F443683

General Info

Members Datasets Scaffolds Average Seq Length
437 240 872 157

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10091320|rootL2_100913202
Length 193
Sequence MITVKQCTVTGFPLLSIVPCRKSTYLDLLFTEKQFFMVKLKINQKEYTVDASPDMPLLWAIRDIVGLTGTKFGCGMAQCGACTVHLDGEAVRSCVTLVSRAVGKEIVTIEGLSADPDNYLQKAWIELDVPQCGYCQSGQIMSAAVLLRENPNPTDEDIDSAMSGNICRCGTYPRIRKAIHLAAKMQREGGKNK

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
224 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
233 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.7
Nodule 0
Rhizoplane 0.23
Rhizosphere 87.41
Stem 0
Stem Tuber 0
Unclassified 6.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10091320 3300003322 Bacteria 1925
2 SwRhRL2b_contig_2198354 2162886007 Bacteria 28683
3 JGI24736J21556_1020327 3300001904 Unclassified 1044
4 JGI24739J22299_10000783 3300001989 Bacteria 11599
5 JGI24737J22298_10007573 3300001990 Bacteria 3659
6 JGI24737J22298_10015189 3300001990 Bacteria 2493
7 JGI24735J21928_10000002 3300002067 Bacteria 624895
8 JGI25154J39366_1012167 3300002738 Bacteria 959
9 JGI25153J46596_10018283 3300003215 Bacteria 2729
10 rootH1_10081086 3300003316 Bacteria 6114
11 rootH2_10052254 3300003320 Bacteria 7924
12 rootL2_10185155 3300003322 Bacteria 7042
13 rootL2_10275954 3300003322 Bacteria 2669
14 JGI25160J50197_1004412 3300003354 Bacteria 6095
15 Ga0055526_1035187 3300003771 Bacteria 1355
16 Ga0055528_1000209 3300003790 Bacteria 49598
17 Ga0055528_1000317 3300003790 Bacteria 40640
18 Ga0055530_10005661 3300003791 Bacteria 5847
19 Ga0055530_10020618 3300003791 Bacteria 1964
20 Ga0055531_10000354 3300003794 Bacteria 44915
21 Ga0055543_1014310 3300004625 Bacteria 1549
22 Ga0065165_1000225 3300005262 Bacteria 99123
23 Ga0065714_10003480 3300005288 Bacteria 7167
24 Ga0065714_10016702 3300005288 Bacteria 2058
25 Ga0065704_10000258 3300005289 Bacteria 102292
26 Ga0065715_10420429 3300005293 Bacteria 859
27 Ga0070658_10235785 3300005327 Bacteria 1550
28 Ga0070658_10481717 3300005327 Bacteria 1071
29 Ga0070676_10000053 3300005328 Bacteria 37051
30 Ga0070683_100028149 3300005329 Bacteria 5077
31 Ga0070683_100745149 3300005329 Bacteria 938
32 Ga0070670_100352791 3300005331 Bacteria 1292
33 Ga0068869_100354900 3300005334 Bacteria 1196
34 Ga0070666_10000050 3300005335 Bacteria 100280
35 Ga0070666_10745510 3300005335 Bacteria 720
36 Ga0070680_100047401 3300005336 Bacteria 3499
37 Ga0068868_100070835 3300005338 Bacteria 2780
38 Ga0068868_100109700 3300005338 Bacteria 2241
39 Ga0068868_100521843 3300005338 Bacteria 1043
40 Ga0070660_100005857 3300005339 Bacteria 8509
41 Ga0070660_100632296 3300005339 Bacteria 896
42 Ga0070669_100266142 3300005353 Bacteria 1369
43 Ga0070671_100038320 3300005355 Bacteria 3979
44 Ga0070673_100258728 3300005364 Bacteria 1520
45 Ga0070673_100280794 3300005364 Bacteria 1461
46 Ga0070667_100011433 3300005367 Bacteria 7340
47 Ga0070667_100012636 3300005367 Bacteria 6983
48 Ga0070667_100603587 3300005367 Bacteria 1011
49 Ga0070667_101013920 3300005367 Bacteria 775
50 Ga0070703_10352800 3300005406 Bacteria 628
51 Ga0070714_101124158 3300005435 Bacteria 766
52 Ga0070713_100205885 3300005436 Bacteria 1779
53 Ga0070713_100436295 3300005436 Bacteria 1228
54 Ga0070713_101214464 3300005436 Bacteria 730
55 Ga0070701_11062759 3300005438 Bacteria 568
56 Ga0070700_101237561 3300005441 Unclassified 625
57 Ga0070700_101450391 3300005441 Bacteria 582
58 Ga0070678_100031234 3300005456 Unclassified 3671
59 Ga0070678_101077194 3300005456 Bacteria 741
60 Ga0070662_100000132 3300005457 Bacteria 41983
61 Ga0070681_10021014 3300005458 Bacteria 6539
62 Ga0068867_100004376 3300005459 Bacteria 9945
63 Ga0068867_100344420 3300005459 Bacteria 1242
64 Ga0070684_100037934 3300005535 Bacteria 4136
65 Ga0070684_100659932 3300005535 Bacteria 974
66 Ga0070684_101098749 3300005535 Bacteria 747
67 Ga0070684_101145978 3300005535 Bacteria 731
68 Ga0068853_100018771 3300005539 Bacteria 5727
69 Ga0068853_100055748 3300005539 Bacteria 3407
70 Ga0068853_100147682 3300005539 Unclassified 2114
71 Ga0070672_100110376 3300005543 Bacteria 2241
72 Ga0070672_100441324 3300005543 Bacteria 1120
