F443722

General Info

Members Datasets Scaffolds Average Seq Length
437 252 874 111

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100095639|Ga0068854_1000956393
Length 136
Sequence VWCGCLISGISFLATGSSLSLQKKVMAKKNFTGVVYSTDPDFQYQENGGQRAQTLPPQQQNLKIYLDRKGGSKLVTRVTGFVGTDADLELIGKRLKTKCGVGGSVKDGEILIQGDFRDKILTLLQTDGYKAKKAGG

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
232 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
233 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
243 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
244 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
245 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 5.95
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 5.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100095639 3300005578 Bacteria 2218
2 JGI24737J22298_10000060 3300001990 Bacteria 32592
3 JGI24735J21928_10000032 3300002067 Bacteria 72360
4 JGI25162J39368_1000162 3300002737 Bacteria 74157
5 rootH2_10196396 3300003320 Bacteria 2811
6 rootH2_10279884 3300003320 Bacteria 1187
7 rootH1_10363186 3300003323 Bacteria 1675
8 Ga0065714_10070570 3300005288 Bacteria 3830
9 Ga0070658_10000008 3300005327 Bacteria 319912
10 Ga0070658_10037412 3300005327 Bacteria 3913
11 Ga0070683_100090808 3300005329 Bacteria 2868
12 Ga0070682_100275062 3300005337 Bacteria 1225
13 Ga0068868_100089075 3300005338 Bacteria 2484
14 Ga0070660_100019093 3300005339 Bacteria 5018
15 Ga0070660_100201347 3300005339 Bacteria 1615
16 Ga0070660_100279903 3300005339 Bacteria 1365
17 Ga0070687_100229355 3300005343 Bacteria 1142
18 Ga0070687_101109790 3300005343 Bacteria 579
19 Ga0070661_100483911 3300005344 Unclassified 989
20 Ga0070661_100886634 3300005344 Bacteria 736
21 Ga0070674_100457586 3300005356 Bacteria 1055
22 Ga0070674_100933130 3300005356 Bacteria 758
23 Ga0070659_100233610 3300005366 Bacteria 1520
24 Ga0070659_101704376 3300005366 Bacteria 564
25 Ga0070714_100344775 3300005435 Bacteria 1398
26 Ga0070713_100049378 3300005436 Bacteria 3471
27 Ga0070701_10096983 3300005438 Bacteria 1626
28 Ga0070700_100449010 3300005441 Bacteria 981
29 Ga0070663_100740030 3300005455 Bacteria 839
30 Ga0070663_101497651 3300005455 Bacteria 600
31 Ga0070678_100286906 3300005456 Bacteria 1394
32 Ga0068867_100098737 3300005459 Bacteria 2227
33 Ga0070685_10650146 3300005466 Bacteria 764
34 Ga0070699_101322248 3300005518 Unclassified 661
35 Ga0070684_100085484 3300005535 Bacteria 2797
36 Ga0070684_101433782 3300005535 Bacteria 650
37 Ga0068853_100090658 3300005539 Bacteria 2687
38 Ga0070672_100501486 3300005543 Bacteria 1050
39 Ga0070672_100777039 3300005543 Bacteria 842
40 Ga0070686_100090555 3300005544 Bacteria 2045
41 Ga0070686_100347352 3300005544 Bacteria 1113
42 Ga0070695_100705265 3300005545 Bacteria 801
43 Ga0070665_101066110 3300005548 Bacteria 820
44 Ga0068855_100000049 3300005563 Bacteria 145321
45 Ga0068855_100011610 3300005563 Bacteria 10643
46 Ga0068855_100074713 3300005563 Bacteria 3936
47 Ga0068855_101051456 3300005563 Bacteria 853
48 Ga0070664_100290945 3300005564 Bacteria 1475
49 Ga0070664_100571837 3300005564 Bacteria 1046
50 Ga0068857_100156202 3300005577 Bacteria 2068
51 Ga0068854_100499830 3300005578 Bacteria 1024
52 Ga0068854_101048888 3300005578 Bacteria 724
53 Ga0068856_100204729 3300005614 Bacteria 1988
54 Ga0068856_100281093 3300005614 Bacteria 1681
55 Ga0068856_100451157 3300005614 Bacteria 1307
56 Ga0070702_100225103 3300005615 Bacteria 1257
57 Ga0068852_100434065 3300005616 Bacteria 1298
58 Ga0068852_100549887 3300005616 Bacteria 1155
59 Ga0068859_100957857 3300005617 Bacteria 939
60 Ga0068864_100325420 3300005618 Bacteria 1445
61 Ga0068864_100336772 3300005618 Bacteria 1421
62 Ga0068864_100424633 3300005618 Bacteria 1267
63 Ga0068861_100208153 3300005719 Bacteria 1646
64 Ga0068858_100227334 3300005842 Bacteria 1768
65 Ga0068858_101111015 3300005842 Bacteria 776
66 Ga0068860_101298263 3300005843 Bacteria 748
67 Ga0068860_102412965 3300005843 Bacteria 546
68 Ga0081538_10007987 3300005981 Bacteria 9052
69 Ga0070717_10007642 3300006028 Bacteria 8037
70 Ga0070717_10620124 3300006028 Bacteria 981
71 Ga0075432_10409566 3300006058 Bacteria 587
