F443759

General Info

Members Datasets Scaffolds Average Seq Length
437 225 874 360

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10006564|Ga0105242_100065642
Length 375
Sequence MRIERAAIRHEGAAMKHDHAPVILDVAGLALDAADRRRLAHPLTGGIVLFARNWRDRLQLTELVAEAKSIRPDLLVCVDHEGGRVQRFRSDGFTALPPMRSLGTMWMNDGGHGAGAGAMRALEAARATGHVLGAELRACGVDLSFTPVLDLDHGASGVIGDRAFHRDPRVVSMLARSLALGLLQAGMHNCGKHFPGHGFVRADSHLEIPVDDRPLKRILADDARPYEWLAGTLASVMPAHVIYPRVDSRPAGFSARWLREILRVDLGFDGAIFSDDLSMAGARRIGDVEVSYAEAAALALAAGCDMVLLCNQSLDGGAAVDALLEALLAAQAAGGWEANPDSERRRLDLLPQTAPVAWDDLMHQPSYQRSLERLP

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
174 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
175 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
222 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
223 2831864461 Roseateles noduli HZ7 Isolate Nodule
224 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
225 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.85
Nodule 1.14
Rhizoplane 2.52
Rhizosphere 73.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10006564 3300009176 Bacteria 8960
2 rootL2_10013481 3300003322 Bacteria 10192
3 rootH1_10044193 3300003323 Bacteria 6802
4 rootH1_10044196 3300003323 Bacteria 15532
5 Ga0055526_1001752 3300003771 Bacteria 15065
6 Ga0055524_1000121 3300003775 Bacteria 91150
7 Ga0055524_1002354 3300003775 Bacteria 9829
8 Ga0055530_10000515 3300003791 Bacteria 33601
9 Ga0055540_1000001 3300003792 Bacteria 466834
10 Ga0055531_10000730 3300003794 Bacteria 27806
11 Ga0055531_10008874 3300003794 Bacteria 5223
12 Ga0055531_10012364 3300003794 Bacteria 4023
13 Ga0055531_10015992 3300003794 Bacteria 3267
14 Ga0055543_1004765 3300004625 Bacteria 3613
15 Ga0065165_1000016 3300005262 Bacteria 286248
16 Ga0065165_1002352 3300005262 Bacteria 16400
17 Ga0065707_10093354 3300005295 Bacteria 3639
18 Ga0070658_10137350 3300005327 Bacteria 2041
19 Ga0070658_10270173 3300005327 Bacteria 1446
20 Ga0070676_10031398 3300005328 Bacteria 3035
21 Ga0070683_100013208 3300005329 Bacteria 7194
22 Ga0070683_100186556 3300005329 Bacteria 1969
23 Ga0070690_100036884 3300005330 Bacteria 3076
24 Ga0070670_100008161 3300005331 Bacteria 8917
25 Ga0070670_100057570 3300005331 Bacteria 3336
26 Ga0070670_100101782 3300005331 Bacteria 2473
27 Ga0070670_100107001 3300005331 Bacteria 2410
28 Ga0070670_100111591 3300005331 Bacteria 2356
29 Ga0068869_100006018 3300005334 Bacteria 7673
30 Ga0068869_100068467 3300005334 Bacteria 2622
31 Ga0068869_100136426 3300005334 Bacteria 1891
32 Ga0070666_10005842 3300005335 Bacteria 7558
33 Ga0070680_100025391 3300005336 Bacteria 4735
34 Ga0068868_100025650 3300005338 Bacteria 4486
35 Ga0068868_100027684 3300005338 Bacteria 4325
36 Ga0068868_100044655 3300005338 Bacteria 3465
37 Ga0070660_100073646 3300005339 Bacteria 2671
38 Ga0070661_100015864 3300005344 Bacteria 5315
39 Ga0070668_100011100 3300005347 Bacteria 6705
40 Ga0070668_100039496 3300005347 Bacteria 3609
41 Ga0070669_100008914 3300005353 Bacteria 7156
42 Ga0070669_100055568 3300005353 Bacteria 2901
43 Ga0070675_100004779 3300005354 Bacteria 10332
44 Ga0070675_100010417 3300005354 Bacteria 7263
45 Ga0070675_100011548 3300005354 Bacteria 6918
