F443748

General Info

Members Datasets Scaffolds Average Seq Length
437 274 874 377

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10022091|Ga0105240_100220916
Length 423
Sequence MRLLLGVRAARRWRVRHPNASALECVSAEGLAAAKATQREDLIMLICQCNAIHRRDVVCGGGAALFSAIVATLMGGARPVRAETIPGKVPEIDRVAVRVVVDSYQFAVAPSRKVSDVEIEHFGWGIGGGKPPGKTLISEFGLSMHVESRRGTETRNVLMDFGFTPDALVNNANLVGIDSAALDALALSHGHYDHFGGLAGFLMQNNGKLKAKLPIYIGGEEAFCSREWTAPPVRGDFGALDRKALEDANVAVTYAEGPALIADHGFTTGHIGQTSFEKLLSPSAMKIGVDHGIGCYADKLPEDERTKAVIPDQFRHEIAIAFNVRGRGLIVLTSCSHRGVINAIKQAQAVSGIKKVHAVIGGFHLAPYKEDYVRDTITALKDIDIDYVIPLHCTGEPFYELAKAELPNKLLRSYTGTRFVFAA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
253 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
259 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
260 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
261 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
262 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
263 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
264 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
265 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
266 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
267 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
268 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
269 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
270 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
271 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
272 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
273 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
274 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 4.12
Rhizoplane 11.44
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 12.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10022091 3300009093 Bacteria 8444
2 JGI25153J46596_10000014 3300003215 Bacteria 298101
3 rootH1_10123329 3300003323 Unclassified 3879
4 JGI25404J52841_10008769 3300003659 Bacteria 2160
5 Ga0070683_100016262 3300005329 Bacteria 6558
6 Ga0070690_100000828 3300005330 Bacteria 15680
7 Ga0070670_100002211 3300005331 Bacteria 15990
8 Ga0068869_100028493 3300005334 Bacteria 3903
9 Ga0070666_10047522 3300005335 Unclassified 2881
10 Ga0070680_100035717 3300005336 Bacteria 4013
11 Ga0070680_100186115 3300005336 Bacteria 1749
12 Ga0070682_100091839 3300005337 Bacteria 1988
13 Ga0068868_100006575 3300005338 Bacteria 8237
14 Ga0070660_100001272 3300005339 Bacteria 17201
15 Ga0070689_100153760 3300005340 Bacteria 1857
16 Ga0070691_10000310 3300005341 Bacteria 17151
17 Ga0070687_100000658 3300005343 Bacteria 11493
18 Ga0070661_100001241 3300005344 Bacteria 17916
19 Ga0070692_10004720 3300005345 Bacteria 5713
20 Ga0070668_100000234 3300005347 Bacteria 36207
21 Ga0070675_100025691 3300005354 Bacteria 4722
22 Ga0070671_100004140 3300005355 Bacteria 11449
23 Ga0070674_100008136 3300005356 Bacteria 6221
24 Ga0070673_100000403 3300005364 Bacteria 22935
25 Ga0070688_100001474 3300005365 Bacteria 11695
26 Ga0070688_100046056 3300005365 Bacteria 2699
27 Ga0070659_100086304 3300005366 Unclassified 2511
28 Ga0070667_100003240 3300005367 Bacteria 13920
29 Ga0070667_100106625 3300005367 Bacteria 2425
30 Ga0070703_10011667 3300005406 Bacteria 2485
31 Ga0070709_10008539 3300005434 Bacteria 5629
32 Ga0070714_100023029 3300005435 Bacteria 5112
33 Ga0070714_100123293 3300005435 Unclassified 2307
34 Ga0070714_100301616 3300005435 Bacteria 1493
35 Ga0070713_100279829 3300005436 Unclassified 1530
36 Ga0070710_10022413 3300005437 Bacteria 3303
37 Ga0070710_10129562 3300005437 Bacteria 1536
38 Ga0070701_10005778 3300005438 Bacteria 5149
39 Ga0070711_100005856 3300005439 Bacteria 7377
40 Ga0070711_100124699 3300005439 Bacteria 1910
41 Ga0070705_100001109 3300005440 Bacteria 14913
42 Ga0070700_100005223 3300005441 Bacteria 6866
43 Ga0070694_100002601 3300005444 Bacteria 10665
44 Ga0070708_100116126 3300005445 Unclassified 2464
45 Ga0070663_100001201 3300005455 Bacteria 14259
46 Ga0070663_100017942 3300005455 Bacteria 4628
47 Ga0070678_100002064 3300005456 Bacteria 10888
48 Ga0070662_100003035 3300005457 Bacteria 10432
49 Ga0070681_10033670 3300005458 Bacteria 5144
50 Ga0070681_10034390 3300005458 Bacteria 5088
51 Ga0070681_10046536 3300005458 Bacteria 4337
52 Ga0070698_100067767 3300005471 Bacteria 3588