72 Ga0075366_10627706 3300006195 Bacteria 666
73 Ga0097621_102122611 3300006237 Unclassified 537
74 Ga0075370_10887080 3300006353 Bacteria 545
75 Ga0068871_100730054 3300006358 Bacteria 909
76 Ga0075428_102674247 3300006844 Bacteria 509
77 Ga0075429_101665879 3300006880 Bacteria 554
78 Ga0097620_100957865 3300006931 Bacteria 939
79 Ga0105240_10000371 3300009093 Bacteria 84390
80 Ga0105240_10034096 3300009093 Bacteria 6569
81 Ga0105240_10049620 3300009093 Bacteria 5296
82 Ga0105240_10119962 3300009093 Bacteria 3167
83 Ga0105240_10341813 3300009093 Bacteria 1700
84 Ga0105240_10679073 3300009093 Bacteria 1126
85 Ga0105240_10940305 3300009093 Bacteria 928
86 Ga0105240_11048626 3300009093 Bacteria 870
87 Ga0111539_10040321 3300009094 Bacteria 5623
88 Ga0111539_10691991 3300009094 Bacteria 1187
89 Ga0111539_12268557 3300009094 Bacteria 630
90 Ga0111539_12771589 3300009094 Bacteria 568
91 Ga0111539_13320785 3300009094 Bacteria 518
92 Ga0105245_10353440 3300009098 Bacteria 1457
93 Ga0105245_10538330 3300009098 Bacteria 1189
94 Ga0105245_10854344 3300009098 Bacteria 950
95 Ga0105245_11155978 3300009098 Bacteria 821
96 Ga0105247_11828895 3300009101 Bacteria 506
97 Ga0105243_10031785 3300009148 Bacteria 4072
98 Ga0105243_10251589 3300009148 Bacteria 1578
99 Ga0105243_10436704 3300009148 Unclassified 1225
100 Ga0105243_10715741 3300009148 Bacteria 978
101 Ga0105241_10005441 3300009174 Bacteria 9415
102 Ga0105241_10108183 3300009174 Bacteria 2222
103 Ga0105241_10381737 3300009174 Bacteria 1231
104 Ga0105241_11481537 3300009174 Bacteria 652
105 Ga0105241_11582084 3300009174 Bacteria 633
106 Ga0105242_10376172 3300009176 Bacteria 1319
107 Ga0105242_10705736 3300009176 Bacteria 987
108 Ga0105242_10796193 3300009176 Bacteria 935
109 Ga0105242_12962106 3300009176 Bacteria 525
110 Ga0105248_11092724 3300009177 Bacteria 901
111 Ga0105237_10001504 3300009545 Bacteria 30678
112 Ga0105237_10003766 3300009545 Bacteria 17851
113 Ga0105237_10004069 3300009545 Bacteria 17053
114 Ga0105237_10118880 3300009545 Bacteria 2637
115 Ga0105237_10210997 3300009545 Bacteria 1942
116 Ga0105237_10235980 3300009545 Bacteria 1830
117 Ga0105237_10263276 3300009545 Bacteria 1727
118 Ga0105237_10756786 3300009545 Bacteria 978
119 Ga0105237_10821638 3300009545 Bacteria 936
120 Ga0105237_11558907 3300009545 Bacteria 667
121 Ga0105238_10065037 3300009551 Bacteria 3648
122 Ga0105238_10438080 3300009551 Bacteria 1303
123 Ga0105249_10530414 3300009553 Bacteria 1226
124 Ga0105249_12253126 3300009553 Bacteria 617
125 Ga0105249_13534169 3300009553 Unclassified 503
126 Ga0105239_10000166 3300010375 Bacteria 94743
127 Ga0105239_10002482 3300010375 Bacteria 23507
128 Ga0105239_10005013 3300010375 Bacteria 15635
129 Ga0105239_10007388 3300010375 Bacteria 12612
130 Ga0105239_10012823 3300010375 Bacteria 9325
131 Ga0105239_10049873 3300010375 Bacteria 4591
132 Ga0105239_10286073 3300010375 Bacteria 1856
133 Ga0105239_10378697 3300010375 Bacteria 1600
134 Ga0105239_10670924 3300010375 Bacteria 1184
135 Ga0105239_10700831 3300010375 Bacteria 1158
136 Ga0105246_10057443 3300011119 Bacteria 2692
137 Ga0105246_10070987 3300011119 Bacteria 2451
138 Ga0105246_10176359 3300011119 Bacteria 1641
139 Ga0157371_11423677 3300013102 Bacteria 539
140 Ga0157370_11132328 3300013104 Unclassified 707
141 Ga0157369_10261802 3300013105 Bacteria 1804
142 Ga0157374_10200054 3300013296 Bacteria 1956
143 Ga0157374_10605861 3300013296 Bacteria 1105
144 Ga0157374_12240951 3300013296 Unclassified 573
145 Ga0157378_10041128 3300013297 Bacteria 4099
146 Ga0163162_10000012 3300013306 Bacteria 292674
147 Ga0163162_10003815 3300013306 Bacteria 14452
148 Ga0163162_10718409 3300013306 Bacteria 1120
149 Ga0163162_10853267 3300013306 Bacteria 1026
150 Ga0163162_11075336 3300013306 Bacteria 911
151 Ga0163162_11122433 3300013306 Bacteria 891
152 Ga0157372_10002381 3300013307 Bacteria 20343
153 Ga0157372_10019173 3300013307 Bacteria 7366
154 Ga0157372_10450905 3300013307 Bacteria 1499
155 Ga0157372_11764410 3300013307 Bacteria 712
156 Ga0157375_10017179 3300013308 Bacteria 6523
157 Ga0157375_10494031 3300013308 Bacteria 1388
158 Ga0157380_10100530 3300014326 Bacteria 2408
