F443753

General Info

Members Datasets Scaffolds Average Seq Length
437 264 874 310

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10102816|Ga0105245_101028164
Length 328
Sequence MLEPDGHRLGLRDPMTLIALTGATGFIGRQLLAELPKRGYRIRVLLRRPAQVPLDCDSAVIGDLTRPQNLSAAFRDAAAVVHSAGLAPGMSGMPADDYRTINAEATGALARAAERAGVRRFVFMSSIRAQCGPSAFGTVTEDLPARPTDAYGLSKLGGEHELAALMTMDWVALRPVLVYGRGAAGNMAALVGAARSRVPLPVSALSARRSLLALDNLVDAVTHVLAASQSFRQPFIVADAQALTVAEMIAALRAGLGRGAGVFPMPESLLRFALQYTGRDAWIERLCQPLVASSAALQSLGWTPRVTTVAGLAALTREGTGATTGRPA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
109 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
112 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
117 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2508501050 Microvirga lupini Lut6 Isolate Nodule
252 2643221734 Bosea sp. Root670 Isolate Unclassified
253 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
254 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
255 2773857925 Microvirga vignae BR3299 Isolate Unclassified
256 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
257 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
258 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
259 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
260 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
261 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
262 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
263 641522639 Methylobacterium sp. 4-46 Isolate Nodule
264 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 0.23
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 1.14
Rhizoplane 13.96
Rhizosphere 81.01
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10102816 3300009098 Bacteria 2646
2 rootH1_10106330 3300003323 Bacteria 1981
3 Ga0070670_100058543 3300005331 Bacteria 3307
4 Ga0068869_100033528 3300005334 Bacteria 3625
5 Ga0070666_10034663 3300005335 Bacteria 3345
6 Ga0068868_100022983 3300005338 Bacteria 4714
7 Ga0068868_100164585 3300005338 Bacteria 1834
8 Ga0070661_100030673 3300005344 Bacteria 3884
9 Ga0070668_100078924 3300005347 Bacteria 2576
10 Ga0070669_100112616 3300005353 Bacteria 2066
11 Ga0070667_100013697 3300005367 Bacteria 6701
12 Ga0070709_10074621 3300005434 Bacteria 2198
13 Ga0070714_100009251 3300005435 Bacteria 7741
14 Ga0070713_100011742 3300005436 Bacteria 6395
15 Ga0070713_100168787 3300005436 Bacteria 1959
16 Ga0070710_10014757 3300005437 Bacteria 3937
17 Ga0070710_10184096 3300005437 Bacteria 1310
18 Ga0070701_10022673 3300005438 Bacteria 3012
19 Ga0070711_100034819 3300005439 Bacteria 3362
20 Ga0070662_100007330 3300005457 Bacteria 7145
21 Ga0068867_100091166 3300005459 Bacteria 2313
22 Ga0070706_100465773 3300005467 Unclassified 1176
23 Ga0070698_100146753 3300005471 Bacteria 2308
24 Ga0068853_100065423 3300005539 Bacteria 3155
25 Ga0070672_100410393 3300005543 Bacteria 1162
26 Ga0070686_100008180 3300005544 Bacteria 5852
27 Ga0070695_100005074 3300005545 Bacteria 7755
28 Ga0070696_100133210 3300005546 Bacteria 1810
29 Ga0070664_100058372 3300005564 Bacteria 3282
30 Ga0070702_100179144 3300005615 Bacteria 1385
31 Ga0068852_100220189 3300005616 Bacteria 1805
32 Ga0068859_100014661 3300005617 Bacteria 7877
33 Ga0068866_10002755 3300005718 Bacteria 7252
34 Ga0068861_100031239 3300005719 Bacteria 3910
35 Ga0068861_100098047 3300005719 Bacteria 2326
36 Ga0068863_100169827 3300005841 Bacteria 2091
37 Ga0081455_10005582 3300005937 Bacteria 13760
38 Ga0081538_10025304 3300005981 Bacteria 4190
39 Ga0081540_1000032 3300005983 Bacteria 144522
40 Ga0081539_10019998 3300005985 Bacteria 4553
41 Ga0070717_10147962 3300006028 Bacteria 2030
42 Ga0070717_10463812 3300006028 Bacteria 1143
43 Ga0075365_10079656 3300006038 Bacteria 2216
44 Ga0075365_10131705 3300006038 Bacteria 1731
45 Ga0075363_100017020 3300006048 Bacteria 3599
46 Ga0070715_10000896 3300006163 Bacteria 8266
47 Ga0070716_100007056 3300006173 Bacteria 5514
48 Ga0070712_100000165 3300006175 Bacteria 35992
49 Ga0070712_100038299 3300006175 Bacteria 3276
50 Ga0070712_100226770 3300006175 Unclassified 1482
51 Ga0068871_100095330 3300006358 Unclassified 2485
52 Ga0075428_100157800 3300006844 Bacteria 2463
53 Ga0075428_100526427 3300006844 Bacteria 1264