53 Ga0070698_100305406 3300005471 Bacteria 1522
54 Ga0070699_100268122 3300005518 Bacteria 1527
55 Ga0070679_100074927 3300005530 Bacteria 3374
56 Ga0070679_100215808 3300005530 Bacteria 1881
57 Ga0070684_100097529 3300005535 Bacteria 2621
58 Ga0070684_100165937 3300005535 Bacteria 2004
59 Ga0070697_100004351 3300005536 Bacteria 10862
60 Ga0068853_100002553 3300005539 Bacteria 13675
61 Ga0068853_100143871 3300005539 Bacteria 2142
62 Ga0070672_100179782 3300005543 Bacteria 1762
63 Ga0070695_100001397 3300005545 Bacteria 13379
64 Ga0070696_100012038 3300005546 Bacteria 5795
65 Ga0070704_100013450 3300005549 Bacteria 5080
66 Ga0070704_100019170 3300005549 Bacteria 4392
67 Ga0068855_100073351 3300005563 Bacteria 3977
68 Ga0068855_100176189 3300005563 Bacteria 2420
69 Ga0070664_100012455 3300005564 Bacteria 6913
70 Ga0068857_100001194 3300005577 Bacteria 20287
71 Ga0068854_100008240 3300005578 Bacteria 6692
72 Ga0068856_100002595 3300005614 Bacteria 18601
73 Ga0068856_100016421 3300005614 Bacteria 7162
74 Ga0070702_100003827 3300005615 Bacteria 6807
75 Ga0068852_100012153 3300005616 Bacteria 6522
76 Ga0068864_100017257 3300005618 Bacteria 6018
77 Ga0068861_100014165 3300005719 Bacteria 5592
78 Ga0068863_100001254 3300005841 Bacteria 25284
79 Ga0068858_100060663 3300005842 Unclassified 3495
80 Ga0068860_100008151 3300005843 Bacteria 10429
81 Ga0068860_100170142 3300005843 Bacteria 2104
82 Ga0068860_100199881 3300005843 Unclassified 1936
83 Ga0068862_100007020 3300005844 Bacteria 9353
84 Ga0081455_10002404 3300005937 Bacteria 22337
85 Ga0081455_10003716 3300005937 Bacteria 17461
86 Ga0081540_1002075 3300005983 Bacteria 16709
87 Ga0081540_1003438 3300005983 Bacteria 12501
88 Ga0075432_10007193 3300006058 Bacteria 3790
89 Ga0070715_10000165 3300006163 Bacteria 15402
90 Ga0070716_100078553 3300006173 Bacteria 1962
91 Ga0070712_100008927 3300006175 Bacteria 6312
92 Ga0070712_100030862 3300006175 Unclassified 3606
93 Ga0070712_100057519 3300006175 Bacteria 2732
94 Ga0070712_100211784 3300006175 Bacteria 1529
95 Ga0097621_100166000 3300006237 Bacteria 1901
96 Ga0097621_100195572 3300006237 Unclassified 1753
97 Ga0068871_100036229 3300006358 Bacteria 3927
98 Ga0068871_100037626 3300006358 Bacteria 3860
99 Ga0068871_100040274 3300006358 Bacteria 3742
100 Ga0075428_100161569 3300006844 Bacteria 2431
101 Ga0075428_100190954 3300006844 Bacteria 2215
102 Ga0075430_100020072 3300006846 Bacteria 5687
103 Ga0075430_100155228 3300006846 Bacteria 1906
104 Ga0075431_100075424 3300006847 Bacteria 3480
105 Ga0075431_100101143 3300006847 Unclassified 2974
106 Ga0075433_10165124 3300006852 Unclassified 1971
107 Ga0075434_100099434 3300006871 Bacteria 2914
108 Ga0075434_100193070 3300006871 Bacteria 2057
109 Ga0075429_100022838 3300006880 Bacteria 5425
110 Ga0075436_100005769 3300006914 Bacteria 8511
111 Ga0075436_100029397 3300006914 Unclassified 3779
112 Ga0099825_1022580 3300006941 Bacteria 4032
113 Ga0075435_100026141 3300007076 Bacteria 4551
114 Ga0105240_10017610 3300009093 Bacteria 9625
115 Ga0105240_10022737 3300009093 Bacteria 8306
116 Ga0105240_10034162 3300009093 Bacteria 6562
117 Ga0105240_10148288 3300009093 Bacteria 2796
118 Ga0105240_10180969 3300009093 Bacteria 2487
119 Ga0111539_10203438 3300009094 Bacteria 2308
120 Ga0111539_10263692 3300009094 Unclassified 2005
121 Ga0111539_10670625 3300009094 Bacteria 1207
122 Ga0105245_10016241 3300009098 Bacteria 6489
123 Ga0105247_10003046 3300009101 Bacteria 11095
124 Ga0105247_10005081 3300009101 Bacteria 8339
125 Ga0105247_10028647 3300009101 Bacteria 3370
126 Ga0114129_10176322 3300009147 Bacteria 2911
127 Ga0114129_10348885 3300009147 Unclassified 1961
128 Ga0105243_10020420 3300009148 Bacteria 5023
129 Ga0105243_10020739 3300009148 Bacteria 4986
130 Ga0105243_10123566 3300009148 Bacteria 2186
131 Ga0105241_10001143 3300009174 Bacteria 20210
132 Ga0105241_10215012 3300009174 Unclassified 1613
133 Ga0105242_10007065 3300009176 Bacteria 8672
134 Ga0105242_10019218 3300009176 Bacteria 5353
135 Ga0105248_10002357 3300009177 Bacteria 20976
136 Ga0105248_10054006 3300009177 Bacteria 4506
137 Ga0105237_10003837 3300009545 Bacteria 17672
138 Ga0105238_10012083 3300009551 Bacteria 8702
139 Ga0105238_10030437 3300009551 Bacteria 5495
140 Ga0105249_10017751 3300009553 Bacteria 6319