73 Ga0070665_100000020 3300005548 Bacteria 389687
74 Ga0070665_100000581 3300005548 Bacteria 51024
75 Ga0070665_100058824 3300005548 Bacteria 3853
76 Ga0068855_100023624 3300005563 Bacteria 7364
77 Ga0068855_100096297 3300005563 Bacteria 3410
78 Ga0068855_100135028 3300005563 Bacteria 2815
79 Ga0068855_101554592 3300005563 Bacteria 678
80 Ga0068857_100138471 3300005577 Bacteria 2199
81 Ga0068857_101121242 3300005577 Bacteria 760
82 Ga0068854_100705393 3300005578 Bacteria 871
83 Ga0068856_100222712 3300005614 Bacteria 1902
84 Ga0068852_100003986 3300005616 Bacteria 10377
85 Ga0068852_100005954 3300005616 Bacteria 8777
86 Ga0068852_100467106 3300005616 Unclassified 1252
87 Ga0068852_100708742 3300005616 Unclassified 1017
88 Ga0068859_100000025 3300005617 Bacteria 191679
89 Ga0068859_100011927 3300005617 Bacteria 8731
90 Ga0068859_100116987 3300005617 Bacteria 2731
91 Ga0068864_100016894 3300005618 Bacteria 6082
92 Ga0068864_100516444 3300005618 Bacteria 1151
93 Ga0068864_101337050 3300005618 Bacteria 717
94 Ga0068864_101629309 3300005618 Bacteria 650
95 Ga0068864_101925290 3300005618 Bacteria 597
96 Ga0068866_11099553 3300005718 Unclassified 569
97 Ga0068851_10072084 3300005834 Bacteria 1789
98 Ga0068863_100002841 3300005841 Bacteria 17144
99 Ga0068863_100289610 3300005841 Bacteria 1587
100 Ga0068863_101302495 3300005841 Bacteria 733
101 Ga0068858_100011067 3300005842 Bacteria 8531
102 Ga0068858_101007505 3300005842 Bacteria 816
103 Ga0068860_100003010 3300005843 Bacteria 17411
104 Ga0068860_100016819 3300005843 Bacteria 7131
105 Ga0068860_101542365 3300005843 Bacteria 686
106 Ga0081539_10051441 3300005985 Unclassified 2322
107 Ga0081539_10129031 3300005985 Bacteria 1245
108 Ga0075366_10104730 3300006195 Bacteria 1700
109 Ga0097621_100001247 3300006237 Bacteria 17596
110 Ga0097621_100548690 3300006237 Bacteria 1052
111 Ga0068871_100000710 3300006358 Bacteria 22594
112 Ga0068871_100305299 3300006358 Bacteria 1398
113 Ga0068871_100584222 3300006358 Bacteria 1014
114 Ga0068871_100851800 3300006358 Bacteria 843
115 Ga0068871_101861024 3300006358 Unclassified 572
116 Ga0068865_100003231 3300006881 Bacteria 9761
117 Ga0097620_100000025 3300006931 Bacteria 191679
118 Ga0097620_100011927 3300006931 Bacteria 8731
119 Ga0097620_100116979 3300006931 Bacteria 2731
120 Ga0099794_10035872 3300007265 Bacteria 2342
121 Ga0105244_10102648 3300009036 Bacteria 1397
122 Ga0105240_10001590 3300009093 Bacteria 38585
123 Ga0105240_10045283 3300009093 Bacteria 5582
124 Ga0105240_10165121 3300009093 Unclassified 2627
125 Ga0105240_10319974 3300009093 Bacteria 1769
126 Ga0105245_10235644 3300009098 Bacteria 1772
127 Ga0105245_10285794 3300009098 Bacteria 1614
128 Ga0105245_12087967 3300009098 Bacteria 620
129 Ga0105247_10029175 3300009101 Bacteria 3342
130 Ga0105247_10553570 3300009101 Bacteria 846
131 Ga0105243_10056302 3300009148 Bacteria 3126
132 Ga0105243_11430480 3300009148 Bacteria 713
133 Ga0105241_10001218 3300009174 Bacteria 19675
134 Ga0105241_10002147 3300009174 Bacteria 14863
135 Ga0105241_10005149 3300009174 Bacteria 9644
136 Ga0105241_10181226 3300009174 Bacteria 1747
137 Ga0105242_10075581 3300009176 Bacteria 2805
138 Ga0105242_10389042 3300009176 Bacteria 1298
139 Ga0105242_11801849 3300009176 Unclassified 650
140 Ga0105248_10316340 3300009177 Bacteria 1758
141 Ga0105237_10005071 3300009545 Bacteria 14963
142 Ga0105237_10005234 3300009545 Bacteria 14676
143 Ga0105237_10005513 3300009545 Bacteria 14262
144 Ga0105237_10007561 3300009545 Bacteria 11876
145 Ga0105237_10070929 3300009545 Bacteria 3479
146 Ga0105237_10134754 3300009545 Bacteria 2464
147 Ga0105237_10174955 3300009545 Bacteria 2147
148 Ga0105237_10908119 3300009545 Bacteria 888
149 Ga0105237_11155496 3300009545 Bacteria 781
150 Ga0105238_10002923 3300009551 Bacteria 17052
151 Ga0105238_10465533 3300009551 Bacteria 1262
152 Ga0105249_10020133 3300009553 Bacteria 5960
153 Ga0105249_10099896 3300009553 Bacteria 2728
154 Ga0105239_10000701 3300010375 Bacteria 47575
155 Ga0105239_10050041 3300010375 Unclassified 4583
156 Ga0105239_10268375 3300010375 Unclassified 1919
157 Ga0105239_10313468 3300010375 Bacteria 1768