159 Ga0157380_10713441 3300014326 Bacteria 1009
160 Ga0182008_10173368 3300014497 Bacteria 1090
161 Ga0157377_10223950 3300014745 Bacteria 1206
162 Ga0157377_10499280 3300014745 Bacteria 850
163 Ga0157376_11488373 3300014969 Bacteria 710
164 Ga0182006_1004122 3300015261 Bacteria 7224
165 Ga0182007_10233012 3300015262 Bacteria 655
166 Ga0163161_10041158 3300017792 Bacteria 3320
167 Ga0209437_100102 3300025233 Bacteria 224216
168 Ga0209026_1001683 3300025250 Bacteria 9293
169 Ga0209233_1010459 3300025261 Bacteria 2779
170 Ga0209676_1000039 3300025292 Bacteria 443158
171 Ga0209050_1000033 3300025298 Bacteria 442615
172 Ga0207688_10344107 3300025901 Bacteria 918
173 Ga0207647_10387074 3300025904 Bacteria 789
174 Ga0207705_10000026 3300025909 Bacteria 256051
175 Ga0207705_10368822 3300025909 Unclassified 1108
176 Ga0207654_10021427 3300025911 Bacteria 3437
177 Ga0207654_10142301 3300025911 Bacteria 1531
178 Ga0207695_10000142 3300025913 Bacteria 214715
179 Ga0207695_10249910 3300025913 Bacteria 1673
180 Ga0207671_10000110 3300025914 Bacteria 126480
181 Ga0207671_10001959 3300025914 Bacteria 22712
182 Ga0207671_10002617 3300025914 Bacteria 18990
183 Ga0207671_10085711 3300025914 Bacteria 2367
184 Ga0207671_10183637 3300025914 Bacteria 1629
185 Ga0207662_10491782 3300025918 Bacteria 844
186 Ga0207657_10063201 3300025919 Bacteria 3166
187 Ga0207657_10122806 3300025919 Bacteria 2136
188 Ga0207657_10294900 3300025919 Bacteria 1285
189 Ga0207694_10140956 3300025924 Bacteria 1938
190 Ga0207687_10607512 3300025927 Bacteria 922
191 Ga0207687_11150927 3300025927 Bacteria 667
192 Ga0207700_10236422 3300025928 Bacteria 1556
193 Ga0207690_10534263 3300025932 Bacteria 952
194 Ga0207706_11105689 3300025933 Unclassified 662
195 Ga0207709_10056906 3300025935 Bacteria 2422
196 Ga0207709_10387328 3300025935 Bacteria 1065
197 Ga0207709_10530999 3300025935 Bacteria 922
198 Ga0207704_10037451 3300025938 Bacteria 2802
199 Ga0207704_10077246 3300025938 Bacteria 2137
200 Ga0207691_10202582 3300025940 Bacteria 1727
201 Ga0207691_10765441 3300025940 Bacteria 812
202 Ga0207689_10498301 3300025942 Bacteria 1020
203 Ga0207661_10293643 3300025944 Bacteria 1455
204 Ga0207661_10954976 3300025944 Bacteria 790
205 Ga0207661_12034555 3300025944 Bacteria 520
206 Ga0207679_10053196 3300025945 Bacteria 2974
207 Ga0207679_10719705 3300025945 Bacteria 907
208 Ga0207667_10000015 3300025949 Bacteria 417534
209 Ga0207667_10899336 3300025949 Unclassified 877
210 Ga0207712_10556706 3300025961 Bacteria 987
211 Ga0207712_10589788 3300025961 Bacteria 960
212 Ga0207640_10045230 3300025981 Bacteria 2826
213 Ga0207640_10072563 3300025981 Bacteria 2323
214 Ga0207640_10598190 3300025981 Bacteria 933
215 Ga0207677_10550205 3300026023 Bacteria 1006
216 Ga0207703_10071236 3300026035 Bacteria 2871
217 Ga0207703_12386953 3300026035 Bacteria 504
218 Ga0207639_10028850 3300026041 Bacteria 4056
219 Ga0207639_10343817 3300026041 Bacteria 1331
220 Ga0207678_10149173 3300026067 Bacteria 1996
221 Ga0207678_11165863 3300026067 Bacteria 682
222 Ga0207702_10121226 3300026078 Bacteria 2341
223 Ga0207702_10194341 3300026078 Bacteria 1877
224 Ga0207702_10232950 3300026078 Bacteria 1722
225 Ga0207702_10563134 3300026078 Bacteria 1115
226 Ga0207641_10856550 3300026088 Bacteria 901
227 Ga0207641_11983743 3300026088 Unclassified 583
228 Ga0207648_10121184 3300026089 Bacteria 2300
229 Ga0207648_11892690 3300026089 Bacteria 558
230 Ga0207676_10232590 3300026095 Bacteria 1649
231 Ga0207676_10384620 3300026095 Bacteria 1307
232 Ga0207676_10850597 3300026095 Bacteria 892
233 Ga0207675_100085427 3300026118 Bacteria 2961
234 Ga0207675_101908818 3300026118 Unclassified 612
235 Ga0207683_10249549 3300026121 Bacteria 1620
236 Ga0207698_10256277 3300026142 Bacteria 1604
237 Ga0207698_10605653 3300026142 Bacteria 1080
238 Ga0268266_10569290 3300028379 Bacteria 1087
239 Ga0268265_10186446 3300028380 Bacteria 1788
240 Ga0268265_11114329 3300028380 Bacteria 784
241 Ga0268264_10649968 3300028381 Bacteria 1043
242 Ga0268264_12066430 3300028381 Bacteria 578
243 Ga0307517_10000198 3300028786 Bacteria 102181
244 Ga0265327_10017213 3300031251 Bacteria 4546
245 Ga0265327_10310752 3300031251 Bacteria 693