141 Ga0105249_10067331 3300009553 Unclassified 3299
142 Ga0105239_10015905 3300010375 Bacteria 8330
143 Ga0105239_10016313 3300010375 Bacteria 8213
144 Ga0105239_10176726 3300010375 Unclassified 2388
145 Ga0105246_10001629 3300011119 Bacteria 13361
146 Ga0157371_10037390 3300013102 Bacteria 3474
147 Ga0157370_10011312 3300013104 Bacteria 9351
148 Ga0157370_10296189 3300013104 Unclassified 1494
149 Ga0157369_10008208 3300013105 Bacteria 11975
150 Ga0157369_10033009 3300013105 Bacteria 5690
151 Ga0157369_10035476 3300013105 Bacteria 5468
152 Ga0157369_10383379 3300013105 Bacteria 1459
153 Ga0157374_10011043 3300013296 Bacteria 7801
154 Ga0157378_10017911 3300013297 Bacteria 6217
155 Ga0157378_10034674 3300013297 Bacteria 4463
156 Ga0157378_10202965 3300013297 Bacteria 1876
157 Ga0163162_10013742 3300013306 Bacteria 7906
158 Ga0163162_10052451 3300013306 Bacteria 4096
159 Ga0163162_10179476 3300013306 Bacteria 2243
160 Ga0157372_10003824 3300013307 Bacteria 16182
161 Ga0157372_10007909 3300013307 Bacteria 11302
162 Ga0157375_10147935 3300013308 Bacteria 2481
163 Ga0163163_10155072 3300014325 Bacteria 2334
164 Ga0163163_10175138 3300014325 Bacteria 2192
165 Ga0157380_10002785 3300014326 Bacteria 11881
166 Ga0182008_10071390 3300014497 Bacteria 1708
167 Ga0157377_10010908 3300014745 Bacteria 4515
168 Ga0157379_10020167 3300014968 Bacteria 5891
169 Ga0157379_10039426 3300014968 Bacteria 4215
170 Ga0157379_10104152 3300014968 Bacteria 2546
171 Ga0157376_10001204 3300014969 Bacteria 17050
172 Ga0209758_1000005 3300025297 Bacteria 1368918
173 Ga0207697_10014403 3300025315 Bacteria 3279
174 Ga0207653_10014359 3300025885 Bacteria 2485
175 Ga0207692_10053489 3300025898 Bacteria 2057
176 Ga0207642_10038315 3300025899 Bacteria 2074
177 Ga0207710_10015518 3300025900 Bacteria 3221
178 Ga0207688_10008937 3300025901 Bacteria 5452
179 Ga0207647_10019280 3300025904 Bacteria 4591
180 Ga0207685_10022980 3300025905 Bacteria 2116
181 Ga0207699_10006877 3300025906 Bacteria 5531
182 Ga0207645_10012997 3300025907 Bacteria 5628
183 Ga0207654_10013501 3300025911 Bacteria 4203
184 Ga0207695_10083456 3300025913 Bacteria 3228
185 Ga0207695_10105210 3300025913 Bacteria 2810
186 Ga0207671_10109542 3300025914 Bacteria 2100
187 Ga0207693_10000343 3300025915 Bacteria 42997
188 Ga0207693_10002297 3300025915 Bacteria 16613
189 Ga0207693_10067890 3300025915 Unclassified 2791
190 Ga0207693_10124691 3300025915 Bacteria 2024
191 Ga0207693_10147752 3300025915 Bacteria 1848
192 Ga0207663_10000540 3300025916 Bacteria 16619
193 Ga0207663_10117263 3300025916 Bacteria 1817
194 Ga0207660_10111141 3300025917 Bacteria 2062
195 Ga0207662_10053827 3300025918 Bacteria 2398
196 Ga0207657_10000793 3300025919 Bacteria 33507
197 Ga0207649_10013373 3300025920 Bacteria 4581
198 Ga0207649_10071502 3300025920 Bacteria 2216
199 Ga0207652_10150112 3300025921 Bacteria 2086
200 Ga0207646_10031825 3300025922 Bacteria 4775
201 Ga0207650_10036815 3300025925 Bacteria 3561
202 Ga0207659_10028097 3300025926 Bacteria 3818
203 Ga0207644_10035980 3300025931 Bacteria 3473
204 Ga0207690_10006770 3300025932 Bacteria 6793
205 Ga0207690_10058118 3300025932 Unclassified 2615
206 Ga0207706_10000771 3300025933 Bacteria 33246
207 Ga0207665_10002391 3300025939 Bacteria 12680
208 Ga0207691_10005611 3300025940 Bacteria 12128
209 Ga0207711_10017754 3300025941 Bacteria 5911
210 Ga0207711_10033203 3300025941 Bacteria 4365
211 Ga0207689_10141378 3300025942 Unclassified 1982
212 Ga0207661_10275902 3300025944 Bacteria 1501
213 Ga0207679_10028815 3300025945 Bacteria 3859
214 Ga0207667_10077517 3300025949 Bacteria 3447
215 Ga0207667_10500569 3300025949 Bacteria 1232
216 Ga0207651_10025319 3300025960 Bacteria 3686
217 Ga0207712_10117226 3300025961 Unclassified 2008
218 Ga0207668_10018020 3300025972 Bacteria 4435
219 Ga0207640_10011305 3300025981 Bacteria 5050
220 Ga0207640_10135349 3300025981 Bacteria 1788
221 Ga0207677_10024875 3300026023 Bacteria 3726
222 Ga0207703_10315505 3300026035 Bacteria 1430
223 Ga0207639_10093790 3300026041 Bacteria 2408
224 Ga0207639_10168646 3300026041 Bacteria 1852
225 Ga0207678_10001022 3300026067 Bacteria 25519
226 Ga0207678_10002818 3300026067 Bacteria 15771
227 Ga0207678_10056980 3300026067 Bacteria 3363
228 Ga0207708_10004422 3300026075 Bacteria 10360