54 Ga0075430_100000821 3300006846 Bacteria 24241
55 Ga0075430_100026606 3300006846 Bacteria 4919
56 Ga0075431_100036436 3300006847 Bacteria 5067
57 Ga0075431_100075329 3300006847 Bacteria 3482
58 Ga0075431_100211345 3300006847 Bacteria 1982
59 Ga0075434_100013846 3300006871 Bacteria 7693
60 Ga0075434_100016976 3300006871 Bacteria 7003
61 Ga0075434_100113923 3300006871 Bacteria 2717
62 Ga0075429_100035014 3300006880 Bacteria 4364
63 Ga0075429_100150599 3300006880 Bacteria 2037
64 Ga0075429_100401069 3300006880 Bacteria 1201
65 Ga0075436_100069091 3300006914 Bacteria 2441
66 Ga0097620_100014660 3300006931 Bacteria 7877
67 Ga0075435_100065785 3300007076 Bacteria 2947
68 Ga0075435_100141042 3300007076 Bacteria 2022
69 Ga0075435_100186404 3300007076 Bacteria 1755
70 Ga0075435_100264251 3300007076 Bacteria 1467
71 Ga0099794_10090216 3300007265 Bacteria 1520
72 Ga0111539_10131964 3300009094 Bacteria 2925
73 Ga0111539_10179891 3300009094 Bacteria 2470
74 Ga0111539_10194521 3300009094 Bacteria 2366
75 Ga0111539_10204364 3300009094 Bacteria 2303
76 Ga0105245_10214169 3300009098 Bacteria 1855
77 Ga0105247_10006172 3300009101 Bacteria 7437
78 Ga0114129_10011285 3300009147 Bacteria 12732
79 Ga0114129_10038749 3300009147 Bacteria 6719
80 Ga0114129_10071187 3300009147 Bacteria 4849
81 Ga0114129_10479030 3300009147 Bacteria 1629
82 Ga0105243_10056774 3300009148 Bacteria 3115
83 Ga0105242_10072007 3300009176 Bacteria 2870
84 Ga0105248_10020474 3300009177 Bacteria 7330
85 Ga0105248_10050919 3300009177 Bacteria 4647
86 Ga0105237_10035802 3300009545 Bacteria 5021
87 Ga0105249_10018832 3300009553 Bacteria 6153
88 Ga0105239_10164771 3300010375 Bacteria 2478
89 Ga0157374_10002466 3300013296 Bacteria 15626
90 Ga0157374_10273954 3300013296 Bacteria 1665
91 Ga0163163_10053005 3300014325 Bacteria 4003
92 Ga0163163_10213910 3300014325 Bacteria 1976
93 Ga0157380_10224478 3300014326 Bacteria 1683
94 Ga0157379_10043843 3300014968 Bacteria 3994
95 Ga0157379_10457580 3300014968 Unclassified 1179
96 Ga0163161_10033692 3300017792 Bacteria 3660
97 Ga0224572_1011707 3300024225 Unclassified 1660
98 Ga0207692_10008624 3300025898 Bacteria 4227
99 Ga0207692_10157652 3300025898 Bacteria 1305
100 Ga0207710_10017012 3300025900 Bacteria 3081
101 Ga0207688_10000117 3300025901 Bacteria 32379
102 Ga0207688_10024528 3300025901 Bacteria 3308
103 Ga0207680_10112027 3300025903 Bacteria 1771
104 Ga0207647_10015624 3300025904 Bacteria 5197
105 Ga0207699_10007287 3300025906 Bacteria 5404
106 Ga0207643_10000291 3300025908 Bacteria 34985
107 Ga0207684_10398025 3300025910 Bacteria 1184
108 Ga0207693_10006232 3300025915 Bacteria 9894
109 Ga0207693_10006770 3300025915 Bacteria 9462
110 Ga0207693_10207868 3300025915 Unclassified 1539
111 Ga0207693_10279578 3300025915 Unclassified 1308
112 Ga0207693_10285589 3300025915 Bacteria 1293
113 Ga0207663_10019637 3300025916 Bacteria 3812
114 Ga0207662_10004840 3300025918 Bacteria 7122
115 Ga0207657_10037546 3300025919 Bacteria 4324
116 Ga0207652_10206391 3300025921 Bacteria 1769
117 Ga0207650_10007981 3300025925 Bacteria 7216
118 Ga0207650_10037956 3300025925 Bacteria 3513
119 Ga0207687_10205609 3300025927 Bacteria 1542
120 Ga0207700_10000458 3300025928 Bacteria 23936
121 Ga0207664_10031202 3300025929 Bacteria 4076
122 Ga0207644_10032511 3300025931 Bacteria 3640
123 Ga0207706_10373489 3300025933 Bacteria 1238
124 Ga0207670_10031516 3300025936 Bacteria 3399
125 Ga0207669_10014161 3300025937 Bacteria 3990
126 Ga0207665_10006165 3300025939 Bacteria 7962
127 Ga0207665_10024600 3300025939 Bacteria 3972
128 Ga0207691_10012255 3300025940 Bacteria 8219
129 Ga0207711_10039010 3300025941 Bacteria 4039
130 Ga0207689_10002877 3300025942 Bacteria 15867
131 Ga0207661_10099866 3300025944 Bacteria 2435
132 Ga0207679_10076308 3300025945 Bacteria 2546
133 Ga0207651_10018905 3300025960 Bacteria 4115
134 Ga0207668_10005839 3300025972 Bacteria 7248
135 Ga0207668_10138395 3300025972 Bacteria 1869
136 Ga0207668_10280253 3300025972 Bacteria 1367
137 Ga0207677_10061643 3300026023 Bacteria 2598
138 Ga0207703_10061763 3300026035 Bacteria 3068
139 Ga0207708_10001828 3300026075 Bacteria 15698
140 Ga0207708_10183747 3300026075 Unclassified 1661
141 Ga0207641_10020581 3300026088 Bacteria 5420
142 Ga0207648_10145861 3300026089 Bacteria 2087