246 Ga0307513_10252515 3300031456 Unclassified 1559
247 Ga0307513_10268969 3300031456 Bacteria 1489
248 Ga0307513_10490047 3300031456 Bacteria 948
249 Ga0307509_10756872 3300031507 Bacteria 637
250 Ga0307405_10296514 3300031731 Unclassified 1224
251 Ga0307405_10362051 3300031731 Unclassified 1123
252 Ga0307410_10484784 3300031852 Unclassified 1015
253 Ga0307410_10509069 3300031852 Bacteria 992
254 Ga0307410_10900518 3300031852 Bacteria 758
255 Ga0307407_10176329 3300031903 Bacteria 1413
256 Ga0307412_10040858 3300031911 Bacteria 3003
257 Ga0307409_100203803 3300031995 Bacteria 1772
258 Ga0307409_100603223 3300031995 Bacteria 1085
259 Ga0307409_101309657 3300031995 Bacteria 750
260 Ga0307416_100013654 3300032002 Bacteria 5530
261 Ga0307416_100055774 3300032002 Bacteria 3185
262 Ga0307416_101101742 3300032002 Bacteria 899
263 Ga0307414_10000038 3300032004 Bacteria 150774
264 Ga0307414_10035361 3300032004 Bacteria 3324
265 Ga0307414_10456375 3300032004 Bacteria 1122
266 Ga0307414_10791393 3300032004 Bacteria 864
267 Ga0307415_100705099 3300032126 Bacteria 911
268 Ga0307507_10000099 3300033179 Bacteria 139532
269 Ga0373941_0031149 3300035115 Bacteria 1587
270 Ga0395899_0000027 3300037312 Bacteria 337387
271 Ga0395900_0037503 3300037418 Bacteria 4997
272 Ga0395900_1541522 3300037418 Bacteria 576
273 Ga0395898_0058817 3300037466 Bacteria 3741
274 Ga0395898_0864013 3300037466 Bacteria 843
275 Ga0395905_0543058 3300037471 Bacteria 1063
276 Ga0395905_0915244 3300037471 Bacteria 780
277 Ga0395901_0029838 3300038443 Bacteria 5616
278 Ga0395901_0211760 3300038443 Bacteria 2028
279 Ga0451841_0922579 3300041498 Bacteria 604
280 Ga0451847_0220163 3300041503 Bacteria 739
281 Ga0451843_1468681 3300041509 Bacteria 2044
282 Ga0451843_1534648 3300041509 Unclassified 542
283 Ga0451853_1610037 3300041512 Bacteria 644
284 Ga0451577_0113832 3300042876 Bacteria 2421
285 Ga0466965_0517538 3300044683 Bacteria 671
286 Ga0466965_0549157 3300044683 Bacteria 652
287 Ga0466961_0318547 3300044693 Bacteria 949
288 Ga0466961_0642301 3300044693 Unclassified 637
289 Ga0466963_0103130 3300044694 Bacteria 1954
290 Ga0466964_0221197 3300044706 Bacteria 920
291 Ga0466971_0025381 3300044719 Bacteria 2646
292 Ga0466957_1316980 3300044842 Bacteria 524
293 Ga0466960_0119262 3300044901 Bacteria 1380
294 Ga0466960_0126548 3300044901 Bacteria 1343
295 Ga0466960_0436547 3300044901 Bacteria 759
296 Ga0466959_0257704 3300045049 Bacteria 1201
297 Ga0466959_0414566 3300045049 Bacteria 915
298 Ga0451576_0880401 3300045051 Bacteria 940
299 Ga0466958_0370046 3300045836 Bacteria 923
300 Ga0466967_0007821 3300045976 Bacteria 7766
301 Ga0466967_0112822 3300045976 Bacteria 2499
302 Ga0466967_0177346 3300045976 Bacteria 2008
303 Ga0466967_0261185 3300045976 Bacteria 1657
304 Ga0466967_0517237 3300045976 Bacteria 1172
305 Ga0466967_0611564 3300045976 Bacteria 1076
306 Ga0466967_1233329 3300045976 Bacteria 745
307 Ga0495592_0725304 3300046454 Bacteria 596
308 Ga0495638_0638329 3300046460 Bacteria 519
309 Ga0495651_0383371 3300046462 Bacteria 921
310 Ga0495653_0983362 3300046463 Bacteria 500
311 Ga0495650_0217394 3300046471 Bacteria 659
312 Ga0495605_0046383 3300046474 Bacteria 2137
313 Ga0495585_0001133 3300046492 Bacteria 21876
314 Ga0495596_0008716 3300046500 Bacteria 4493
315 Ga0495596_0207638 3300046500 Bacteria 761
316 Ga0495583_0318777 3300046506 Bacteria 616
317 Ga0495606_0011937 3300046507 Bacteria 7023
318 Ga0495606_0507229 3300046507 Bacteria 608
319 Ga0495616_0011492 3300046513 Bacteria 5068
320 Ga0495618_0380025 3300046514 Bacteria 867
321 Ga0495631_0002688 3300046518 Bacteria 9884
322 Ga0495631_0359870 3300046518 Bacteria 619
323 Ga0495632_0095809 3300046519 Bacteria 1402
324 Ga0495637_0238031 3300046520 Bacteria 658
325 Ga0495644_0012379 3300046523 Bacteria 3280
326 Ga0495648_0005749 3300046524 Bacteria 10233
327 Ga0495652_0087230 3300046529 Bacteria 2560
328 Ga0495652_0393396 3300046529 Bacteria 983
329 Ga0495652_0546543 3300046529 Bacteria 797
330 Ga0495652_0631270 3300046529 Unclassified 727
331 Ga0495587_0545107 3300046536 Bacteria 640
332 Ga0495609_0002226 3300046538 Bacteria 12129
333 Ga0495622_0073739 3300046557 Bacteria 1574