158 Ga0105246_10007813 3300011119 Bacteria 6561
159 Ga0105246_10336892 3300011119 Unclassified 1231
160 Ga0105246_10552826 3300011119 Bacteria 987
161 Ga0157373_10000578 3300013100 Bacteria 28485
162 Ga0157373_10037590 3300013100 Bacteria 3470
163 Ga0157371_10100589 3300013102 Bacteria 2050
164 Ga0157371_10101777 3300013102 Unclassified 2038
165 Ga0157371_10151391 3300013102 Bacteria 1655
166 Ga0157371_10151413 3300013102 Bacteria 1655
167 Ga0157370_10012898 3300013104 Bacteria 8639
168 Ga0157370_10414331 3300013104 Bacteria 1240
169 Ga0157370_10434743 3300013104 Bacteria 1207
170 Ga0157370_10927471 3300013104 Bacteria 790
171 Ga0157369_10103496 3300013105 Bacteria 3033
172 Ga0157369_10329063 3300013105 Bacteria 1588
173 Ga0157369_11070987 3300013105 Unclassified 824
174 Ga0157374_10002112 3300013296 Bacteria 16713
175 Ga0157374_10003227 3300013296 Bacteria 13700
176 Ga0157374_10052963 3300013296 Bacteria 3782
177 Ga0157374_10088782 3300013296 Bacteria 2945
178 Ga0157378_10002905 3300013297 Bacteria 15257
179 Ga0157378_10013693 3300013297 Bacteria 7094
180 Ga0157378_10057730 3300013297 Bacteria 3460
181 Ga0157378_10126202 3300013297 Bacteria 2364
182 Ga0163162_10000032 3300013306 Bacteria 156609
183 Ga0163162_10000344 3300013306 Bacteria 42218
184 Ga0163162_10099580 3300013306 Bacteria 2997
185 Ga0163162_10218310 3300013306 Unclassified 2037
186 Ga0163162_10288161 3300013306 Bacteria 1774
187 Ga0163162_10306013 3300013306 Bacteria 1722
188 Ga0163162_10782639 3300013306 Bacteria 1072
189 Ga0163162_11599856 3300013306 Bacteria 743
190 Ga0163162_12369200 3300013306 Bacteria 610
191 Ga0157372_10002858 3300013307 Bacteria 18659
192 Ga0157372_10098441 3300013307 Bacteria 3337
193 Ga0157375_10020919 3300013308 Bacteria 5988
194 Ga0157375_10046977 3300013308 Bacteria 4212
195 Ga0157375_10105260 3300013308 Bacteria 2911
196 Ga0157375_10486316 3300013308 Bacteria 1399
197 Ga0157375_10532032 3300013308 Bacteria 1338
198 Ga0157375_10622578 3300013308 Bacteria 1237
199 Ga0163163_10531012 3300014325 Bacteria 1239
200 Ga0157380_10002914 3300014326 Bacteria 11634
201 Ga0157377_10117356 3300014745 Unclassified 1608
202 Ga0157379_10025888 3300014968 Bacteria 5216
203 Ga0157379_10296230 3300014968 Bacteria 1474
204 Ga0157379_10411603 3300014968 Bacteria 1244
205 Ga0157376_10007363 3300014969 Bacteria 7848
206 Ga0157376_10294666 3300014969 Bacteria 1533
207 Ga0163161_10337241 3300017792 Bacteria 1195
208 Ga0163161_10521296 3300017792 Unclassified 970
209 Ga0206356_11644439 3300020070 Bacteria 809
210 Ga0213872_10031289 3300021361 Bacteria 2439
211 Ga0209437_100024 3300025233 Bacteria 592878
212 Ga0209646_1002891 3300025246 Bacteria 3580
213 Ga0209673_1000167 3300025273 Bacteria 135172
214 Ga0209676_1000001 3300025292 Bacteria 1852142
215 Ga0209564_1001763 3300025295 Bacteria 20152
216 Ga0209564_1004541 3300025295 Bacteria 8428
217 Ga0209564_1089063 3300025295 Bacteria 572
218 Ga0209758_1013768 3300025297 Bacteria 4375
219 Ga0209050_1000018 3300025298 Bacteria 723263
220 Ga0209050_1000503 3300025298 Bacteria 66444
221 Ga0207426_1004780 3300025302 Bacteria 6439
222 Ga0209051_1077781 3300025303 Bacteria 970
223 Ga0209257_1000008 3300025304 Bacteria 1294570
224 Ga0209257_1003179 3300025304 Bacteria 14609
225 Ga0207656_10149571 3300025321 Bacteria 1105
226 Ga0207642_10343912 3300025899 Unclassified 878
227 Ga0207710_10025163 3300025900 Bacteria 2568
228 Ga0207680_10000086 3300025903 Bacteria 42622
229 Ga0207680_10796485 3300025903 Bacteria 677
230 Ga0207647_10002636 3300025904 Bacteria 13557
231 Ga0207645_10000440 3300025907 Bacteria 34498
232 Ga0207705_10013419 3300025909 Bacteria 5910
233 Ga0207654_10003112 3300025911 Bacteria 8401
234 Ga0207654_10003382 3300025911 Bacteria 8074
235 Ga0207654_10026306 3300025911 Bacteria 3149
236 Ga0207707_10101356 3300025912 Bacteria 2516
237 Ga0207695_10019578 3300025913 Bacteria 7788
238 Ga0207695_10022737 3300025913 Bacteria 7104
239 Ga0207695_10109889 3300025913 Bacteria 2738
240 Ga0207671_10003741 3300025914 Bacteria 14990
241 Ga0207671_10041100 3300025914 Bacteria 3422
242 Ga0207671_10045295 3300025914 Bacteria 3253