143 Ga0207648_10156136 3300026089 Bacteria 2014
144 Ga0207676_10375581 3300026095 Bacteria 1322
145 Ga0207683_10036001 3300026121 Bacteria 4307
146 Ga0268266_10030720 3300028379 Bacteria 4563
147 Ga0268265_10031473 3300028380 Bacteria 3831
148 Ga0268264_10078844 3300028381 Bacteria 2809
149 Ga0265760_10036223 3300031090 Bacteria 1463
150 Ga0316575_10003861 3300031665 Bacteria 5230
151 Ga0316579_10016074 3300031691 Bacteria 3261
152 Ga0316576_10115359 3300031727 Bacteria 2015
153 Ga0316576_10130885 3300031727 Bacteria 1887
154 Ga0316578_10022830 3300031728 Bacteria 3494
155 Ga0316578_10083458 3300031728 Bacteria 1903
156 Ga0316577_10095340 3300031733 Bacteria 1666
157 Ga0316577_10172540 3300031733 Bacteria 1220
158 Ga0307410_10205439 3300031852 Bacteria 1506
159 Ga0307409_100457600 3300031995 Bacteria 1233
160 Ga0316585_10044677 3300032137 Bacteria 1416
161 Ga0316580_10014519 3300032139 Bacteria 2405
162 Ga0373952_0033036 3300035092 Bacteria 1159
163 Ga0373946_0006727 3300035171 Bacteria 4178
164 Ga0373946_0077756 3300035171 Bacteria 1447
165 Ga0373955_0007178 3300035172 Bacteria 5108
166 Ga0316574_0096072 3300035398 Bacteria 1893
167 Ga0373924_0006143 3300035410 Bacteria 4290
168 Ga0373931_0185692 3300035691 Bacteria 1234
169 Ga0373935_0000454 3300035692 Bacteria 21220
170 Ga0373935_0157404 3300035692 Bacteria 1546
171 Ga0373935_0218724 3300035692 Bacteria 1322
172 Ga0373927_0013081 3300035695 Bacteria 5520
173 Ga0373927_0085781 3300035695 Bacteria 2044
174 Ga0373927_0205640 3300035695 Bacteria 1293
175 Ga0373927_0299979 3300035695 Bacteria 1057
176 Ga0373933_0002060 3300035724 Bacteria 11550
177 Ga0373947_0008199 3300035725 Bacteria 6025
178 Ga0373947_0145167 3300035725 Unclassified 1525
179 Ga0373947_0230401 3300035725 Bacteria 1220
180 Ga0373937_0000089 3300036401 Bacteria 84564
181 Ga0373937_0123732 3300036401 Bacteria 2412
182 Ga0316582_0141959 3300036647 Bacteria 1619
183 Ga0316584_0015212 3300036712 Bacteria 5498
184 Ga0316584_0113076 3300036712 Bacteria 2031
185 Ga0373925_0000016 3300037068 Bacteria 176830
186 Ga0395899_0003124 3300037312 Bacteria 13190
187 Ga0395900_0001182 3300037418 Bacteria 32449
188 Ga0395900_0072980 3300037418 Bacteria 3528
189 Ga0395900_0081703 3300037418 Bacteria 3320
190 Ga0395900_0314121 3300037418 Bacteria 1549
191 Ga0395898_0016185 3300037466 Bacteria 7638
192 Ga0395898_0128715 3300037466 Bacteria 2425
193 Ga0395898_0131992 3300037466 Bacteria 2392
194 Ga0395905_0010942 3300037471 Bacteria 8781
195 Ga0395905_0257108 3300037471 Bacteria 1631
196 Ga0436364_0574792 3300037853 Bacteria 3067
197 Ga0395901_0009068 3300038443 Bacteria 10072
198 Ga0395901_0023566 3300038443 Bacteria 6311
199 Ga0395901_0064829 3300038443 Bacteria 3803
200 Ga0395901_0203904 3300038443 Bacteria 2072
201 Ga0395901_0217943 3300038443 Bacteria 1995
202 Ga0439466_0086160 3300041411 Unclassified 987
203 Ga0466966_0030301 3300044684 Bacteria 3513
204 Ga0466961_0081002 3300044693 Bacteria 2055
205 Ga0466967_0096051 3300045976 Bacteria 2703
206 Ga0495592_0001282 3300046454 Bacteria 17428
207 Ga0495629_0009971 3300046459 Bacteria 6932
208 Ga0495651_0002468 3300046462 Bacteria 14299
209 Ga0495651_0170297 3300046462 Bacteria 1552
210 Ga0495653_0000022 3300046463 Bacteria 169653
211 Ga0495580_0208744 3300046472 Bacteria 1344
212 Ga0495662_0000552 3300046476 Bacteria 17176
213 Ga0495662_0128930 3300046476 Bacteria 1243
214 Ga0495662_0153972 3300046476 Bacteria 1132
215 Ga0495664_0000013 3300046477 Bacteria 204282
216 Ga0495584_0002262 3300046491 Bacteria 10979
217 Ga0495585_0004639 3300046492 Bacteria 8872
218 Ga0495594_0080925 3300046499 Bacteria 1813
219 Ga0495596_0039934 3300046500 Bacteria 1853
220 Ga0495608_0000004 3300046511 Bacteria 355027
221 Ga0495618_0000032 3300046514 Bacteria 104874
222 Ga0495628_0000014 3300046516 Bacteria 205818
223 Ga0495630_0008555 3300046517 Bacteria 7343
224 Ga0495630_0217896 3300046517 Bacteria 1457
225 Ga0495644_0058726 3300046523 Bacteria 1446
226 Ga0495652_0000002 3300046529 Bacteria 946606
227 Ga0495652_0029463 3300046529 Unclassified 4822
228 Ga0495665_0025776 3300046531 Bacteria 3157
229 Ga0495665_0098434 3300046531 Bacteria 1536
230 Ga0495640_0000001 3300046533 Bacteria 853827
231 Ga0495640_0015948 3300046533 Bacteria 5637