334 Ga0495633_0129639 3300046558 Bacteria 1167
335 Ga0495656_0341452 3300046615 Bacteria 774
336 Ga0495668_0000041 3300046616 Bacteria 229462
337 Ga0495668_0344383 3300046616 Bacteria 818
338 Ga0495625_0001074 3300046660 Bacteria 35469
339 Ga0495625_0006807 3300046660 Bacteria 10099
340 Ga0495625_0019812 3300046660 Bacteria 5206
341 Ga0495625_0052810 3300046660 Bacteria 2909
342 Ga0495625_0070086 3300046660 Bacteria 2462
343 Ga0495625_0685147 3300046660 Bacteria 607
344 Ga0495661_0003969 3300046665 Bacteria 10802
345 Ga0495661_0019791 3300046665 Bacteria 4405
346 Ga0495658_0056278 3300046683 Bacteria 2242
347 Ga0495669_0289710 3300046684 Unclassified 788
348 Ga0495671_0047709 3300046692 Bacteria 2139
349 Ga0495649_0041674 3300046694 Bacteria 2510
350 Ga0495600_0528280 3300046809 Bacteria 723
351 Ga0495660_0128470 3300046810 Bacteria 1274
352 Ga0495672_0008998 3300047320 Bacteria 7285
353 Ga0495672_0039394 3300047320 Bacteria 2873
354 Ga0495683_0018196 3300047323 Bacteria 3634
355 Ga0495687_067582 3300047443 Bacteria 1446
356 Ga0495686_0112543 3300047472 Bacteria 1630
357 Ga0495686_0255679 3300047472 Bacteria 983
358 Ga0496101_0075230 3300048904 Bacteria 2485
359 Ga0496101_1600005 3300048904 Bacteria 506
360 Ga0496102_0345902 3300048905 Bacteria 1400
361 Ga0496103_0325389 3300048906 Bacteria 989
362 Ga0496104_0416704 3300048907 Bacteria 1255
363 Ga0496105_0121067 3300048908 Bacteria 2158
364 Ga0496105_0876295 3300048908 Bacteria 678
365 Ga0496106_0347191 3300048909 Bacteria 1192
366 Ga0496106_0590779 3300048909 Bacteria 890
367 Ga0496107_0441266 3300048910 Bacteria 967
368 Ga0496108_0015382 3300048911 Bacteria 6241
369 Ga0496108_0624367 3300048911 Bacteria 938
370 Ga0496109_0003673 3300048912 Bacteria 12817
371 Ga0496109_0334785 3300048912 Bacteria 1429
372 Ga0496109_0474510 3300048912 Bacteria 1181
373 Ga0496109_0936162 3300048912 Bacteria 804
374 Ga0496110_0882989 3300048913 Bacteria 800
375 Ga0496110_0943829 3300048913 Bacteria 769
376 Ga0496111_1034470 3300048914 Bacteria 587
377 Ga0496112_0036639 3300048915 Bacteria 4786
378 Ga0496112_0104974 3300048915 Bacteria 2795
379 Ga0496112_0364492 3300048915 Bacteria 1387
380 Ga0496112_1232281 3300048915 Bacteria 665
381 Ga0496113_1457267 3300048916 Bacteria 529
382 Ga0496114_1257973 3300048917 Bacteria 627
383 Ga0496115_0812891 3300048918 Bacteria 727
384 Ga0496126_1148015 3300048929 Unclassified 574
385 Ga0495678_001603 3300049459 Bacteria 17329
386 Ga0495682_0015405 3300049460 Bacteria 2897
387 Ga0501031_0037522 3300049568 Bacteria 3162
388 Ga0501032_0023231 3300049569 Bacteria 4290
389 Ga0501033_0343019 3300049570 Bacteria 1047
390 Ga0501034_0498491 3300049571 Bacteria 1131
391 Ga0501036_0115330 3300049572 Bacteria 2269
392 Ga0501037_0039477 3300049573 Bacteria 3475
393 Ga0501038_0041922 3300049574 Bacteria 3989
394 Ga0501039_0054866 3300049575 Bacteria 3085
395 Ga0501039_0567240 3300049575 Bacteria 890
396 Ga0501042_0014391 3300049578 Bacteria 5400
397 Ga0501042_0767315 3300049578 Bacteria 701
398 Ga0501043_0069426 3300049579 Bacteria 2767
399 Ga0501046_0004061 3300049580 Bacteria 13356
400 Ga0501047_0008279 3300049581 Bacteria 9816
401 Ga0501047_0107784 3300049581 Bacteria 2667
402 Ga0501067_0062110 3300049583 Bacteria 2068
403 Ga0501068_0106313 3300049584 Bacteria 1742
404 Ga0501069_0094140 3300049585 Bacteria 1695
405 Ga0501069_0476171 3300049585 Bacteria 744
406 Ga0501069_0964563 3300049585 Bacteria 520
407 Ga0501070_1032322 3300049586 Bacteria 636
408 Ga0501071_0370900 3300049587 Bacteria 1091
409 Ga0501072_0422662 3300049588 Bacteria 1056
410 Ga0501073_0009643 3300049589 Bacteria 7118
411 Ga0501076_0982372 3300049592 Bacteria 696
412 Ga0501206_081164 3300049653 Unclassified 563
413 Ga0501261_108001 3300049690 Unclassified 537
414 Ga0501245_123304 3300049708 Unclassified 548
415 Ga0501079_0101435 3300049741 Bacteria 2232
416 Ga0501080_0173989 3300049742 Bacteria 1984
417 Ga0501080_0668538 3300049742 Bacteria 918
418 Ga0501083_0477410 3300049744 Bacteria 811
419 Ga0501035_0222156 3300049822 Bacteria 1612
420 Ga0501044_0110443 3300049823 Bacteria 2758
421 Ga0501044_0549143 3300049823 Bacteria 1052
422 nmdc:mga07m45_490060_c1 3300050496 Bacteria 712