229 Ga0207641_10021818 3300026088 Bacteria 5265
230 Ga0207676_10009149 3300026095 Bacteria 7052
231 Ga0207674_10016082 3300026116 Bacteria 8195
232 Ga0207674_10070183 3300026116 Bacteria 3522
233 Ga0207675_100000706 3300026118 Bacteria 33090
234 Ga0207683_10001159 3300026121 Bacteria 23967
235 Ga0207683_10079397 3300026121 Bacteria 2909
236 Ga0207698_10010611 3300026142 Bacteria 5933
237 Ga0209389_1000072 3300027296 Bacteria 96795
238 Ga0209389_1001196 3300027296 Bacteria 17831
239 Ga0209589_1000270 3300027357 Bacteria 65577
240 Ga0209489_100206 3300027361 Bacteria 96866
241 Ga0209489_106825 3300027361 Bacteria 17831
242 Ga0209700_104961 3300027363 Bacteria 23195
243 Ga0207428_10036376 3300027907 Bacteria 4016
244 Ga0268266_10001901 3300028379 Bacteria 23501
245 Ga0268265_10005729 3300028380 Bacteria 8482
246 Ga0268264_10032366 3300028381 Bacteria 4290
247 Ga0265327_10004817 3300031251 Bacteria 11708
248 Ga0307509_10000005 3300031507 Bacteria 435959
249 Ga0307509_10215426 3300031507 Unclassified 1740
250 Ga0307516_10021186 3300031730 Bacteria 6698
251 Ga0307516_10116076 3300031730 Bacteria 2473
252 Ga0307516_10150624 3300031730 Bacteria 2087
253 Ga0307510_10001430 3300033180 Bacteria 26243
254 Ga0373944_0012250 3300035089 Bacteria 2360
255 Ga0373945_0004295 3300035116 Bacteria 4525
256 Ga0373943_0002199 3300035170 Bacteria 8871
257 Ga0373961_0025889 3300035241 Bacteria 1599
258 Ga0373931_0013366 3300035691 Bacteria 3996
259 Ga0373927_0022031 3300035695 Bacteria 4175
260 Ga0373927_0026075 3300035695 Bacteria 3820
261 Ga0373927_0040105 3300035695 Bacteria 3038
262 Ga0373947_0010783 3300035725 Bacteria 5243
263 Ga0373947_0010954 3300035725 Bacteria 5206
264 Ga0373947_0046240 3300035725 Unclassified 2606
265 Ga0373925_0047186 3300037068 Bacteria 3206
266 Ga0373925_0106311 3300037068 Bacteria 2163
267 Ga0373925_0156451 3300037068 Unclassified 1793
268 Ga0395900_0019056 3300037418 Bacteria 6996
269 Ga0395900_0026147 3300037418 Bacteria 5976
270 Ga0395900_0150460 3300037418 Bacteria 2378
271 Ga0395898_0079478 3300037466 Bacteria 3164
272 Ga0395898_0236896 3300037466 Bacteria 1741
273 Ga0395905_0003449 3300037471 Bacteria 16921
274 Ga0395905_0009927 3300037471 Bacteria 9276
275 Ga0395905_0024454 3300037471 Bacteria 5701
276 Ga0395901_0011455 3300038443 Bacteria 8987
277 Ga0395901_0277771 3300038443 Unclassified 1741
278 Ga0436365_1336659 3300039437 Bacteria 4625
279 Ga0451577_0109853 3300042876 Unclassified 2466
280 Ga0466972_0026920 3300044658 Bacteria 2848
281 Ga0466968_0020907 3300044735 Bacteria 2646
282 Ga0466967_0013088 3300045976 Bacteria 6390
283 Ga0466967_0203920 3300045976 Bacteria 1874
284 Ga0495603_0000982 3300046455 Bacteria 16447
285 Ga0495629_0002902 3300046459 Bacteria 13077
286 Ga0495629_0025529 3300046459 Bacteria 4198
287 Ga0495638_0070428 3300046460 Bacteria 2141
288 Ga0495651_0185626 3300046462 Bacteria 1468
289 Ga0495580_0008156 3300046472 Bacteria 8342
290 Ga0495582_0072441 3300046473 Bacteria 1907
291 Ga0495639_0001158 3300046475 Bacteria 11919
292 Ga0495662_0027865 3300046476 Unclassified 2728
293 Ga0495664_0003323 3300046477 Bacteria 8738
294 Ga0495584_0006106 3300046491 Bacteria 6339
295 Ga0495594_0001809 3300046499 Bacteria 11114
296 Ga0495618_0050618 3300046514 Bacteria 2624
297 Ga0495618_0145120 3300046514 Bacteria 1517
298 Ga0495630_0006524 3300046517 Bacteria 8308
299 Ga0495630_0028338 3300046517 Unclassified 4162
300 Ga0495630_0116723 3300046517 Bacteria 2023
301 Ga0495652_0056990 3300046529 Bacteria 3316
302 Ga0495665_0010996 3300046531 Bacteria 4896
303 Ga0495665_0067408 3300046531 Unclassified 1888
304 Ga0495665_0086995 3300046531 Bacteria 1642
305 Ga0495640_0018620 3300046533 Bacteria 5142
306 Ga0495640_0036321 3300046533 Unclassified 3481
307 Ga0495640_0080018 3300046533 Bacteria 2174
308 Ga0495640_0146946 3300046533 Unclassified 1516
309 Ga0495645_0107764 3300046543 Unclassified 1974
310 Ga0495634_0013818 3300046642 Bacteria 5831
311 Ga0495634_0018490 3300046642 Unclassified 4962
312 Ga0495634_0028873 3300046642 Bacteria 3845
313 Ga0495634_0080130 3300046642 Unclassified 2137
314 Ga0495625_0008142 3300046660 Bacteria 8981
315 Ga0495635_0022407 3300046663 Unclassified 4398
316 Ga0495635_0076785 3300046663 Bacteria 2289
317 Ga0495635_0098694 3300046663 Bacteria 1996