232 Ga0495640_0049098 3300046533 Unclassified 2912
233 Ga0495587_0000004 3300046536 Bacteria 358433
234 Ga0495598_0002627 3300046537 Bacteria 3721
235 Ga0495645_0000001 3300046543 Bacteria 657910
236 Ga0495633_0055016 3300046558 Bacteria 1871
237 Ga0495667_0000009 3300046559 Bacteria 223329
238 Ga0495656_0014469 3300046615 Bacteria 2959
239 Ga0495668_0117130 3300046616 Bacteria 1457
240 Ga0495634_0000033 3300046642 Bacteria 109811
241 Ga0495611_0103920 3300046648 Bacteria 1321
242 Ga0495635_0000003 3300046663 Bacteria 390055
243 Ga0495661_0079627 3300046665 Bacteria 1893
244 Ga0495588_0106703 3300046674 Bacteria 1474
245 Ga0495657_0000112 3300046675 Bacteria 72999
246 Ga0495657_0115412 3300046675 Bacteria 1697
247 Ga0495599_0000012 3300046678 Bacteria 181156
248 Ga0495623_0000026 3300046679 Bacteria 90660
249 Ga0495646_0000005 3300046680 Bacteria 266899
250 Ga0495647_0040146 3300046681 Bacteria 1777
251 Ga0495613_0108857 3300046689 Unclassified 1998
252 Ga0495624_0028414 3300046690 Bacteria 3655
253 Ga0495624_0165057 3300046690 Bacteria 1352
254 Ga0495670_0017387 3300046691 Bacteria 3538
255 Ga0495600_0000003 3300046809 Bacteria 180457
256 Ga0495660_0143618 3300046810 Bacteria 1185
257 Ga0495581_0025749 3300047315 Bacteria 3411
258 Ga0495604_0000002 3300047317 Bacteria 530904
259 Ga0495674_0000004 3300047319 Bacteria 531855
260 Ga0495674_0101279 3300047319 Bacteria 2450
261 Ga0495676_0180459 3300047321 Bacteria 1480
262 Ga0495676_0250245 3300047321 Bacteria 1209
263 Ga0495680_0000129 3300047322 Bacteria 74623
264 Ga0495675_0000268 3300047444 Bacteria 37760
265 Ga0495675_0095399 3300047444 Bacteria 1865
266 Ga0495677_0014818 3300047445 Bacteria 2836
267 Ga0495684_0000019 3300047471 Bacteria 153938
268 Ga0495593_0000137 3300047673 Bacteria 35364
269 Ga0495593_0050775 3300047673 Bacteria 2196
270 Ga0495602_0000001 3300048088 Bacteria 510904
271 Ga0495602_0059076 3300048088 Bacteria 3351
272 Ga0496100_0004121 3300048903 Bacteria 7665
273 Ga0496100_0028207 3300048903 Bacteria 3461
274 Ga0496101_0002301 3300048904 Bacteria 11683
275 Ga0496101_0011088 3300048904 Bacteria 5973
276 Ga0496101_0015677 3300048904 Bacteria 5113
277 Ga0496101_0363736 3300048904 Bacteria 1137
278 Ga0496102_0001907 3300048905 Bacteria 17978
279 Ga0496102_0007993 3300048905 Bacteria 9039
280 Ga0496102_0037270 3300048905 Bacteria 4385
281 Ga0496102_0099392 3300048905 Bacteria 2700
282 Ga0496103_0066537 3300048906 Unclassified 2249
283 Ga0496103_0242963 3300048906 Bacteria 1158
284 Ga0496104_0001787 3300048907 Bacteria 18622
285 Ga0496104_0003321 3300048907 Bacteria 13883
286 Ga0496104_0004100 3300048907 Bacteria 12644
287 Ga0496104_0064968 3300048907 Bacteria 3462
288 Ga0496104_0156797 3300048907 Bacteria 2184
289 Ga0496104_0199917 3300048907 Bacteria 1910
290 Ga0496105_0001778 3300048908 Bacteria 15399
291 Ga0496105_0011008 3300048908 Bacteria 7130
292 Ga0496105_0012522 3300048908 Bacteria 6715
293 Ga0496105_0026567 3300048908 Bacteria 4724
294 Ga0496105_0110199 3300048908 Bacteria 2272
295 Ga0496105_0126532 3300048908 Bacteria 2106
296 Ga0496106_0001903 3300048909 Bacteria 15629
297 Ga0496106_0022600 3300048909 Bacteria 4675
298 Ga0496106_0046243 3300048909 Bacteria 3271
299 Ga0496106_0289114 3300048909 Bacteria 1314
300 Ga0496107_0000742 3300048910 Bacteria 18683
301 Ga0496107_0084093 3300048910 Bacteria 2321
302 Ga0496108_0004907 3300048911 Bacteria 10804
303 Ga0496108_0005149 3300048911 Bacteria 10570
304 Ga0496108_0012312 3300048911 Bacteria 6957
305 Ga0496108_0113936 3300048911 Bacteria 2314
306 Ga0496109_0001273 3300048912 Bacteria 20907
307 Ga0496109_0002185 3300048912 Bacteria 16231
308 Ga0496109_0042044 3300048912 Bacteria 4139
309 Ga0496109_0045609 3300048912 Bacteria 3978
310 Ga0496110_0001267 3300048913 Bacteria 18072
311 Ga0496110_0001439 3300048913 Bacteria 17212
312 Ga0496110_0008474 3300048913 Bacteria 8276
313 Ga0496110_0049989 3300048913 Bacteria 3670
314 Ga0496110_0299461 3300048913 Bacteria 1465
315 Ga0496111_0005865 3300048914 Bacteria 7920
316 Ga0496111_0011164 3300048914 Bacteria 6046
317 Ga0496111_0021366 3300048914 Bacteria 4518
318 Ga0496111_0112493 3300048914 Bacteria 2006
319 Ga0496111_0279234 3300048914 Bacteria 1239
320 Ga0496112_0002066 3300048915 Bacteria 15919