243 Ga0207671_10061581 3300025914 Bacteria 2784
244 Ga0207671_10090623 3300025914 Bacteria 2303
245 Ga0207671_10132864 3300025914 Bacteria 1912
246 Ga0207671_10352321 3300025914 Bacteria 1167
247 Ga0207671_10509077 3300025914 Bacteria 960
248 Ga0207660_10040488 3300025917 Bacteria 3263
249 Ga0207657_10024815 3300025919 Bacteria 5542
250 Ga0207657_10828162 3300025919 Bacteria 715
251 Ga0207649_11578123 3300025920 Unclassified 519
252 Ga0207652_10234357 3300025921 Bacteria 1654
253 Ga0207681_10196804 3300025923 Bacteria 1545
254 Ga0207681_10524243 3300025923 Bacteria 973
255 Ga0207694_10045797 3300025924 Bacteria 3379
256 Ga0207694_10901207 3300025924 Bacteria 748
257 Ga0207650_10235102 3300025925 Bacteria 1479
258 Ga0207650_10525594 3300025925 Bacteria 990
259 Ga0207659_10172062 3300025926 Bacteria 1709
260 Ga0207687_10515110 3300025927 Bacteria 1000
261 Ga0207687_10886206 3300025927 Bacteria 763
262 Ga0207700_10101554 3300025928 Bacteria 2295
263 Ga0207644_10006375 3300025931 Bacteria 7685
264 Ga0207706_10000043 3300025933 Bacteria 124186
265 Ga0207686_10231683 3300025934 Bacteria 1339
266 Ga0207686_10773218 3300025934 Bacteria 768
267 Ga0207709_10550351 3300025935 Bacteria 907
268 Ga0207709_10668142 3300025935 Bacteria 829
269 Ga0207704_10000120 3300025938 Bacteria 42425
270 Ga0207704_10037988 3300025938 Bacteria 2787
271 Ga0207691_10195380 3300025940 Bacteria 1763
272 Ga0207691_10420680 3300025940 Bacteria 1139
273 Ga0207691_10464867 3300025940 Unclassified 1076
274 Ga0207689_10073266 3300025942 Bacteria 2813
275 Ga0207689_10546704 3300025942 Bacteria 972
276 Ga0207661_10569136 3300025944 Bacteria 1039
277 Ga0207667_10128096 3300025949 Bacteria 2614
278 Ga0207667_10250986 3300025949 Bacteria 1810
279 Ga0207667_10325279 3300025949 Bacteria 1570
280 Ga0207667_10737383 3300025949 Bacteria 985
281 Ga0207667_11379221 3300025949 Bacteria 679
282 Ga0207651_10095750 3300025960 Bacteria 2187
283 Ga0207651_10303544 3300025960 Bacteria 1328
284 Ga0207712_10016747 3300025961 Bacteria 4752
285 Ga0207658_10069358 3300025986 Bacteria 2663
286 Ga0207658_10203373 3300025986 Bacteria 1655
287 Ga0207658_10237326 3300025986 Bacteria 1542
288 Ga0207677_10047780 3300026023 Bacteria 2876
289 Ga0207677_10531715 3300026023 Bacteria 1021
290 Ga0207703_10006240 3300026035 Bacteria 9538
291 Ga0207703_12235185 3300026035 Bacteria 523
292 Ga0207639_10010887 3300026041 Bacteria 6308
293 Ga0207639_10014040 3300026041 Bacteria 5622
294 Ga0207639_10121741 3300026041 Unclassified 2145
295 Ga0207639_10203438 3300026041 Bacteria 1700
296 Ga0207641_10000661 3300026088 Bacteria 37590
297 Ga0207641_10059102 3300026088 Bacteria 3264
298 Ga0207648_10008517 3300026089 Bacteria 9927
299 Ga0207648_10108564 3300026089 Bacteria 2436
300 Ga0207676_10038678 3300026095 Bacteria 3643
301 Ga0207676_10072976 3300026095 Bacteria 2761
302 Ga0207676_11810000 3300026095 Bacteria 609
303 Ga0207683_10009754 3300026121 Bacteria 8186
304 Ga0207698_10001744 3300026142 Bacteria 12682
305 Ga0207698_10002995 3300026142 Bacteria 10135
306 Ga0268266_10000018 3300028379 Bacteria 569141
307 Ga0268266_10009155 3300028379 Bacteria 8738
308 Ga0268266_10057610 3300028379 Bacteria 3344
309 Ga0268264_10002203 3300028381 Bacteria 17296
310 Ga0265318_10077374 3300028577 Unclassified 1230
311 Ga0307517_10006765 3300028786 Bacteria 16871
312 Ga0307517_10011991 3300028786 Bacteria 11958
313 Ga0307515_10000162 3300028794 Bacteria 163720
314 Ga0265338_10020762 3300028800 Bacteria 6889
315 Ga0265324_10008508 3300029957 Bacteria 4072
316 Ga0265320_10078342 3300031240 Bacteria 1546
317 Ga0307513_10162634 3300031456 Bacteria 2122
318 Ga0307509_10023175 3300031507 Bacteria 6981
319 Ga0316578_10321793 3300031728 Bacteria 923
320 Ga0307412_10000031 3300031911 Bacteria 207128
321 Ga0307416_101424201 3300032002 Bacteria 799
322 Ga0307414_10001701 3300032004 Bacteria 11461
323 Ga0307510_10000766 3300033180 Bacteria 33227
324 Ga0373936_0000449 3300035113 Bacteria 13800
325 Ga0373954_0322448 3300035118 Bacteria 763
326 Ga0373955_0064475 3300035172 Bacteria 2031
327 Ga0373955_0110386 3300035172 Bacteria 1590
328 Ga0316574_0436286 3300035398 Bacteria 822