423 nmdc:mga08y16_175081_c1 3300050511 Bacteria 2228
424 nmdc:mga0n895_1346668_c1 3300050512 Bacteria 683
425 Ga0500644_0543936 3300053088 Bacteria 512
426 Ga0500646_0109204 3300053090 Bacteria 878
427 Ga0500608_000955 3300053122 Bacteria 10346
428 Ga0500614_016581 3300053123 Bacteria 1655
429 Ga0500618_000016 3300053125 Bacteria 164049
430 Ga0500642_0050288 3300053130 Unclassified 1837
431 Ga0500652_090688 3300053131 Bacteria 1276
432 Ga0500616_0102816 3300053153 Bacteria 1393
433 Ga0500616_0207438 3300053153 Bacteria 864
434 Ga0500634_0152876 3300053161 Bacteria 1076
435 Ga0501084_0261461 3300054114 Bacteria 1461
436 Ga0466962_0010802 3300061719 Bacteria 4390
437 Ga0466962_0588416 3300061719 Bacteria 567
438 Ga0068854_100095639
439 JGI24737J22298_10000060
440 JGI24735J21928_10000032
441 JGI25162J39368_1000162
442 rootH2_10196396
443 rootH2_10279884
444 rootH1_10363186
445 Ga0065714_10070570
446 Ga0070658_10000008
447 Ga0070658_10037412
448 Ga0070683_100090808
449 Ga0070682_100275062
450 Ga0068868_100089075
451 Ga0070660_100019093
452 Ga0070660_100201347
453 Ga0070660_100279903
454 Ga0070687_100229355
455 Ga0070687_101109790
456 Ga0070661_100483911
457 Ga0070661_100886634
458 Ga0070674_100457586
459 Ga0070674_100933130
460 Ga0070659_100233610
461 Ga0070659_101704376
462 Ga0070714_100344775
463 Ga0070713_100049378
464 Ga0070701_10096983
465 Ga0070700_100449010
466 Ga0070663_100740030
467 Ga0070663_101497651
468 Ga0070678_100286906
469 Ga0068867_100098737
470 Ga0070685_10650146
471 Ga0070699_101322248
472 Ga0070684_100085484
473 Ga0070684_101433782
474 Ga0068853_100090658
475 Ga0070672_100501486
476 Ga0070672_100777039
477 Ga0070686_100090555
478 Ga0070686_100347352
479 Ga0070695_100705265
480 Ga0070665_101066110
481 Ga0068855_100000049
482 Ga0068855_100011610
483 Ga0068855_100074713
484 Ga0068855_101051456
485 Ga0070664_100290945
486 Ga0070664_100571837
487 Ga0068857_100156202
488 Ga0068854_100499830
489 Ga0068854_101048888
490 Ga0068856_100204729
491 Ga0068856_100281093
492 Ga0068856_100451157
493 Ga0070702_100225103
494 Ga0068852_100434065
495 Ga0068852_100549887
496 Ga0068859_100957857
497 Ga0068864_100325420
498 Ga0068864_100336772
499 Ga0068864_100424633
500 Ga0068861_100208153
501 Ga0068858_100227334
502 Ga0068858_101111015
503 Ga0068860_101298263
504 Ga0068860_102412965
505 Ga0081538_10007987
506 Ga0070717_10007642
507 Ga0070717_10620124
508 Ga0075432_10409566
509 Ga0075366_10627706
510 Ga0097621_102122611
511 Ga0075370_10887080
512 Ga0068871_100730054
513 Ga0075428_102674247
514 Ga0075429_101665879
515 Ga0097620_100957865
516 Ga0105240_10000371
517 Ga0105240_10034096
518 Ga0105240_10049620
519 Ga0105240_10119962
520 Ga0105240_10341813
521 Ga0105240_10679073
522 Ga0105240_10940305
523 Ga0105240_11048626
524 Ga0111539_10040321
525 Ga0111539_10691991
526 Ga0111539_12268557
527 Ga0111539_12771589
528 Ga0111539_13320785
529 Ga0105245_10353440
530 Ga0105245_10538330
531 Ga0105245_10854344
532 Ga0105245_11155978
533 Ga0105247_11828895
534 Ga0105243_10031785
535 Ga0105243_10251589
536 Ga0105243_10436704
537 Ga0105243_10715741
538 Ga0105241_10005441
539 Ga0105241_10108183
540 Ga0105241_10381737
541 Ga0105241_11481537
542 Ga0105241_11582084
543 Ga0105242_10376172
544 Ga0105242_10705736
545 Ga0105242_10796193
546 Ga0105242_12962106
547 Ga0105248_11092724
548 Ga0105237_10001504
549 Ga0105237_10003766
550 Ga0105237_10004069
551 Ga0105237_10118880
552 Ga0105237_10210997
553 Ga0105237_10235980
554 Ga0105237_10263276
555 Ga0105237_10756786
556 Ga0105237_10821638
557 Ga0105237_11558907
558 Ga0105238_10065037
559 Ga0105238_10438080
560 Ga0105249_10530414
561 Ga0105249_12253126
562 Ga0105249_13534169
563 Ga0105239_10000166
564 Ga0105239_10002482
565 Ga0105239_10005013
566 Ga0105239_10007388
567 Ga0105239_10012823
568 Ga0105239_10049873
569 Ga0105239_10286073
570 Ga0105239_10378697
571 Ga0105239_10670924
572 Ga0105239_10700831
573 Ga0105246_10057443
574 Ga0105246_10070987
575 Ga0105246_10176359
576 Ga0157371_11423677
577 Ga0157370_11132328
578 Ga0157369_10261802
579 Ga0157374_10200054
580 Ga0157374_10605861
581 Ga0157374_12240951
582 Ga0157378_10041128
583 Ga0163162_10000012
584 Ga0163162_10003815