321 Ga0496112_0047470 3300048915 Bacteria 4212
322 Ga0496112_0228716 3300048915 Bacteria 1814
323 Ga0496113_0000303 3300048916 Bacteria 23409
324 Ga0496113_0099471 3300048916 Bacteria 2252
325 Ga0496113_0107369 3300048916 Bacteria 2169
326 Ga0496114_0034255 3300048917 Bacteria 4188
327 Ga0496114_0036960 3300048917 Bacteria 4037
328 Ga0496114_0074741 3300048917 Unclassified 2853
329 Ga0496114_0371724 3300048917 Bacteria 1265
330 Ga0496115_0046868 3300048918 Bacteria 3456
331 Ga0496115_0147274 3300048918 Bacteria 1943
332 Ga0496115_0479660 3300048918 Bacteria 1002
333 Ga0501031_0039636 3300049568 Bacteria 3075
334 Ga0501031_0110056 3300049568 Bacteria 1799
335 Ga0501033_0013590 3300049570 Bacteria 6197
336 Ga0501036_0037735 3300049572 Bacteria 4087
337 Ga0501036_0258202 3300049572 Bacteria 1460
338 Ga0501038_0218533 3300049574 Bacteria 1521
339 Ga0501039_0075978 3300049575 Bacteria 2612
340 Ga0501039_0203986 3300049575 Bacteria 1555
341 Ga0501041_0338091 3300049577 Bacteria 951
342 Ga0501042_0022700 3300049578 Bacteria 4384
343 Ga0501046_0143013 3300049580 Bacteria 1809
344 Ga0501046_0152187 3300049580 Bacteria 1745
345 Ga0501047_0082444 3300049581 Bacteria 3091
346 Ga0501048_0020365 3300049582 Bacteria 4861
347 Ga0501048_0050840 3300049582 Bacteria 2951
348 Ga0501048_0095929 3300049582 Bacteria 2092
349 Ga0501067_0067523 3300049583 Bacteria 1980
350 Ga0501068_0167865 3300049584 Bacteria 1384
351 Ga0501070_0024439 3300049586 Bacteria 5068
352 Ga0501071_0078814 3300049587 Bacteria 2408
353 Ga0501071_0252787 3300049587 Bacteria 1331
354 Ga0501071_0346350 3300049587 Bacteria 1130
355 Ga0501072_0019090 3300049588 Bacteria 5295
356 Ga0501072_0076716 3300049588 Bacteria 2644
357 Ga0501074_0057473 3300049590 Bacteria 2803
358 Ga0501074_0172408 3300049590 Unclassified 1544
359 Ga0501075_0019838 3300049591 Bacteria 4881
360 Ga0501075_0032573 3300049591 Bacteria 3873
361 Ga0501075_0073487 3300049591 Bacteria 2586
362 Ga0501075_0345836 3300049591 Bacteria 1133
363 Ga0501076_0020624 3300049592 Bacteria 5045
364 Ga0501076_0134828 3300049592 Bacteria 2004
365 Ga0501077_0111650 3300049593 Bacteria 1733
366 Ga0501077_0175905 3300049593 Bacteria 1360
367 Ga0501079_0021305 3300049741 Bacteria 4958
368 Ga0501079_0059627 3300049741 Bacteria 2943
369 Ga0501079_0118862 3300049741 Bacteria 2055
370 Ga0501079_0125471 3300049741 Bacteria 1997
371 Ga0501080_0088030 3300049742 Bacteria 2885
372 Ga0501081_0190533 3300049743 Bacteria 1485
373 Ga0501081_0247889 3300049743 Bacteria 1300
374 Ga0501081_0334639 3300049743 Bacteria 1114
375 Ga0501035_0190512 3300049822 Bacteria 1763
376 Ga0501035_0207181 3300049822 Bacteria 1679
377 Ga0501035_0323482 3300049822 Bacteria 1295
378 Ga0501044_0129600 3300049823 Bacteria 2517
379 Ga0501044_0282983 3300049823 Bacteria 1591
380 Ga0501045_0396943 3300049824 Bacteria 1026
381 nmdc:mga03683_21476_c1 3300050489 Bacteria 1982
382 nmdc:mga03n38_14102_c1 3300050490 Bacteria 3056
383 nmdc:mga0yw44_23391_c1 3300050492 Bacteria 3481
384 nmdc:mga0yw44_36988_c1 3300050492 Bacteria 2880
385 nmdc:mga05p37_10595_c1 3300050507 Bacteria 10933
386 nmdc:mga05p37_128688_c1 3300050507 Bacteria 3108
387 nmdc:mga05p37_24411_c1 3300050507 Bacteria 7347
388 nmdc:mga05p37_45362_c1 3300050507 Bacteria 5407
389 nmdc:mga05p37_64137_c1 3300050507 Bacteria 4520
390 nmdc:mga09592_175345_c1 3300050508 Bacteria 1854
391 nmdc:mga09592_254893_c1 3300050508 Unclassified 1521
392 nmdc:mga0qj67_233123_c1 3300050509 Bacteria 1494
393 nmdc:mga0qj67_7_c1 3300050509 Bacteria 146944
394 nmdc:mga06r32_28380_c1 3300050510 Bacteria 5235
395 nmdc:mga06r32_47274_c1 3300050510 Bacteria 4109
396 nmdc:mga06r32_4897_c1 3300050510 Bacteria 12061
397 nmdc:mga08y16_181785_c1 3300050511 Bacteria 2183
398 nmdc:mga08y16_32342_c1 3300050511 Bacteria 5500
399 nmdc:mga0n895_109175_c1 3300050512 Bacteria 2782
400 nmdc:mga0n895_218219_c1 3300050512 Bacteria 1936
401 nmdc:mga0n895_286064_c1 3300050512 Bacteria 1671
402 nmdc:mga0n895_402777_c1 3300050512 Bacteria 1384
403 nmdc:mga0rr50_477431_c1 3300050513 Bacteria 1059
404 Ga0495601_0000002 3300053077 Bacteria 528704
405 Ga0495601_0033688 3300053077 Bacteria 3192
406 Ga0495601_0153247 3300053077 Bacteria 1505
407 Ga0495612_0000012 3300053078 Bacteria 223883