329 Ga0316574_0741514 3300035398 Bacteria 600
330 Ga0373937_0024923 3300036401 Bacteria 5399
331 Ga0373937_0787200 3300036401 Bacteria 899
332 Ga0373937_0837019 3300036401 Bacteria 868
333 Ga0395899_0110378 3300037312 Bacteria 1978
334 Ga0395900_0000231 3300037418 Bacteria 87314
335 Ga0395900_0026896 3300037418 Bacteria 5888
336 Ga0395898_0012430 3300037466 Bacteria 8802
337 Ga0395898_0076397 3300037466 Bacteria 3235
338 Ga0395905_0000261 3300037471 Bacteria 78643
339 Ga0395905_0000769 3300037471 Bacteria 42306
340 Ga0436364_0126689 3300037853 Bacteria 1217
341 Ga0395901_0000236 3300038443 Bacteria 69250
342 Ga0395901_0003843 3300038443 Bacteria 15134
343 Ga0436361_0020381 3300039447 Bacteria 2420
344 Ga0439431_0027889 3300041997 Bacteria 1389
345 Ga0439437_047902 3300042000 Bacteria 563
346 Ga0439445_0060612 3300042004 Bacteria 1034
347 Ga0439448_0026007 3300042005 Bacteria 1838
348 Ga0439457_056842 3300042014 Bacteria 883
349 Ga0439434_0077868 3300042435 Bacteria 1050
350 Ga0439435_0011220 3300042436 Bacteria 2146
351 Ga0451577_0009571 3300042876 Bacteria 9312
352 Ga0451577_0202546 3300042876 Bacteria 1792
353 Ga0451577_0261008 3300042876 Bacteria 1569
354 Ga0466969_0102905 3300044656 Bacteria 1343
355 Ga0466969_0148902 3300044656 Bacteria 1079
356 Ga0466972_0000062 3300044658 Bacteria 108852
357 Ga0466972_0015232 3300044658 Bacteria 3845
358 Ga0466961_0209328 3300044693 Bacteria 1204
359 Ga0466961_0350116 3300044693 Bacteria 899
360 Ga0466971_0331358 3300044719 Bacteria 734
361 Ga0466970_0298650 3300044765 Bacteria 908
362 Ga0466959_0018117 3300045049 Bacteria 5168
363 Ga0466959_0048157 3300045049 Bacteria 3133
364 Ga0466959_0172996 3300045049 Bacteria 1514
365 Ga0451576_0027340 3300045051 Bacteria 6128
366 Ga0466958_0722353 3300045836 Bacteria 649
367 Ga0495629_0083755 3300046459 Bacteria 2226
368 Ga0495638_0148451 3300046460 Bacteria 1362
369 Ga0495651_0044860 3300046462 Bacteria 3426
370 Ga0495650_0042353 3300046471 Bacteria 1939
371 Ga0495580_0042540 3300046472 Bacteria 3237
372 Ga0495596_0052271 3300046500 Bacteria 1599
373 Ga0495583_0052018 3300046506 Bacteria 1865
374 Ga0495583_0258429 3300046506 Bacteria 697
375 Ga0495606_0254605 3300046507 Bacteria 972
376 Ga0495608_0114514 3300046511 Bacteria 1732
377 Ga0495616_0009420 3300046513 Bacteria 5713
378 Ga0495616_0035715 3300046513 Bacteria 2569
379 Ga0495630_0038337 3300046517 Bacteria 3585
380 Ga0495630_1127230 3300046517 Bacteria 594
381 Ga0495632_0094399 3300046519 Unclassified 1415
382 Ga0495652_0585825 3300046529 Bacteria 763
383 Ga0495665_0272735 3300046531 Bacteria 869
384 Ga0495586_0054309 3300046535 Bacteria 2171
385 Ga0495587_0084330 3300046536 Bacteria 1840
386 Ga0495645_0120134 3300046543 Bacteria 1851
387 Ga0495645_0433205 3300046543 Bacteria 832
388 Ga0495633_0000014 3300046558 Bacteria 261742
389 Ga0495633_0000104 3300046558 Bacteria 114011
390 Ga0495667_0368178 3300046559 Bacteria 907
391 Ga0495667_0521402 3300046559 Bacteria 744
392 Ga0495668_0106075 3300046616 Bacteria 1537
393 Ga0495668_0344009 3300046616 Bacteria 818
394 Ga0495625_0000005 3300046660 Bacteria 596135
395 Ga0495625_0009290 3300046660 Bacteria 8242
396 Ga0495625_0055057 3300046660 Bacteria 2838
397 Ga0495625_0063142 3300046660 Bacteria 2616
398 Ga0495625_0090199 3300046660 Bacteria 2121
399 Ga0495625_0433034 3300046660 Bacteria 815
400 Ga0495661_0005445 3300046665 Bacteria 9036
401 Ga0495669_0023652 3300046684 Bacteria 2676
402 Ga0495671_0193084 3300046692 Unclassified 988
403 Ga0495649_0000003 3300046694 Bacteria 880817
404 Ga0495649_0063220 3300046694 Bacteria 1989
405 Ga0495660_0048514 3300046810 Bacteria 2322
406 Ga0495604_0197126 3300047317 Bacteria 1400
407 Ga0495604_0364254 3300047317 Bacteria 958
408 Ga0495674_0074974 3300047319 Bacteria 2912
409 Ga0495687_002745 3300047443 Bacteria 13645
410 Ga0495687_106578 3300047443 Bacteria 1039
411 Ga0495686_0044810 3300047472 Bacteria 2800
412 Ga0495602_0042214 3300048088 Bacteria 4158
413 Ga0496115_1104766 3300048918 Bacteria 601
414 Ga0496126_0011212 3300048929 Bacteria 9302
415 Ga0496126_0046152 3300048929 Bacteria 3999
416 Ga0495678_049516 3300049459 Bacteria 1632