318 Ga0495635_0101904 3300046663 Bacteria 1962
319 Ga0495588_0045795 3300046674 Bacteria 2243
320 Ga0495623_0089432 3300046679 Bacteria 1893
321 Ga0495646_0093203 3300046680 Unclassified 1736
322 Ga0495647_0004053 3300046681 Bacteria 4731
323 Ga0495613_0006249 3300046689 Bacteria 8908
324 Ga0495624_0004548 3300046690 Bacteria 10137
325 Ga0495581_0011334 3300047315 Bacteria 5158
326 Ga0495581_0017376 3300047315 Bacteria 4177
327 Ga0495581_0063858 3300047315 Bacteria 2127
328 Ga0495581_0066126 3300047315 Bacteria 2090
329 Ga0495674_0007651 3300047319 Bacteria 10318
330 Ga0495674_0057061 3300047319 Bacteria 3418
331 Ga0495674_0333586 3300047319 Bacteria 1233
332 Ga0495676_0017247 3300047321 Bacteria 6389
333 Ga0495684_0036803 3300047471 Unclassified 3752
334 Ga0495684_0044958 3300047471 Bacteria 3379
335 Ga0495684_0047335 3300047471 Bacteria 3289
336 Ga0495684_0051123 3300047471 Bacteria 3154
337 Ga0495593_0062777 3300047673 Bacteria 1941
338 Ga0496100_0010316 3300048903 Bacteria 5286
339 Ga0496100_0014744 3300048903 Bacteria 4545
340 Ga0496100_0095067 3300048903 Bacteria 2042
341 Ga0496102_0023713 3300048905 Bacteria 5452
342 Ga0496102_0038206 3300048905 Bacteria 4331
343 Ga0496103_0006185 3300048906 Bacteria 7154
344 Ga0496103_0009784 3300048906 Bacteria 5676
345 Ga0496103_0180682 3300048906 Bacteria 1356
346 Ga0496104_0001379 3300048907 Bacteria 21015
347 Ga0496104_0022829 3300048907 Bacteria 5749
348 Ga0496104_0037291 3300048907 Bacteria 4546
349 Ga0496104_0053799 3300048907 Bacteria 3804
350 Ga0496105_0002390 3300048908 Bacteria 13596
351 Ga0496105_0057238 3300048908 Bacteria 3219
352 Ga0496105_0081388 3300048908 Bacteria 2674
353 Ga0496106_0012134 3300048909 Bacteria 6359
354 Ga0496106_0069665 3300048909 Bacteria 2685
355 Ga0496107_0152506 3300048910 Bacteria 1710
356 Ga0496108_0017524 3300048911 Bacteria 5860
357 Ga0496108_0021324 3300048911 Bacteria 5325
358 Ga0496108_0038748 3300048911 Bacteria 3971
359 Ga0496108_0088977 3300048911 Bacteria 2624
360 Ga0496109_0004359 3300048912 Bacteria 11826
361 Ga0496109_0067404 3300048912 Bacteria 3278
362 Ga0496109_0093926 3300048912 Bacteria 2776
363 Ga0496109_0110717 3300048912 Bacteria 2553
364 Ga0496109_0274350 3300048912 Bacteria 1589
365 Ga0496110_0051708 3300048913 Bacteria 3610
366 Ga0496110_0068866 3300048913 Bacteria 3133
367 Ga0496110_0310742 3300048913 Unclassified 1435
368 Ga0496111_0011920 3300048914 Bacteria 5874
369 Ga0496111_0022661 3300048914 Bacteria 4399
370 Ga0496111_0108813 3300048914 Bacteria 2040
371 Ga0496112_0009592 3300048915 Bacteria 8730
372 Ga0496112_0074873 3300048915 Bacteria 3348
373 Ga0496113_0017595 3300048916 Bacteria 4965
374 Ga0496113_0055404 3300048916 Unclassified 2972
375 Ga0496113_0210330 3300048916 Unclassified 1548
376 Ga0496113_0232375 3300048916 Bacteria 1470
377 Ga0496114_0007710 3300048917 Bacteria 8514
378 Ga0496114_0022597 3300048917 Bacteria 5127
379 Ga0496114_0080389 3300048917 Unclassified 2753
380 Ga0496114_0376026 3300048917 Unclassified 1257
381 Ga0496115_0033255 3300048918 Bacteria 4070
382 Ga0496115_0060304 3300048918 Bacteria 3056
383 Ga0496115_0067679 3300048918 Bacteria 2889
384 Ga0496115_0148197 3300048918 Bacteria 1937
385 Ga0496115_0160349 3300048918 Bacteria 1858
386 Ga0496115_0289062 3300048918 Unclassified 1345
387 Ga0496125_0221437 3300048928 Bacteria 1219
388 Ga0501033_0122462 3300049570 Unclassified 1887
389 Ga0501039_0063445 3300049575 Bacteria 2863
390 Ga0501075_0057309 3300049591 Bacteria 2933
391 Ga0501076_0039198 3300049592 Bacteria 3720
392 Ga0501077_0005853 3300049593 Bacteria 7493
393 Ga0501077_0161097 3300049593 Unclassified 1424
394 Ga0501079_0064345 3300049741 Bacteria 2829
395 Ga0501081_0163635 3300049743 Bacteria 1604
396 Ga0501045_0029045 3300049824 Bacteria 3994
397 Ga0501045_0204240 3300049824 Unclassified 1472
398 nmdc:mga05p37_78966_c1 3300050507 Bacteria 4053
399 nmdc:mga0qj67_129827_c1 3300050509 Unclassified 2041
400 nmdc:mga0qj67_90752_c1 3300050509 Bacteria 2455
401 nmdc:mga06r32_27580_c1 3300050510 Bacteria 5308
402 nmdc:mga08x19_99630_c1 3300050514 Bacteria 1927
403 Ga0495601_0030647 3300053077 Unclassified 3340
404 Ga0495601_0043528 3300053077 Bacteria 2819
405 Ga0495612_0028255 3300053078 Unclassified 2258
406 Ga0495612_0032007 3300053078 Bacteria 2124
407 Ga0495612_0043931 3300053078 Bacteria 1827