46 Ga0070675_100017314 3300005354 Bacteria 5725
47 Ga0070675_100025466 3300005354 Bacteria 4742
48 Ga0070675_100169245 3300005354 Bacteria 1883
49 Ga0070675_100199901 3300005354 Bacteria 1734
50 Ga0070671_100008478 3300005355 Bacteria 8238
51 Ga0070671_100012328 3300005355 Bacteria 6883
52 Ga0070671_100035021 3300005355 Bacteria 4158
53 Ga0070671_100314021 3300005355 Bacteria 1335
54 Ga0070671_100342189 3300005355 Bacteria 1276
55 Ga0070674_100004964 3300005356 Bacteria 7624
56 Ga0070673_100007810 3300005364 Bacteria 7083
57 Ga0070673_100050422 3300005364 Bacteria 3255
58 Ga0070673_100065168 3300005364 Bacteria 2905
59 Ga0070673_100067571 3300005364 Bacteria 2859
60 Ga0070659_100005335 3300005366 Bacteria 9220
61 Ga0070667_100002053 3300005367 Bacteria 17829
62 Ga0070667_100015048 3300005367 Bacteria 6392
63 Ga0070667_100042339 3300005367 Bacteria 3821
64 Ga0070667_100117883 3300005367 Bacteria 2307
65 Ga0070667_100132163 3300005367 Bacteria 2179
66 Ga0070663_100049975 3300005455 Bacteria 2972
67 Ga0070678_100035116 3300005456 Bacteria 3497
68 Ga0070678_100132828 3300005456 Bacteria 1980
69 Ga0070662_100008631 3300005457 Bacteria 6650
70 Ga0070662_100012119 3300005457 Bacteria 5708
71 Ga0070662_100028919 3300005457 Bacteria 3863
72 Ga0068867_100006721 3300005459 Bacteria 8131
73 Ga0068867_100020479 3300005459 Bacteria 4714
74 Ga0068867_100043063 3300005459 Bacteria 3304
75 Ga0068867_100085295 3300005459 Bacteria 2387
76 Ga0068867_100255468 3300005459 Bacteria 1427
77 Ga0070679_100021665 3300005530 Bacteria 6276
78 Ga0070679_100042059 3300005530 Bacteria 4550
79 Ga0068853_100062068 3300005539 Bacteria 3233
80 Ga0068853_100113703 3300005539 Bacteria 2407
81 Ga0070672_100002031 3300005543 Bacteria 12729
82 Ga0070672_100007063 3300005543 Bacteria 7594
83 Ga0070672_100010437 3300005543 Bacteria 6445
84 Ga0070672_100080388 3300005543 Bacteria 2611
85 Ga0070672_100101071 3300005543 Bacteria 2339
86 Ga0070672_100247841 3300005543 Bacteria 1500
87 Ga0070664_100005762 3300005564 Bacteria 9989
88 Ga0070664_100016787 3300005564 Bacteria 6008
89 Ga0070664_100025177 3300005564 Bacteria 4930
90 Ga0070664_100128859 3300005564 Bacteria 2222
91 Ga0068857_100107336 3300005577 Bacteria 2508
92 Ga0068857_100190966 3300005577 Bacteria 1865
93 Ga0068854_100025152 3300005578 Bacteria 4085
94 Ga0068854_100043140 3300005578 Bacteria 3195
95 Ga0068856_100009753 3300005614 Bacteria 9329
96 Ga0068856_100215634 3300005614 Bacteria 1935
97 Ga0068852_100017004 3300005616 Bacteria 5694
98 Ga0068852_100037453 3300005616 Bacteria 4066
99 Ga0068852_100246599 3300005616 Bacteria 1709
100 Ga0068859_100226275 3300005617 Bacteria 1959
101 Ga0068864_100009971 3300005618 Bacteria 7838
102 Ga0068864_100020710 3300005618 Bacteria 5504
103 Ga0068864_100032590 3300005618 Bacteria 4428
104 Ga0068864_100173460 3300005618 Bacteria 1968
105 Ga0068866_10002843 3300005718 Bacteria 7136
106 Ga0068861_100001754 3300005719 Bacteria 13938
107 Ga0068851_10034263 3300005834 Bacteria 2533
108 Ga0068851_10147085 3300005834 Bacteria 1285
109 Ga0068863_100008147 3300005841 Bacteria 10232
110 Ga0068858_100029185 3300005842 Bacteria 5121