408 Ga0495612_0066993 3300053078 Bacteria 1493
409 Ga0495595_0000012 3300053084 Bacteria 174322
410 Ga0495595_0039516 3300053084 Bacteria 2153
411 Ga0495595_0079060 3300053084 Bacteria 1564
412 Ga0495595_0079599 3300053084 Bacteria 1559
413 Ga0495619_0000003 3300053085 Bacteria 515784
414 Ga0501084_0001517 3300054114 Bacteria 18424
415 Ga0501084_0031886 3300054114 Bacteria 4407
416 Ga0501082_0054779 3300060353 Bacteria 3438
417 Ga0501082_0291357 3300060353 Bacteria 1421
418 Ga0501082_0342766 3300060353 Bacteria 1302
419 Ga0501082_0569957 3300060353 Bacteria 990
420 Ga0466962_0061028 3300061719 Bacteria 1800
421 Ga0530510_0015708 3300061734 Bacteria 5351
422 Ga0530510_0041812 3300061734 Bacteria 3310
423 Ga0530510_0041954 3300061734 Bacteria 3304
424 2508734461 2508501050 Bacteria 9633614
425 2644737612 2643221734 Bacteria 5365412
426 2738743478 2738541281 Bacteria 5112672
427 2739352385 2738543032 Bacteria 5115625
428 2774869540 2773857925 Bacteria 6472445
429 2776257277 2775506901 Bacteria 9631051
430 2835314410 2835312727 Bacteria 7413381
431 2842698632 2842698319 Bacteria 5190321
432 2882458791 2882456835 Bacteria 6863978
433 2884298283 2884298095 Bacteria 3823049
434 2894241230 2894232714 Bacteria 8834183
435 3003669083 3003665799 Bacteria 7279786
436 641640377 641522639 Bacteria 7737025
437 643597815 643348564 Bacteria 8839022
438 Ga0105245_10102816
439 rootH1_10106330
440 Ga0070670_100058543
441 Ga0068869_100033528
442 Ga0070666_10034663
443 Ga0068868_100022983
444 Ga0068868_100164585
445 Ga0070661_100030673
446 Ga0070668_100078924
447 Ga0070669_100112616
448 Ga0070667_100013697
449 Ga0070709_10074621
450 Ga0070714_100009251
451 Ga0070713_100011742
452 Ga0070713_100168787
453 Ga0070710_10014757
454 Ga0070710_10184096
455 Ga0070701_10022673
456 Ga0070711_100034819
457 Ga0070662_100007330
458 Ga0068867_100091166
459 Ga0070706_100465773
460 Ga0070698_100146753
461 Ga0068853_100065423
462 Ga0070672_100410393
463 Ga0070686_100008180
464 Ga0070695_100005074
465 Ga0070696_100133210
466 Ga0070664_100058372
467 Ga0070702_100179144
468 Ga0068852_100220189
469 Ga0068859_100014661
470 Ga0068866_10002755
471 Ga0068861_100031239
472 Ga0068861_100098047
473 Ga0068863_100169827
474 Ga0081455_10005582
475 Ga0081538_10025304
476 Ga0081540_1000032
477 Ga0081539_10019998
478 Ga0070717_10147962
479 Ga0070717_10463812
480 Ga0075365_10079656
481 Ga0075365_10131705
482 Ga0075363_100017020
483 Ga0070715_10000896
484 Ga0070716_100007056
485 Ga0070712_100000165
486 Ga0070712_100038299
487 Ga0070712_100226770
488 Ga0068871_100095330
489 Ga0075428_100157800
490 Ga0075428_100526427
491 Ga0075430_100000821
492 Ga0075430_100026606
493 Ga0075431_100036436
494 Ga0075431_100075329
495 Ga0075431_100211345
496 Ga0075434_100013846
497 Ga0075434_100016976
498 Ga0075434_100113923
499 Ga0075429_100035014
500 Ga0075429_100150599
501 Ga0075429_100401069
502 Ga0075436_100069091
503 Ga0097620_100014660
504 Ga0075435_100065785
505 Ga0075435_100141042
506 Ga0075435_100186404
507 Ga0075435_100264251
508 Ga0099794_10090216
509 Ga0111539_10131964
510 Ga0111539_10179891
511 Ga0111539_10194521
512 Ga0111539_10204364
513 Ga0105245_10214169
514 Ga0105247_10006172
515 Ga0114129_10011285
516 Ga0114129_10038749
517 Ga0114129_10071187
518 Ga0114129_10479030
519 Ga0105243_10056774
520 Ga0105242_10072007
521 Ga0105248_10020474
522 Ga0105248_10050919
523 Ga0105237_10035802
524 Ga0105249_10018832
525 Ga0105239_10164771
526 Ga0157374_10002466
527 Ga0157374_10273954
528 Ga0163163_10053005
529 Ga0163163_10213910
530 Ga0157380_10224478
531 Ga0157379_10043843
532 Ga0157379_10457580
533 Ga0163161_10033692
534 Ga0224572_1011707
535 Ga0207692_10008624
536 Ga0207692_10157652
537 Ga0207710_10017012
538 Ga0207688_10000117
539 Ga0207688_10024528
540 Ga0207680_10112027
541 Ga0207647_10015624
542 Ga0207699_10007287
543 Ga0207643_10000291
544 Ga0207684_10398025
545 Ga0207693_10006232
546 Ga0207693_10006770
547 Ga0207693_10207868
548 Ga0207693_10279578
549 Ga0207693_10285589
550 Ga0207663_10019637
551 Ga0207662_10004840
552 Ga0207657_10037546
553 Ga0207652_10206391
554 Ga0207650_10007981
555 Ga0207650_10037956
556 Ga0207687_10205609
557 Ga0207700_10000458
558 Ga0207664_10031202
559 Ga0207644_10032511
560 Ga0207706_10373489