408 Ga0495619_0001351 3300053085 Bacteria 16089
409 Ga0495619_0163191 3300053085 Bacteria 1539
410 Ga0500641_0034489 3300053096 Unclassified 2014
411 Ga0500595_006008 3300053119 Bacteria 5219
412 Ga0500559_0096227 3300053136 Bacteria 1360
413 Ga0500573_0014992 3300053140 Bacteria 4389
414 Ga0500622_0004644 3300053156 Bacteria 8515
415 Ga0500637_0021501 3300053178 Bacteria 3506
416 Ga0500645_020924 3300053730 Bacteria 2022
417 Ga0500596_005095 3300053735 Bacteria 2347
418 Ga0530510_0034221 3300061734 Unclassified 3659
419 Ga0530510_0038979 3300061734 Bacteria 3431
420 Ga0530510_0236105 3300061734 Unclassified 1361
421 2513627255 2513237092 Bacteria 8341956
422 2513655285 2513237096 Bacteria 8722461
423 2513680206 2513237098 Bacteria 9902361
424 2513696168 2513237101 Bacteria 7952346
425 2513863690 2513237137 Bacteria 9558895
426 2513889260 2513237141 Bacteria 8496279
427 2513915689 2513237145 Bacteria 8979722
428 2524541843 2524023228 Bacteria 10118060
429 2770199676 2767802442 Bacteria 5747986
430 2841963018 2841957949 Bacteria 8652217
431 2847938378 2847930680 Bacteria 9342022
432 2876762100 2876761206 Bacteria 10111113
433 2879086036 2879083081 Bacteria 8587928
434 2881668601 2881665667 Bacteria 8175609
435 2885384820 2885383462 Bacteria 9473874
436 2903770282 2903768456 Bacteria 9749579
437 643604858 643348564 Bacteria 8839022
438 Ga0105240_10022091
439 JGI25153J46596_10000014
440 rootH1_10123329
441 JGI25404J52841_10008769
442 Ga0070683_100016262
443 Ga0070690_100000828
444 Ga0070670_100002211
445 Ga0068869_100028493
446 Ga0070666_10047522
447 Ga0070680_100035717
448 Ga0070680_100186115
449 Ga0070682_100091839
450 Ga0068868_100006575
451 Ga0070660_100001272
452 Ga0070689_100153760
453 Ga0070691_10000310
454 Ga0070687_100000658
455 Ga0070661_100001241
456 Ga0070692_10004720
457 Ga0070668_100000234
458 Ga0070675_100025691
459 Ga0070671_100004140
460 Ga0070674_100008136
461 Ga0070673_100000403
462 Ga0070688_100001474
463 Ga0070688_100046056
464 Ga0070659_100086304
465 Ga0070667_100003240
466 Ga0070667_100106625
467 Ga0070703_10011667
468 Ga0070709_10008539
469 Ga0070714_100023029
470 Ga0070714_100123293
471 Ga0070714_100301616
472 Ga0070713_100279829
473 Ga0070710_10022413
474 Ga0070710_10129562
475 Ga0070701_10005778
476 Ga0070711_100005856
477 Ga0070711_100124699
478 Ga0070705_100001109
479 Ga0070700_100005223
480 Ga0070694_100002601
481 Ga0070708_100116126
482 Ga0070663_100001201
483 Ga0070663_100017942
484 Ga0070678_100002064
485 Ga0070662_100003035
486 Ga0070681_10033670
487 Ga0070681_10034390
488 Ga0070681_10046536
489 Ga0070698_100067767
490 Ga0070698_100305406
491 Ga0070699_100268122
492 Ga0070679_100074927
493 Ga0070679_100215808
494 Ga0070684_100097529
495 Ga0070684_100165937
496 Ga0070697_100004351
497 Ga0068853_100002553
498 Ga0068853_100143871
499 Ga0070672_100179782
500 Ga0070695_100001397
501 Ga0070696_100012038
502 Ga0070704_100013450
503 Ga0070704_100019170
504 Ga0068855_100073351
505 Ga0068855_100176189
506 Ga0070664_100012455
507 Ga0068857_100001194
508 Ga0068854_100008240
509 Ga0068856_100002595
510 Ga0068856_100016421
511 Ga0070702_100003827
512 Ga0068852_100012153
513 Ga0068864_100017257
514 Ga0068861_100014165
515 Ga0068863_100001254
516 Ga0068858_100060663
517 Ga0068860_100008151
518 Ga0068860_100170142
519 Ga0068860_100199881
520 Ga0068862_100007020
521 Ga0081455_10002404
522 Ga0081455_10003716
523 Ga0081540_1002075
524 Ga0081540_1003438
525 Ga0075432_10007193
526 Ga0070715_10000165
527 Ga0070716_100078553
528 Ga0070712_100008927
529 Ga0070712_100030862
530 Ga0070712_100057519
531 Ga0070712_100211784
532 Ga0097621_100166000
533 Ga0097621_100195572
534 Ga0068871_100036229
535 Ga0068871_100037626
536 Ga0068871_100040274
537 Ga0075428_100161569
538 Ga0075428_100190954
539 Ga0075430_100020072
540 Ga0075430_100155228
541 Ga0075431_100075424
542 Ga0075431_100101143
543 Ga0075433_10165124
544 Ga0075434_100099434
545 Ga0075434_100193070
546 Ga0075429_100022838
547 Ga0075436_100005769
548 Ga0075436_100029397
549 Ga0099825_1022580
550 Ga0075435_100026141
551 Ga0105240_10017610
552 Ga0105240_10022737
553 Ga0105240_10034162
554 Ga0105240_10148288
555 Ga0105240_10180969
556 Ga0111539_10203438
557 Ga0111539_10263692
558 Ga0111539_10670625
559 Ga0105245_10016241
560 Ga0105247_10003046
