125091 Ga0068870_101250912 177
374 3300005843 Ga0068860_101202663 Ga0068860_1012026631 177
375 3300006871 Ga0075434_100949654 Ga0075434_1009496541 177
376 3300009148 Ga0105243_11319089 Ga0105243_113190892 177
377 3300009174 Ga0105241_10576362 Ga0105241_105763622 177
378 3300009553 Ga0105249_10597095 Ga0105249_105970952 177
379 3300013100 Ga0157373_10014107 Ga0157373_100141072 177
380 3300013104 Ga0157370_10014887 Ga0157370_100148872 177
381 3300013307 Ga0157372_10113005 Ga0157372_101130053 177
382 3300014326 Ga0157380_10416088 Ga0157380_104160881 177
383 3300017792 Ga0163161_10969402 Ga0163161_109694021 177
384 3300025893 Ga0207682_10006258 Ga0207682_100062583 177
385 3300025911 Ga0207654_10045232 Ga0207654_100452323 177
386 3300025912 Ga0207707_10064575 Ga0207707_100645753 177
387 3300025917 Ga0207660_10179454 Ga0207660_101794542 177
388 3300025920 Ga0207649_10035005 Ga0207649_100350052 177
389 3300025921 Ga0207652_10109568 Ga0207652_101095682 177
390 3300025923 Ga0207681_10066168 Ga0207681_100661681 177
391 3300025925 Ga0207650_10344262 Ga0207650_103442621 177
392 3300025926 Ga0207659_10041467 Ga0207659_100414673 177
393 3300025933 Ga0207706_10395808 Ga0207706_103958082 177
394 3300025935 Ga0207709_10473713 Ga0207709_104737132 177
395 3300025938 Ga0207704_10205455 Ga0207704_102054552 177
396 3300025961 Ga0207712_10334891 Ga0207712_103348913 177
397 3300025986 Ga0207658_10441438 Ga0207658_104414381 177
398 3300026067 Ga0207678_11353618 Ga0207678_113536181 177
399 3300026088 Ga0207641_10312054 Ga0207641_103120542 177
400 3300026116 Ga0207674_10165424 Ga0207674_101654242 177
401 3300045051 Ga0451576_0672347 Ga0451576_0672347_384_932 177
402 3300046539 Ga0495621_0014337 Ga0495621_0014337_229_765 177
403 3300049571 Ga0501034_0059094 Ga0501034_0059094_2306_2854 177
404 3300049571 Ga0501034_0139234 Ga0501034_0139234_1112_1669 177
405 3300049581 Ga0501047_0177067 Ga0501047_0177067_1186_1734 177
406 3300049583 Ga0501067_0084256 Ga0501067_0084256_907_1455 177
407 3300049589 Ga0501073_0046361 Ga0501073_0046361_1242_1790 177
408 3300049590 Ga0501074_0377328 Ga0501074_0377328_373_921 177
409 3300049742 Ga0501080_0031013 Ga0501080_0031013_4027_4575 177
410 3300049744 Ga0501083_0163326 Ga0501083_0163326_812_1360 177
411 3300060353 Ga0501082_0222515 Ga0501082_0222515_238_786 177
412 3300002067 JGI24735J21928_10039211 JGI24735J21928_100392112 179
413 3300005327 Ga0070658_10000258 Ga0070658_100002589 179
414 3300005335 Ga0070666_10000001 Ga0070666_10000001261 179
415 3300005344 Ga0070661_100004763 Ga0070661_1000047635 179
416 3300005367 Ga0070667_100061271 Ga0070667_1000612713 179
417 3300005456 Ga0070678_100099139 Ga0070678_1000991391 179
418 3300005548 Ga0070665_100030037 Ga0070665_1000300374 179
419 3300005842 Ga0068858_100105362 Ga0068858_1001053622 179
420 3300005843 Ga0068860_100022760 Ga0068860_1000227605 179
421 3300005844 Ga0068862_100373066 Ga0068862_1003730662 179
422 3300009177 Ga0105248_11316160 Ga0105248_113161601 179
423 3300009551 Ga0105238_10001010 Ga0105238_1000101029 179
424 3300013306 Ga0163162_10001588 Ga0163162_1000158819 179
425 3300025903 Ga0207680_10000003 Ga0207680_10000003309 179
426 3300025909 Ga0207705_10018667 Ga0207705_100186675 179
427 3300025920 Ga0207649_10005585 Ga0207649_100055853 179
428 3300025924 Ga0207694_10000469 Ga0207694_1000046914 179
429 3300026035 Ga0207703_10171066 Ga0207703_101710663 179
430 3300026121 Ga0207683_10075634 Ga0207683_100756343 179
431 3300028379 Ga0268266_10000011 Ga0268266_10000011257 179
432 3300028381 Ga0268264_10019693 Ga0268264_100196935 179
433 3300033180 Ga0307510_10108124 Ga0307510_101081243 179
434 3300046471 Ga0495650_0000222 Ga0495650_0000222_18947_19486 179
435 3300046507 Ga0495606_0057674 Ga0495606_0057674_994_1533 179
436 3300048924 Ga0496121_0214223 Ga0496121_0214223_596_1135 179
437 3300048929 Ga0496126_0046169 Ga0496126_0046169_562_1101 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

61

173

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8731 24 177
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8727 25 176
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8673 24 177
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8567 30 179
3l8k-assembly1.cif.gz_B-2 crystal structure of a dihydrolipoyl dehydrogenase from sulfolobus solfataricus 0.8564 31 54
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8741 76 176 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8698 32 177 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8576 32 177 3.30.300.20
3l8kB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8564 31 54 3.50.50.60
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8546 69 179 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7D7VH81-F1-model_v4 OsmC family peroxiredoxin 0.9512 3 177
AF-A0A537G7D5-F1-model_v4 OsmC family protein 0.95 53 177
AF-A0A536BQX9-F1-model_v4 OsmC family protein 0.9496 1 165
AF-A0A327LYH2-F1-model_v4 OsmC family peroxiredoxin 0.9482 1 165
AF-A0A536BBI7-F1-model_v4 OsmC family protein 0.9481 1 165

Feature Viewer

pLDDT pTM Quality
93.77 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map