561 Ga0207670_10031516
562 Ga0207669_10014161
563 Ga0207665_10006165
564 Ga0207665_10024600
565 Ga0207691_10012255
566 Ga0207711_10039010
567 Ga0207689_10002877
568 Ga0207661_10099866
569 Ga0207679_10076308
570 Ga0207651_10018905
571 Ga0207668_10005839
572 Ga0207668_10138395
573 Ga0207668_10280253
574 Ga0207677_10061643
575 Ga0207703_10061763
576 Ga0207708_10001828
577 Ga0207708_10183747
578 Ga0207641_10020581
579 Ga0207648_10145861
580 Ga0207648_10156136
581 Ga0207676_10375581
582 Ga0207683_10036001
583 Ga0268266_10030720
584 Ga0268265_10031473
585 Ga0268264_10078844
586 Ga0265760_10036223
587 Ga0316575_10003861
588 Ga0316579_10016074
589 Ga0316576_10115359
590 Ga0316576_10130885
591 Ga0316578_10022830
592 Ga0316578_10083458
593 Ga0316577_10095340
594 Ga0316577_10172540
595 Ga0307410_10205439
596 Ga0307409_100457600
597 Ga0316585_10044677
598 Ga0316580_10014519
599 Ga0373952_0033036
600 Ga0373946_0006727
601 Ga0373946_0077756
602 Ga0373955_0007178
603 Ga0316574_0096072
604 Ga0373924_0006143
605 Ga0373931_0185692
606 Ga0373935_0000454
607 Ga0373935_0157404
608 Ga0373935_0218724
609 Ga0373927_0013081
610 Ga0373927_0085781
611 Ga0373927_0205640
612 Ga0373927_0299979
613 Ga0373933_0002060
614 Ga0373947_0008199
615 Ga0373947_0145167
616 Ga0373947_0230401
617 Ga0373937_0000089
618 Ga0373937_0123732
619 Ga0316582_0141959
620 Ga0316584_0015212
621 Ga0316584_0113076
622 Ga0373925_0000016
623 Ga0395899_0003124
624 Ga0395900_0001182
625 Ga0395900_0072980
626 Ga0395900_0081703
627 Ga0395900_0314121
628 Ga0395898_0016185
629 Ga0395898_0128715
630 Ga0395898_0131992
631 Ga0395905_0010942
632 Ga0395905_0257108
633 Ga0436364_0574792
634 Ga0395901_0009068
635 Ga0395901_0023566
636 Ga0395901_0064829
637 Ga0395901_0203904
638 Ga0395901_0217943
639 Ga0439466_0086160
640 Ga0466966_0030301
641 Ga0466961_0081002
642 Ga0466967_0096051
643 Ga0495592_0001282
644 Ga0495629_0009971
645 Ga0495651_0002468
646 Ga0495651_0170297
647 Ga0495653_0000022
648 Ga0495580_0208744
649 Ga0495662_0000552
650 Ga0495662_0128930
651 Ga0495662_0153972
652 Ga0495664_0000013
653 Ga0495584_0002262
654 Ga0495585_0004639
655 Ga0495594_0080925
656 Ga0495596_0039934
657 Ga0495608_0000004
658 Ga0495618_0000032
659 Ga0495628_0000014
660 Ga0495630_0008555
661 Ga0495630_0217896
662 Ga0495644_0058726
663 Ga0495652_0000002
664 Ga0495652_0029463
665 Ga0495665_0025776
666 Ga0495665_0098434
667 Ga0495640_0000001
668 Ga0495640_0015948
669 Ga0495640_0049098
670 Ga0495587_0000004
671 Ga0495598_0002627
672 Ga0495645_0000001
673 Ga0495633_0055016
674 Ga0495667_0000009
675 Ga0495656_0014469
676 Ga0495668_0117130
677 Ga0495634_0000033
678 Ga0495611_0103920
679 Ga0495635_0000003
680 Ga0495661_0079627
681 Ga0495588_0106703
682 Ga0495657_0000112
683 Ga0495657_0115412
684 Ga0495599_0000012
685 Ga0495623_0000026
686 Ga0495646_0000005
687 Ga0495647_0040146
688 Ga0495613_0108857
689 Ga0495624_0028414
690 Ga0495624_0165057
691 Ga0495670_0017387
692 Ga0495600_0000003
693 Ga0495660_0143618
694 Ga0495581_0025749
695 Ga0495604_0000002
696 Ga0495674_0000004
697 Ga0495674_0101279
698 Ga0495676_0180459
699 Ga0495676_0250245
700 Ga0495680_0000129
701 Ga0495675_0000268
702 Ga0495675_0095399
703 Ga0495677_0014818
704 Ga0495684_0000019
705 Ga0495593_0000137
706 Ga0495593_0050775
707 Ga0495602_0000001
708 Ga0495602_0059076
709 Ga0496100_0004121
710 Ga0496100_0028207
711 Ga0496101_0002301
712 Ga0496101_0011088
713 Ga0496101_0015677
714 Ga0496101_0363736
715 Ga0496102_0001907
716 Ga0496102_0007993
717 Ga0496102_0037270
718 Ga0496102_0099392
719 Ga0496103_0066537
720 Ga0496103_0242963
721 Ga0496104_0001787
722 Ga0496104_0003321
723 Ga0496104_0004100
724 Ga0496104_0064968
725 Ga0496104_0156797
726 Ga0496104_0199917
727 Ga0496105_0001778
728 Ga0496105_0011008
729 Ga0496105_0012522
730 Ga0496105_0026567
731 Ga0496105_0110199
732 Ga0496105_0126532
733 Ga0496106_0001903
734 Ga0496106_0022600
735 Ga0496106_0046243
736 Ga0496106_0289114
737 Ga0496107_0000742
738 Ga0496107_0084093
739 Ga0496108_0004907
740 Ga0496108_0005149
741 Ga0496108_0012312
742 Ga0496108_0113936
743 Ga0496109_0001273
744 Ga0496109_0002185
745 Ga0496109_0042044
746 Ga0496109_0045609
747 Ga0496110_0001267
748 Ga0496110_0001439
749 Ga0496110_0008474
750 Ga0496110_0049989