561 Ga0105247_10005081
562 Ga0105247_10028647
563 Ga0114129_10176322
564 Ga0114129_10348885
565 Ga0105243_10020420
566 Ga0105243_10020739
567 Ga0105243_10123566
568 Ga0105241_10001143
569 Ga0105241_10215012
570 Ga0105242_10007065
571 Ga0105242_10019218
572 Ga0105248_10002357
573 Ga0105248_10054006
574 Ga0105237_10003837
575 Ga0105238_10012083
576 Ga0105238_10030437
577 Ga0105249_10017751
578 Ga0105249_10067331
579 Ga0105239_10015905
580 Ga0105239_10016313
581 Ga0105239_10176726
582 Ga0105246_10001629
583 Ga0157371_10037390
584 Ga0157370_10011312
585 Ga0157370_10296189
586 Ga0157369_10008208
587 Ga0157369_10033009
588 Ga0157369_10035476
589 Ga0157369_10383379
590 Ga0157374_10011043
591 Ga0157378_10017911
592 Ga0157378_10034674
593 Ga0157378_10202965
594 Ga0163162_10013742
595 Ga0163162_10052451
596 Ga0163162_10179476
597 Ga0157372_10003824
598 Ga0157372_10007909
599 Ga0157375_10147935
600 Ga0163163_10155072
601 Ga0163163_10175138
602 Ga0157380_10002785
603 Ga0182008_10071390
604 Ga0157377_10010908
605 Ga0157379_10020167
606 Ga0157379_10039426
607 Ga0157379_10104152
608 Ga0157376_10001204
609 Ga0209758_1000005
610 Ga0207697_10014403
611 Ga0207653_10014359
612 Ga0207692_10053489
613 Ga0207642_10038315
614 Ga0207710_10015518
615 Ga0207688_10008937
616 Ga0207647_10019280
617 Ga0207685_10022980
618 Ga0207699_10006877
619 Ga0207645_10012997
620 Ga0207654_10013501
621 Ga0207695_10083456
622 Ga0207695_10105210
623 Ga0207671_10109542
624 Ga0207693_10000343
625 Ga0207693_10002297
626 Ga0207693_10067890
627 Ga0207693_10124691
628 Ga0207693_10147752
629 Ga0207663_10000540
630 Ga0207663_10117263
631 Ga0207660_10111141
632 Ga0207662_10053827
633 Ga0207657_10000793
634 Ga0207649_10013373
635 Ga0207649_10071502
636 Ga0207652_10150112
637 Ga0207646_10031825
638 Ga0207650_10036815
639 Ga0207659_10028097
640 Ga0207644_10035980
641 Ga0207690_10006770
642 Ga0207690_10058118
643 Ga0207706_10000771
644 Ga0207665_10002391
645 Ga0207691_10005611
646 Ga0207711_10017754
647 Ga0207711_10033203
648 Ga0207689_10141378
649 Ga0207661_10275902
650 Ga0207679_10028815
651 Ga0207667_10077517
652 Ga0207667_10500569
653 Ga0207651_10025319
654 Ga0207712_10117226
655 Ga0207668_10018020
656 Ga0207640_10011305
657 Ga0207640_10135349
658 Ga0207677_10024875
659 Ga0207703_10315505
660 Ga0207639_10093790
661 Ga0207639_10168646
662 Ga0207678_10001022
663 Ga0207678_10002818
664 Ga0207678_10056980
665 Ga0207708_10004422
666 Ga0207641_10021818
667 Ga0207676_10009149
668 Ga0207674_10016082
669 Ga0207674_10070183
670 Ga0207675_100000706
671 Ga0207683_10001159
672 Ga0207683_10079397
673 Ga0207698_10010611
674 Ga0209389_1000072
675 Ga0209389_1001196
676 Ga0209589_1000270
677 Ga0209489_100206
678 Ga0209489_106825
679 Ga0209700_104961
680 Ga0207428_10036376
681 Ga0268266_10001901
682 Ga0268265_10005729
683 Ga0268264_10032366
684 Ga0265327_10004817
685 Ga0307509_10000005
686 Ga0307509_10215426
687 Ga0307516_10021186
688 Ga0307516_10116076
689 Ga0307516_10150624
690 Ga0307510_10001430
691 Ga0373944_0012250
692 Ga0373945_0004295
693 Ga0373943_0002199
694 Ga0373961_0025889
695 Ga0373931_0013366
696 Ga0373927_0022031
697 Ga0373927_0026075
698 Ga0373927_0040105
699 Ga0373947_0010783
700 Ga0373947_0010954
701 Ga0373947_0046240
702 Ga0373925_0047186
703 Ga0373925_0106311
704 Ga0373925_0156451
705 Ga0395900_0019056
706 Ga0395900_0026147
707 Ga0395900_0150460
708 Ga0395898_0079478
709 Ga0395898_0236896
710 Ga0395905_0003449
711 Ga0395905_0009927
712 Ga0395905_0024454
713 Ga0395901_0011455
714 Ga0395901_0277771
715 Ga0436365_1336659
716 Ga0451577_0109853
717 Ga0466972_0026920
718 Ga0466968_0020907
719 Ga0466967_0013088
720 Ga0466967_0203920
721 Ga0495603_0000982
722 Ga0495629_0002902
723 Ga0495629_0025529
724 Ga0495638_0070428
725 Ga0495651_0185626
726 Ga0495580_0008156
727 Ga0495582_0072441
728 Ga0495639_0001158
729 Ga0495662_0027865
730 Ga0495664_0003323
731 Ga0495584_0006106
732 Ga0495594_0001809
733 Ga0495618_0050618
734 Ga0495618_0145120
735 Ga0495630_0006524
736 Ga0495630_0028338
737 Ga0495630_0116723
738 Ga0495652_0056990
739 Ga0495665_0010996
740 Ga0495665_0067408
741 Ga0495665_0086995
742 Ga0495640_0018620
743 Ga0495640_0036321
744 Ga0495640_0080018
745 Ga0495640_0146946
746 Ga0495645_0107764
747 Ga0495634_0013818
748 Ga0495634_0018490
749 Ga0495634_0028873