585 Ga0163162_10718409
586 Ga0163162_10853267
587 Ga0163162_11075336
588 Ga0163162_11122433
589 Ga0157372_10002381
590 Ga0157372_10019173
591 Ga0157372_10450905
592 Ga0157372_11764410
593 Ga0157375_10017179
594 Ga0157375_10494031
595 Ga0157380_10100530
596 Ga0157380_10713441
597 Ga0182008_10173368
598 Ga0157377_10223950
599 Ga0157377_10499280
600 Ga0157376_11488373
601 Ga0182006_1004122
602 Ga0182007_10233012
603 Ga0163161_10041158
604 Ga0209437_100102
605 Ga0209026_1001683
606 Ga0209233_1010459
607 Ga0209676_1000039
608 Ga0209050_1000033
609 Ga0207688_10344107
610 Ga0207647_10387074
611 Ga0207705_10000026
612 Ga0207705_10368822
613 Ga0207654_10021427
614 Ga0207654_10142301
615 Ga0207695_10000142
616 Ga0207695_10249910
617 Ga0207671_10000110
618 Ga0207671_10001959
619 Ga0207671_10002617
620 Ga0207671_10085711
621 Ga0207671_10183637
622 Ga0207662_10491782
623 Ga0207657_10063201
624 Ga0207657_10122806
625 Ga0207657_10294900
626 Ga0207694_10140956
627 Ga0207687_10607512
628 Ga0207687_11150927
629 Ga0207700_10236422
630 Ga0207690_10534263
631 Ga0207706_11105689
632 Ga0207709_10056906
633 Ga0207709_10387328
634 Ga0207709_10530999
635 Ga0207704_10037451
636 Ga0207704_10077246
637 Ga0207691_10202582
638 Ga0207691_10765441
639 Ga0207689_10498301
640 Ga0207661_10293643
641 Ga0207661_10954976
642 Ga0207661_12034555
643 Ga0207679_10053196
644 Ga0207679_10719705
645 Ga0207667_10000015
646 Ga0207667_10899336
647 Ga0207712_10556706
648 Ga0207712_10589788
649 Ga0207640_10045230
650 Ga0207640_10072563
651 Ga0207640_10598190
652 Ga0207677_10550205
653 Ga0207703_10071236
654 Ga0207703_12386953
655 Ga0207639_10028850
656 Ga0207639_10343817
657 Ga0207678_10149173
658 Ga0207678_11165863
659 Ga0207702_10121226
660 Ga0207702_10194341
661 Ga0207702_10232950
662 Ga0207702_10563134
663 Ga0207641_10856550
664 Ga0207641_11983743
665 Ga0207648_10121184
666 Ga0207648_11892690
667 Ga0207676_10232590
668 Ga0207676_10384620
669 Ga0207676_10850597
670 Ga0207675_100085427
671 Ga0207675_101908818
672 Ga0207683_10249549
673 Ga0207698_10256277
674 Ga0207698_10605653
675 Ga0268266_10569290
676 Ga0268265_10186446
677 Ga0268265_11114329
678 Ga0268264_10649968
679 Ga0268264_12066430
680 Ga0307517_10000198
681 Ga0265327_10017213
682 Ga0265327_10310752
683 Ga0307513_10252515
684 Ga0307513_10268969
685 Ga0307513_10490047
686 Ga0307509_10756872
687 Ga0307405_10296514
688 Ga0307405_10362051
689 Ga0307410_10484784
690 Ga0307410_10509069
691 Ga0307410_10900518
692 Ga0307407_10176329
693 Ga0307412_10040858
694 Ga0307409_100203803
695 Ga0307409_100603223
696 Ga0307409_101309657
697 Ga0307416_100013654
698 Ga0307416_100055774
699 Ga0307416_101101742
700 Ga0307414_10000038
701 Ga0307414_10035361
702 Ga0307414_10456375
703 Ga0307414_10791393
704 Ga0307415_100705099
705 Ga0307507_10000099
706 Ga0373941_0031149
707 Ga0395899_0000027
708 Ga0395900_0037503
709 Ga0395900_1541522
710 Ga0395898_0058817
711 Ga0395898_0864013
712 Ga0395905_0543058
713 Ga0395905_0915244
714 Ga0395901_0029838
715 Ga0395901_0211760
716 Ga0451841_0922579
717 Ga0451847_0220163
718 Ga0451843_1468681
719 Ga0451843_1534648
720 Ga0451853_1610037
721 Ga0451577_0113832
722 Ga0466965_0517538
723 Ga0466965_0549157
724 Ga0466961_0318547
725 Ga0466961_0642301
726 Ga0466963_0103130
727 Ga0466964_0221197
728 Ga0466971_0025381
729 Ga0466957_1316980
730 Ga0466960_0119262
731 Ga0466960_0126548
732 Ga0466960_0436547
733 Ga0466959_0257704
734 Ga0466959_0414566
735 Ga0451576_0880401
736 Ga0466958_0370046
737 Ga0466967_0007821
738 Ga0466967_0112822
739 Ga0466967_0177346
740 Ga0466967_0261185
741 Ga0466967_0517237
742 Ga0466967_0611564
743 Ga0466967_1233329
744 Ga0495592_0725304
745 Ga0495638_0638329
746 Ga0495651_0383371
747 Ga0495653_0983362
748 Ga0495650_0217394
749 Ga0495605_0046383
750 Ga0495585_0001133
751 Ga0495596_0008716
752 Ga0495596_0207638
753 Ga0495583_0318777
754 Ga0495606_0011937
755 Ga0495606_0507229
756 Ga0495616_0011492
757 Ga0495618_0380025
758 Ga0495631_0002688
759 Ga0495631_0359870
760 Ga0495632_0095809
761 Ga0495637_0238031
762 Ga0495644_0012379
763 Ga0495648_0005749
764 Ga0495652_0087230
765 Ga0495652_0393396
766 Ga0495652_0546543
767 Ga0495652_0631270
768 Ga0495587_0545107