417 Ga0501297_013697 3300049520 Bacteria 954
418 Ga0501047_0109067 3300049581 Bacteria 2651
419 Ga0501241_000943 3300049758 Bacteria 6165
420 Ga0501241_002500 3300049758 Bacteria 3548
421 nmdc:mga0k408_319903_c1 3300050493 Bacteria 926
422 nmdc:mga08x19_968428_c1 3300050514 Bacteria 604
423 Ga0500644_0140514 3300053088 Bacteria 959
424 Ga0500581_173266 3300053089 Unclassified 988
425 Ga0500651_0016121 3300053093 Bacteria 4593
426 Ga0500651_0036214 3300053093 Bacteria 3109
427 Ga0500572_116688 3300053111 Bacteria 862
428 Ga0500608_003726 3300053122 Bacteria 5775
429 Ga0500559_0346115 3300053136 Bacteria 695
430 Ga0500589_017274 3300053147 Bacteria 3250
431 Ga0500622_0000844 3300053156 Bacteria 26216
432 Ga0500622_0013499 3300053156 Bacteria 4407
433 Ga0500624_000909 3300053157 Bacteria 6240
434 Ga0500645_004358 3300053730 Bacteria 5439
435 Ga0500661_077089 3300055283 Bacteria 614
436 Ga0587062_064667 3300059639 Bacteria 649
437 rootL2_10091320
438 SwRhRL2b_contig_2198354
439 JGI24736J21556_1020327
440 JGI24739J22299_10000783
441 JGI24737J22298_10007573
442 JGI24737J22298_10015189
443 JGI24735J21928_10000002
444 JGI25154J39366_1012167
445 JGI25153J46596_10018283
446 rootH1_10081086
447 rootH2_10052254
448 rootL2_10185155
449 rootL2_10275954
450 JGI25160J50197_1004412
451 Ga0055526_1035187
452 Ga0055528_1000209
453 Ga0055528_1000317
454 Ga0055530_10005661
455 Ga0055530_10020618
456 Ga0055531_10000354
457 Ga0055543_1014310
458 Ga0065165_1000225
459 Ga0065714_10003480
460 Ga0065714_10016702
461 Ga0065704_10000258
462 Ga0065715_10420429
463 Ga0070658_10235785
464 Ga0070658_10481717
465 Ga0070676_10000053
466 Ga0070683_100028149
467 Ga0070683_100745149
468 Ga0070670_100352791
469 Ga0068869_100354900
470 Ga0070666_10000050
471 Ga0070666_10745510
472 Ga0070680_100047401
473 Ga0068868_100070835
474 Ga0068868_100109700
475 Ga0068868_100521843
476 Ga0070660_100005857
477 Ga0070660_100632296
478 Ga0070669_100266142
479 Ga0070671_100038320
480 Ga0070673_100258728
481 Ga0070673_100280794
482 Ga0070667_100011433
483 Ga0070667_100012636
484 Ga0070667_100603587
485 Ga0070667_101013920
486 Ga0070703_10352800
487 Ga0070714_101124158
488 Ga0070713_100205885
489 Ga0070713_100436295
490 Ga0070713_101214464
491 Ga0070701_11062759
492 Ga0070700_101237561
493 Ga0070700_101450391
494 Ga0070678_100031234
495 Ga0070678_101077194
496 Ga0070662_100000132
497 Ga0070681_10021014
498 Ga0068867_100004376
499 Ga0068867_100344420
500 Ga0070684_100037934
501 Ga0070684_100659932
502 Ga0070684_101098749
503 Ga0070684_101145978
504 Ga0068853_100018771
505 Ga0068853_100055748
506 Ga0068853_100147682
507 Ga0070672_100110376
508 Ga0070672_100441324
509 Ga0070665_100000020
510 Ga0070665_100000581
511 Ga0070665_100058824
512 Ga0068855_100023624
513 Ga0068855_100096297
514 Ga0068855_100135028
515 Ga0068855_101554592
516 Ga0068857_100138471
517 Ga0068857_101121242
518 Ga0068854_100705393
519 Ga0068856_100222712
520 Ga0068852_100003986
521 Ga0068852_100005954
522 Ga0068852_100467106
523 Ga0068852_100708742
524 Ga0068859_100000025
525 Ga0068859_100011927
526 Ga0068859_100116987
527 Ga0068864_100016894
528 Ga0068864_100516444
529 Ga0068864_101337050
530 Ga0068864_101629309
531 Ga0068864_101925290
532 Ga0068866_11099553
533 Ga0068851_10072084
534 Ga0068863_100002841
535 Ga0068863_100289610
536 Ga0068863_101302495
537 Ga0068858_100011067
538 Ga0068858_101007505
539 Ga0068860_100003010
540 Ga0068860_100016819
541 Ga0068860_101542365
542 Ga0081539_10051441
543 Ga0081539_10129031
544 Ga0075366_10104730
545 Ga0097621_100001247
546 Ga0097621_100548690
547 Ga0068871_100000710
548 Ga0068871_100305299
549 Ga0068871_100584222
550 Ga0068871_100851800
551 Ga0068871_101861024
552 Ga0068865_100003231
553 Ga0097620_100000025
554 Ga0097620_100011927
555 Ga0097620_100116979
556 Ga0099794_10035872
557 Ga0105244_10102648
558 Ga0105240_10001590
559 Ga0105240_10045283
560 Ga0105240_10165121
561 Ga0105240_10319974
562 Ga0105245_10235644
563 Ga0105245_10285794
564 Ga0105245_12087967
565 Ga0105247_10029175
566 Ga0105247_10553570
567 Ga0105243_10056302
568 Ga0105243_11430480
569 Ga0105241_10001218
570 Ga0105241_10002147