750 Ga0495634_0080130
751 Ga0495625_0008142
752 Ga0495635_0022407
753 Ga0495635_0076785
754 Ga0495635_0098694
755 Ga0495635_0101904
756 Ga0495588_0045795
757 Ga0495623_0089432
758 Ga0495646_0093203
759 Ga0495647_0004053
760 Ga0495613_0006249
761 Ga0495624_0004548
762 Ga0495581_0011334
763 Ga0495581_0017376
764 Ga0495581_0063858
765 Ga0495581_0066126
766 Ga0495674_0007651
767 Ga0495674_0057061
768 Ga0495674_0333586
769 Ga0495676_0017247
770 Ga0495684_0036803
771 Ga0495684_0044958
772 Ga0495684_0047335
773 Ga0495684_0051123
774 Ga0495593_0062777
775 Ga0496100_0010316
776 Ga0496100_0014744
777 Ga0496100_0095067
778 Ga0496102_0023713
779 Ga0496102_0038206
780 Ga0496103_0006185
781 Ga0496103_0009784
782 Ga0496103_0180682
783 Ga0496104_0001379
784 Ga0496104_0022829
785 Ga0496104_0037291
786 Ga0496104_0053799
787 Ga0496105_0002390
788 Ga0496105_0057238
789 Ga0496105_0081388
790 Ga0496106_0012134
791 Ga0496106_0069665
792 Ga0496107_0152506
793 Ga0496108_0017524
794 Ga0496108_0021324
795 Ga0496108_0038748
796 Ga0496108_0088977
797 Ga0496109_0004359
798 Ga0496109_0067404
799 Ga0496109_0093926
800 Ga0496109_0110717
801 Ga0496109_0274350
802 Ga0496110_0051708
803 Ga0496110_0068866
804 Ga0496110_0310742
805 Ga0496111_0011920
806 Ga0496111_0022661
807 Ga0496111_0108813
808 Ga0496112_0009592
809 Ga0496112_0074873
810 Ga0496113_0017595
811 Ga0496113_0055404
812 Ga0496113_0210330
813 Ga0496113_0232375
814 Ga0496114_0007710
815 Ga0496114_0022597
816 Ga0496114_0080389
817 Ga0496114_0376026
818 Ga0496115_0033255
819 Ga0496115_0060304
820 Ga0496115_0067679
821 Ga0496115_0148197
822 Ga0496115_0160349
823 Ga0496115_0289062
824 Ga0496125_0221437
825 Ga0501033_0122462
826 Ga0501039_0063445
827 Ga0501075_0057309
828 Ga0501076_0039198
829 Ga0501077_0005853
830 Ga0501077_0161097
831 Ga0501079_0064345
832 Ga0501081_0163635
833 Ga0501045_0029045
834 Ga0501045_0204240
835 nmdc:mga05p37_78966_c1
836 nmdc:mga0qj67_129827_c1
837 nmdc:mga0qj67_90752_c1
838 nmdc:mga06r32_27580_c1
839 nmdc:mga08x19_99630_c1
840 Ga0495601_0030647
841 Ga0495601_0043528
842 Ga0495612_0028255
843 Ga0495612_0032007
844 Ga0495612_0043931
845 Ga0495619_0001351
846 Ga0495619_0163191
847 Ga0500641_0034489
848 Ga0500595_006008
849 Ga0500559_0096227
850 Ga0500573_0014992
851 Ga0500622_0004644
852 Ga0500637_0021501
853 Ga0500645_020924
854 Ga0500596_005095
855 Ga0530510_0034221
856 Ga0530510_0038979
857 Ga0530510_0236105
858 2513627255
859 2513655285
860 2513680206
861 2513696168
862 2513863690
863 2513889260
864 2513915689
865 2524541843
866 2770199676
867 2841963018
868 2847938378
869 2876762100
870 2879086036
871 2881668601
872 2885384820
873 2903770282
874 643604858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

141

209

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dck-assembly1.cif.gz_B crystal structure of phosphodiesterase tw9814 0.9154 49 376
7dck-assembly1.cif.gz_B crystal structure of phosphodiesterase tw9814 0.9009 49 376
3h3e-assembly1.cif.gz_A crystal structure of tm1679, a metal-dependent hydrolase of the beta-lactamase superfamily 0.895 53 373
2p4z-assembly2.cif.gz_B a ferredoxin-like metallo-beta-lactamase superfamily protein from thermoanaerobacter tengcongensis 0.8878 51 373
3h3e-assembly1.cif.gz_A crystal structure of tm1679, a metal-dependent hydrolase of the beta-lactamase superfamily 0.8718 53 373
ID Description Score Start End Superfamily
af_Q57749_3_293_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9028 45 373 3.60.15.10
af_Q57749_3_293_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8939 45 373 3.60.15.10
af_Q57890_1_256_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8887 55 371 3.60.15.10
2p4zA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8859 51 373 3.60.15.10
3h3eA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8856 54 373 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A532U5A6-F1-model_v4 MBL fold metallo-hydrolase 0.99 274 371 GO:0016740
AF-A0A316W9N2-F1-model_v4 MBL fold metallo-hydrolase 0.9882 277 378 GO:0016740
GO:0016787
AF-A0A1S1P1B4-F1-model_v4 MBL fold metallo-hydrolase 0.9858 92 378 GO:0016740
GO:0016787
AF-A0A534ANQ2-F1-model_v4 MBL fold metallo-hydrolase 0.9812 97 378 GO:0016740
GO:0016787
AF-A0A537SH90-F1-model_v4 MBL fold metallo-hydrolase 0.9789 94 371 GO:0016740
GO:0016787

Map