769 Ga0495609_0002226
770 Ga0495622_0073739
771 Ga0495633_0129639
772 Ga0495656_0341452
773 Ga0495668_0000041
774 Ga0495668_0344383
775 Ga0495625_0001074
776 Ga0495625_0006807
777 Ga0495625_0019812
778 Ga0495625_0052810
779 Ga0495625_0070086
780 Ga0495625_0685147
781 Ga0495661_0003969
782 Ga0495661_0019791
783 Ga0495658_0056278
784 Ga0495669_0289710
785 Ga0495671_0047709
786 Ga0495649_0041674
787 Ga0495600_0528280
788 Ga0495660_0128470
789 Ga0495672_0008998
790 Ga0495672_0039394
791 Ga0495683_0018196
792 Ga0495687_067582
793 Ga0495686_0112543
794 Ga0495686_0255679
795 Ga0496101_0075230
796 Ga0496101_1600005
797 Ga0496102_0345902
798 Ga0496103_0325389
799 Ga0496104_0416704
800 Ga0496105_0121067
801 Ga0496105_0876295
802 Ga0496106_0347191
803 Ga0496106_0590779
804 Ga0496107_0441266
805 Ga0496108_0015382
806 Ga0496108_0624367
807 Ga0496109_0003673
808 Ga0496109_0334785
809 Ga0496109_0474510
810 Ga0496109_0936162
811 Ga0496110_0882989
812 Ga0496110_0943829
813 Ga0496111_1034470
814 Ga0496112_0036639
815 Ga0496112_0104974
816 Ga0496112_0364492
817 Ga0496112_1232281
818 Ga0496113_1457267
819 Ga0496114_1257973
820 Ga0496115_0812891
821 Ga0496126_1148015
822 Ga0495678_001603
823 Ga0495682_0015405
824 Ga0501031_0037522
825 Ga0501032_0023231
826 Ga0501033_0343019
827 Ga0501034_0498491
828 Ga0501036_0115330
829 Ga0501037_0039477
830 Ga0501038_0041922
831 Ga0501039_0054866
832 Ga0501039_0567240
833 Ga0501042_0014391
834 Ga0501042_0767315
835 Ga0501043_0069426
836 Ga0501046_0004061
837 Ga0501047_0008279
838 Ga0501047_0107784
839 Ga0501067_0062110
840 Ga0501068_0106313
841 Ga0501069_0094140
842 Ga0501069_0476171
843 Ga0501069_0964563
844 Ga0501070_1032322
845 Ga0501071_0370900
846 Ga0501072_0422662
847 Ga0501073_0009643
848 Ga0501076_0982372
849 Ga0501206_081164
850 Ga0501261_108001
851 Ga0501245_123304
852 Ga0501079_0101435
853 Ga0501080_0173989
854 Ga0501080_0668538
855 Ga0501083_0477410
856 Ga0501035_0222156
857 Ga0501044_0110443
858 Ga0501044_0549143
859 nmdc:mga07m45_490060_c1
860 nmdc:mga08y16_175081_c1
861 nmdc:mga0n895_1346668_c1
862 Ga0500644_0543936
863 Ga0500646_0109204
864 Ga0500608_000955
865 Ga0500614_016581
866 Ga0500618_000016
867 Ga0500642_0050288
868 Ga0500652_090688
869 Ga0500616_0102816
870 Ga0500616_0207438
871 Ga0500634_0152876
872 Ga0501084_0261461
873 Ga0466962_0010802
874 Ga0466962_0588416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01253

SUI1

Translation initiation factor SUI1

58

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jb3-assembly1.cif.gz_1 cryo-em structure of a full archaeal ribosomal translation initiation complex in the p-remote conformation 0.8784 35 109
4mo0-assembly1.cif.gz_A crystal structure of aif1 from methanocaldococcus jannaschii 0.8571 34 109
1d1r-assembly1.cif.gz_A nmr solution structure of the product of the e. coli ycih gene. 0.8443 35 111
5zcy-assembly1.cif.gz_A crystal structure of archaeal translation initiation factor 1 at 1.5 angstroms resolution 0.8369 37 109
6ywe-assembly1.cif.gz_7 the structure of the mitoribosome from neurospora crassa in the p/e trna bound state 0.8359 39 104
ID Description Score Start End Superfamily
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.9723 36 111 3.30.780.10
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.9026 36 111 3.30.780.10
4mo0A00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8571 34 109 3.30.780.10
af_A0A1D8PCL3_418_494_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8503 36 107 3.30.780.10
1d1rA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8443 35 111 3.30.780.10
ID Description Score Start End GO Terms
AF-A0A381S1K9-F1-model_v4 SUI1 domain-containing protein 0.9801 28 111 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-W1F1T4-F1-model_v4 Translation initiation factor SUI1-related protein 0.9751 47 111 GO:0003743
AF-A0A257K1E2-F1-model_v4 Stress response translation initiation inhibitor YciH 0.9727 36 111 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A455U219-F1-model_v4 SUI1 domain-containing protein 0.9723 36 111 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A381WQ30-F1-model_v4 SUI1 domain-containing protein 0.9722 50 111 GO:0003743

Map