751 Ga0496110_0299461
752 Ga0496111_0005865
753 Ga0496111_0011164
754 Ga0496111_0021366
755 Ga0496111_0112493
756 Ga0496111_0279234
757 Ga0496112_0002066
758 Ga0496112_0047470
759 Ga0496112_0228716
760 Ga0496113_0000303
761 Ga0496113_0099471
762 Ga0496113_0107369
763 Ga0496114_0034255
764 Ga0496114_0036960
765 Ga0496114_0074741
766 Ga0496114_0371724
767 Ga0496115_0046868
768 Ga0496115_0147274
769 Ga0496115_0479660
770 Ga0501031_0039636
771 Ga0501031_0110056
772 Ga0501033_0013590
773 Ga0501036_0037735
774 Ga0501036_0258202
775 Ga0501038_0218533
776 Ga0501039_0075978
777 Ga0501039_0203986
778 Ga0501041_0338091
779 Ga0501042_0022700
780 Ga0501046_0143013
781 Ga0501046_0152187
782 Ga0501047_0082444
783 Ga0501048_0020365
784 Ga0501048_0050840
785 Ga0501048_0095929
786 Ga0501067_0067523
787 Ga0501068_0167865
788 Ga0501070_0024439
789 Ga0501071_0078814
790 Ga0501071_0252787
791 Ga0501071_0346350
792 Ga0501072_0019090
793 Ga0501072_0076716
794 Ga0501074_0057473
795 Ga0501074_0172408
796 Ga0501075_0019838
797 Ga0501075_0032573
798 Ga0501075_0073487
799 Ga0501075_0345836
800 Ga0501076_0020624
801 Ga0501076_0134828
802 Ga0501077_0111650
803 Ga0501077_0175905
804 Ga0501079_0021305
805 Ga0501079_0059627
806 Ga0501079_0118862
807 Ga0501079_0125471
808 Ga0501080_0088030
809 Ga0501081_0190533
810 Ga0501081_0247889
811 Ga0501081_0334639
812 Ga0501035_0190512
813 Ga0501035_0207181
814 Ga0501035_0323482
815 Ga0501044_0129600
816 Ga0501044_0282983
817 Ga0501045_0396943
818 nmdc:mga03683_21476_c1
819 nmdc:mga03n38_14102_c1
820 nmdc:mga0yw44_23391_c1
821 nmdc:mga0yw44_36988_c1
822 nmdc:mga05p37_10595_c1
823 nmdc:mga05p37_128688_c1
824 nmdc:mga05p37_24411_c1
825 nmdc:mga05p37_45362_c1
826 nmdc:mga05p37_64137_c1
827 nmdc:mga09592_175345_c1
828 nmdc:mga09592_254893_c1
829 nmdc:mga0qj67_233123_c1
830 nmdc:mga0qj67_7_c1
831 nmdc:mga06r32_28380_c1
832 nmdc:mga06r32_47274_c1
833 nmdc:mga06r32_4897_c1
834 nmdc:mga08y16_181785_c1
835 nmdc:mga08y16_32342_c1
836 nmdc:mga0n895_109175_c1
837 nmdc:mga0n895_218219_c1
838 nmdc:mga0n895_286064_c1
839 nmdc:mga0n895_402777_c1
840 nmdc:mga0rr50_477431_c1
841 Ga0495601_0000002
842 Ga0495601_0033688
843 Ga0495601_0153247
844 Ga0495612_0000012
845 Ga0495612_0066993
846 Ga0495595_0000012
847 Ga0495595_0039516
848 Ga0495595_0079060
849 Ga0495595_0079599
850 Ga0495619_0000003
851 Ga0501084_0001517
852 Ga0501084_0031886
853 Ga0501082_0054779
854 Ga0501082_0291357
855 Ga0501082_0342766
856 Ga0501082_0569957
857 Ga0466962_0061028
858 Ga0530510_0015708
859 Ga0530510_0041812
860 Ga0530510_0041954
861 2508734461
862 2644737612
863 2738743478
864 2739352385
865 2774869540
866 2776257277
867 2835314410
868 2842698632
869 2882458791
870 2884298283
871 2894241230
872 3003669083
873 641640377
874 643597815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

15

232

0.88

PF05368

NmrA

NmrA-like family

18

132

0.88

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

19

169

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

18

238

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

19

237

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

22

197

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8866 5 309
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8801 5 309
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.877 5 307
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8706 5 309
3m2p-assembly3.cif.gz_E the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8671 5 308
ID Description Score Start End Superfamily
af_K7VJC9_94_197_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9492 5 35 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8684 5 40 3.50.50.60
3m2pE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8658 5 308 3.40.50.720
3m2pE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8595 5 308 3.40.50.720
3sc6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8559 2 229 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2G8MH58-F1-model_v4 deleted 0.9642 188 308
AF-A0A1Q3QFD4-F1-model_v4 deleted 0.9547 61 306
AF-A0A2G8MH58-F1-model_v4 deleted 0.949 188 308
AF-W2TXR6-F1-model_v4 Putative epimerase/dehydratase WbiG 0.947 82 312
AF-A0A1E3W2W6-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9445 7 308

Map