111 Ga0068858_100032464 3300005842 Bacteria 4847
112 Ga0068858_100035860 3300005842 Bacteria 4599
113 Ga0068860_100010210 3300005843 Bacteria 9293
114 Ga0068860_100012046 3300005843 Bacteria 8517
115 Ga0068862_100075506 3300005844 Bacteria 2915
116 Ga0068862_100281870 3300005844 Bacteria 1523
117 Ga0075368_10004315 3300006042 Bacteria 4808
118 Ga0075368_10024402 3300006042 Bacteria 2316
119 Ga0075368_10037262 3300006042 Bacteria 1901
120 Ga0075363_100025267 3300006048 Bacteria 3028
121 Ga0075364_10006775 3300006051 Bacteria 6756
122 Ga0075364_10063712 3300006051 Bacteria 2420
123 Ga0070715_10074880 3300006163 Bacteria 1522
124 Ga0075362_10010920 3300006177 Bacteria 3563
125 Ga0075362_10015345 3300006177 Bacteria 3114
126 Ga0075367_10013686 3300006178 Bacteria 4370
127 Ga0075367_10013850 3300006178 Bacteria 4351
128 Ga0075366_10004389 3300006195 Bacteria 7569
129 Ga0075366_10006193 3300006195 Bacteria 6529
130 Ga0075366_10020276 3300006195 Bacteria 3856
131 Ga0075366_10022784 3300006195 Bacteria 3646
132 Ga0075366_10027483 3300006195 Bacteria 3338
133 Ga0075366_10027485 3300006195 Bacteria 3338
134 Ga0075366_10041096 3300006195 Bacteria 2737
135 Ga0097621_100024414 3300006237 Bacteria 4720
136 Ga0097621_100041515 3300006237 Bacteria 3703
137 Ga0075370_10002177 3300006353 Bacteria 8992
138 Ga0075370_10013105 3300006353 Bacteria 4398
139 Ga0075370_10040870 3300006353 Bacteria 2617
140 Ga0075370_10045271 3300006353 Bacteria 2488
141 Ga0068871_100005973 3300006358 Bacteria 8569
142 Ga0068871_100006732 3300006358 Bacteria 8160
143 Ga0097620_100226278 3300006931 Bacteria 1959
144 Ga0099823_1000021 3300006944 Bacteria 76133
145 Ga0079104_1000001 3300006946 Bacteria 521847
146 Ga0105240_10002389 3300009093 Bacteria 30277
147 Ga0105240_10060597 3300009093 Bacteria 4718
148 Ga0105240_10148546 3300009093 Bacteria 2793
149 Ga0111539_10257504 3300009094 Bacteria 2032
150 Ga0105245_10123515 3300009098 Bacteria 2421
151 Ga0105243_10109870 3300009148 Bacteria 2304
152 Ga0105248_10010877 3300009177 Bacteria 10046
153 Ga0105248_10035875 3300009177 Bacteria 5547
154 Ga0105237_10001228 3300009545 Bacteria 34145
155 Ga0105237_10229268 3300009545 Bacteria 1858
156 Ga0105238_10038345 3300009551 Bacteria 4866
157 Ga0105238_10422771 3300009551 Bacteria 1327
158 Ga0105249_10068937 3300009553 Bacteria 3263
159 Ga0105239_10000942 3300010375 Bacteria 41042
160 Ga0157319_1000008 3300012497 Bacteria 315600
161 Ga0157371_10065465 3300013102 Bacteria 2574
162 Ga0157371_10194240 3300013102 Bacteria 1454
163 Ga0157370_10089028 3300013104 Bacteria 2899
164 Ga0157374_10012674 3300013296 Bacteria 7342
165 Ga0163162_10009814 3300013306 Bacteria 9317
166 Ga0163162_10015375 3300013306 Bacteria 7477
167 Ga0163162_10015380 3300013306 Bacteria 7475
168 Ga0163162_10162788 3300013306 Bacteria 2353
169 Ga0157372_10057881 3300013307 Bacteria 4333
170 Ga0157375_10039310 3300013308 Bacteria 4553
171 Ga0157375_10062939 3300013308 Bacteria 3689
172 Ga0157375_10093843 3300013308 Bacteria 3068
173 Ga0157375_10102612 3300013308 Bacteria 2946
174 Ga0157375_10158698 3300013308 Bacteria 2403
175 Ga0157375_10262258 3300013308 Bacteria 1889