571 Ga0105241_10005149
572 Ga0105241_10181226
573 Ga0105242_10075581
574 Ga0105242_10389042
575 Ga0105242_11801849
576 Ga0105248_10316340
577 Ga0105237_10005071
578 Ga0105237_10005234
579 Ga0105237_10005513
580 Ga0105237_10007561
581 Ga0105237_10070929
582 Ga0105237_10134754
583 Ga0105237_10174955
584 Ga0105237_10908119
585 Ga0105237_11155496
586 Ga0105238_10002923
587 Ga0105238_10465533
588 Ga0105249_10020133
589 Ga0105249_10099896
590 Ga0105239_10000701
591 Ga0105239_10050041
592 Ga0105239_10268375
593 Ga0105239_10313468
594 Ga0105246_10007813
595 Ga0105246_10336892
596 Ga0105246_10552826
597 Ga0157373_10000578
598 Ga0157373_10037590
599 Ga0157371_10100589
600 Ga0157371_10101777
601 Ga0157371_10151391
602 Ga0157371_10151413
603 Ga0157370_10012898
604 Ga0157370_10414331
605 Ga0157370_10434743
606 Ga0157370_10927471
607 Ga0157369_10103496
608 Ga0157369_10329063
609 Ga0157369_11070987
610 Ga0157374_10002112
611 Ga0157374_10003227
612 Ga0157374_10052963
613 Ga0157374_10088782
614 Ga0157378_10002905
615 Ga0157378_10013693
616 Ga0157378_10057730
617 Ga0157378_10126202
618 Ga0163162_10000032
619 Ga0163162_10000344
620 Ga0163162_10099580
621 Ga0163162_10218310
622 Ga0163162_10288161
623 Ga0163162_10306013
624 Ga0163162_10782639
625 Ga0163162_11599856
626 Ga0163162_12369200
627 Ga0157372_10002858
628 Ga0157372_10098441
629 Ga0157375_10020919
630 Ga0157375_10046977
631 Ga0157375_10105260
632 Ga0157375_10486316
633 Ga0157375_10532032
634 Ga0157375_10622578
635 Ga0163163_10531012
636 Ga0157380_10002914
637 Ga0157377_10117356
638 Ga0157379_10025888
639 Ga0157379_10296230
640 Ga0157379_10411603
641 Ga0157376_10007363
642 Ga0157376_10294666
643 Ga0163161_10337241
644 Ga0163161_10521296
645 Ga0206356_11644439
646 Ga0213872_10031289
647 Ga0209437_100024
648 Ga0209646_1002891
649 Ga0209673_1000167
650 Ga0209676_1000001
651 Ga0209564_1001763
652 Ga0209564_1004541
653 Ga0209564_1089063
654 Ga0209758_1013768
655 Ga0209050_1000018
656 Ga0209050_1000503
657 Ga0207426_1004780
658 Ga0209051_1077781
659 Ga0209257_1000008
660 Ga0209257_1003179
661 Ga0207656_10149571
662 Ga0207642_10343912
663 Ga0207710_10025163
664 Ga0207680_10000086
665 Ga0207680_10796485
666 Ga0207647_10002636
667 Ga0207645_10000440
668 Ga0207705_10013419
669 Ga0207654_10003112
670 Ga0207654_10003382
671 Ga0207654_10026306
672 Ga0207707_10101356
673 Ga0207695_10019578
674 Ga0207695_10022737
675 Ga0207695_10109889
676 Ga0207671_10003741
677 Ga0207671_10041100
678 Ga0207671_10045295
679 Ga0207671_10061581
680 Ga0207671_10090623
681 Ga0207671_10132864
682 Ga0207671_10352321
683 Ga0207671_10509077
684 Ga0207660_10040488
685 Ga0207657_10024815
686 Ga0207657_10828162
687 Ga0207649_11578123
688 Ga0207652_10234357
689 Ga0207681_10196804
690 Ga0207681_10524243
691 Ga0207694_10045797
692 Ga0207694_10901207
693 Ga0207650_10235102
694 Ga0207650_10525594
695 Ga0207659_10172062
696 Ga0207687_10515110
697 Ga0207687_10886206
698 Ga0207700_10101554
699 Ga0207644_10006375
700 Ga0207706_10000043
701 Ga0207686_10231683
702 Ga0207686_10773218
703 Ga0207709_10550351
704 Ga0207709_10668142
705 Ga0207704_10000120
706 Ga0207704_10037988
707 Ga0207691_10195380
708 Ga0207691_10420680
709 Ga0207691_10464867
710 Ga0207689_10073266
711 Ga0207689_10546704
712 Ga0207661_10569136
713 Ga0207667_10128096
714 Ga0207667_10250986
715 Ga0207667_10325279
716 Ga0207667_10737383
717 Ga0207667_11379221
718 Ga0207651_10095750
719 Ga0207651_10303544
720 Ga0207712_10016747
721 Ga0207658_10069358
722 Ga0207658_10203373
723 Ga0207658_10237326
724 Ga0207677_10047780
725 Ga0207677_10531715
726 Ga0207703_10006240
727 Ga0207703_12235185
728 Ga0207639_10010887
729 Ga0207639_10014040
730 Ga0207639_10121741
731 Ga0207639_10203438
732 Ga0207641_10000661
733 Ga0207641_10059102
734 Ga0207648_10008517
735 Ga0207648_10108564
736 Ga0207676_10038678
737 Ga0207676_10072976
738 Ga0207676_11810000
739 Ga0207683_10009754
740 Ga0207698_10001744
741 Ga0207698_10002995
742 Ga0268266_10000018
743 Ga0268266_10009155
744 Ga0268266_10057610
745 Ga0268264_10002203
746 Ga0265318_10077374
747 Ga0307517_10006765
748 Ga0307517_10011991
749 Ga0307515_10000162
750 Ga0265338_10020762
751 Ga0265324_10008508
752 Ga0265320_10078342
753 Ga0307513_10162634
754 Ga0307509_10023175
755 Ga0316578_10321793
756 Ga0307412_10000031
757 Ga0307416_101424201
758 Ga0307414_10001701
759 Ga0307510_10000766
760 Ga0373936_0000449
761 Ga0373954_0322448
762 Ga0373955_0064475
763 Ga0373955_0110386
764 Ga0316574_0436286
765 Ga0316574_0741514
766 Ga0373937_0024923
767 Ga0373937_0787200
768 Ga0373937_0837019
769 Ga0395899_0110378
770 Ga0395900_0000231
771 Ga0395900_0026896
772 Ga0395898_0012430
773 Ga0395898_0076397
774 Ga0395905_0000261
775 Ga0395905_0000769
776 Ga0436364_0126689
777 Ga0395901_0000236
778 Ga0395901_0003843
779 Ga0436361_0020381
780 Ga0439431_0027889
781 Ga0439437_047902
782 Ga0439445_0060612
783 Ga0439448_0026007
784 Ga0439457_056842
785 Ga0439434_0077868
786 Ga0439435_0011220
787 Ga0451577_0009571
788 Ga0451577_0202546
789 Ga0451577_0261008
790 Ga0466969_0102905
791 Ga0466969_0148902
792 Ga0466972_0000062
793 Ga0466972_0015232
794 Ga0466961_0209328
795 Ga0466961_0350116
796 Ga0466971_0331358
797 Ga0466970_0298650
798 Ga0466959_0018117
799 Ga0466959_0048157
800 Ga0466959_0172996
801 Ga0451576_0027340
802 Ga0466958_0722353
803 Ga0495629_0083755
804 Ga0495638_0148451
805 Ga0495651_0044860
806 Ga0495650_0042353
807 Ga0495580_0042540
808 Ga0495596_0052271
809 Ga0495583_0052018
810 Ga0495583_0258429
811 Ga0495606_0254605
812 Ga0495608_0114514
813 Ga0495616_0009420
814 Ga0495616_0035715
815 Ga0495630_0038337
816 Ga0495630_1127230
817 Ga0495632_0094399
818 Ga0495652_0585825
819 Ga0495665_0272735
820 Ga0495586_0054309
821 Ga0495587_0084330
822 Ga0495645_0120134
823 Ga0495645_0433205
824 Ga0495633_0000014
825 Ga0495633_0000104
826 Ga0495667_0368178
827 Ga0495667_0521402
828 Ga0495668_0106075
829 Ga0495668_0344009
830 Ga0495625_0000005
831 Ga0495625_0009290
832 Ga0495625_0055057
833 Ga0495625_0063142
834 Ga0495625_0090199
835 Ga0495625_0433034
836 Ga0495661_0005445
837 Ga0495669_0023652
838 Ga0495671_0193084
839 Ga0495649_0000003
840 Ga0495649_0063220
841 Ga0495660_0048514
842 Ga0495604_0197126
843 Ga0495604_0364254
844 Ga0495674_0074974
845 Ga0495687_002745
846 Ga0495687_106578
847 Ga0495686_0044810
848 Ga0495602_0042214
849 Ga0496115_1104766
850 Ga0496126_0011212
851 Ga0496126_0046152
852 Ga0495678_049516
853 Ga0501297_013697
854 Ga0501047_0109067
855 Ga0501241_000943
856 Ga0501241_002500
857 nmdc:mga0k408_319903_c1
858 nmdc:mga08x19_968428_c1
859 Ga0500644_0140514
860 Ga0500581_173266
861 Ga0500651_0016121
862 Ga0500651_0036214
863 Ga0500572_116688
864 Ga0500608_003726
865 Ga0500559_0346115
866 Ga0500589_017274
867 Ga0500622_0000844
868 Ga0500622_0013499
869 Ga0500624_000909
870 Ga0500645_004358
871 Ga0500661_077089
872 Ga0587062_064667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

108

180

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

40

106

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8712 2 152
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.855 2 151
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.8524 2 151
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8498 2 152
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.8459 2 153
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8863 82 149 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.884 82 150 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8705 82 149 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8589 83 149 1.10.150.120
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8575 82 153 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A7Y9HYG7-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase small subunit (CoxS/CutS family) 0.9326 55 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V7RUN0-F1-model_v4 [2Fe-2S]-binding domain-containing protein 0.9218 51 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V7FSL9-F1-model_v4 (2Fe-2S)-binding protein 0.9213 43 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A7Y3G6D5-F1-model_v4 (2Fe-2S)-binding protein 0.9154 44 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A2R6M1L7-F1-model_v4 Carbon monoxide dehydrogenase 0.9105 43 154 GO:0016491
GO:0046872
GO:0051537

Map