176 Ga0163163_10180996 3300014325 Bacteria 2155
177 Ga0157380_10012326 3300014326 Bacteria 6201
178 Ga0157380_10047810 3300014326 Bacteria 3367
179 Ga0157377_10002823 3300014745 Bacteria 7749
180 Ga0157379_10022800 3300014968 Bacteria 5548
181 Ga0157379_10030462 3300014968 Bacteria 4803
182 Ga0157379_10043791 3300014968 Bacteria 3996
183 Ga0157379_10046178 3300014968 Bacteria 3887
184 Ga0157379_10096825 3300014968 Bacteria 2648
185 Ga0157379_10140733 3300014968 Bacteria 2175
186 Ga0157376_10010115 3300014969 Bacteria 6889
187 Ga0163161_10027884 3300017792 Bacteria 4007
188 Ga0209673_1011533 3300025273 Bacteria 3637
189 Ga0209673_1011821 3300025273 Bacteria 3568
190 Ga0209564_1000008 3300025295 Bacteria 953227
191 Ga0209050_1000934 3300025298 Bacteria 38215
192 Ga0209050_1010184 3300025298 Bacteria 4672
193 Ga0209256_1000015 3300025299 Bacteria 622953
194 Ga0209256_1001723 3300025299 Bacteria 20972
195 Ga0209256_1001935 3300025299 Bacteria 18873
196 Ga0209051_1000018 3300025303 Bacteria 527061
197 Ga0209051_1000244 3300025303 Bacteria 91505
198 Ga0209051_1002679 3300025303 Bacteria 12440
199 Ga0209257_1000084 3300025304 Bacteria 291502
200 Ga0209257_1000144 3300025304 Bacteria 197078
201 Ga0209257_1007729 3300025304 Bacteria 6404
202 Ga0209257_1012179 3300025304 Bacteria 4018
203 Ga0207642_10004772 3300025899 Bacteria 4379
204 Ga0207688_10205072 3300025901 Bacteria 1183
205 Ga0207680_10045362 3300025903 Bacteria 2591
206 Ga0207645_10003842 3300025907 Bacteria 11246
207 Ga0207645_10011283 3300025907 Bacteria 6107
208 Ga0207645_10023842 3300025907 Bacteria 3972
209 Ga0207645_10057865 3300025907 Bacteria 2475
210 Ga0207705_10122504 3300025909 Bacteria 1931
211 Ga0207707_10142327 3300025912 Bacteria 2097
212 Ga0207695_10011810 3300025913 Bacteria 10537
213 Ga0207671_10095082 3300025914 Bacteria 2250
214 Ga0207660_10071448 3300025917 Bacteria 2525
215 Ga0207660_10265729 3300025917 Bacteria 1358
216 Ga0207662_10002309 3300025918 Bacteria 9551
217 Ga0207662_10024514 3300025918 Bacteria 3471
218 Ga0207657_10017805 3300025919 Bacteria 6802
219 Ga0207649_10000359 3300025920 Bacteria 34180
220 Ga0207649_10145829 3300025920 Bacteria 1625
221 Ga0207652_10069211 3300025921 Bacteria 3064
222 Ga0207681_10004142 3300025923 Bacteria 8988
223 Ga0207681_10071729 3300025923 Bacteria 2417
224 Ga0207681_10072873 3300025923 Bacteria 2400
225 Ga0207650_10099348 3300025925 Bacteria 2237
226 Ga0207650_10121601 3300025925 Bacteria 2033
227 Ga0207659_10009237 3300025926 Bacteria 6156
228 Ga0207659_10038145 3300025926 Bacteria 3340
229 Ga0207659_10204037 3300025926 Bacteria 1581
230 Ga0207687_10240838 3300025927 Bacteria 1433
231 Ga0207644_10001574 3300025931 Bacteria 14734
232 Ga0207644_10015626 3300025931 Bacteria 5099
233 Ga0207644_10042686 3300025931 Bacteria 3215
234 Ga0207644_10057128 3300025931 Bacteria 2817
235 Ga0207644_10082148 3300025931 Bacteria 2383
236 Ga0207644_10087115 3300025931 Bacteria 2320
237 Ga0207644_10129042 3300025931 Bacteria 1933
238 Ga0207644_10135935 3300025931 Bacteria 1887
239 Ga0207644_10169155 3300025931 Bacteria 1705
240 Ga0207690_10018071 3300025932 Bacteria 4319
241 Ga0207706_10004316 3300025933 Bacteria 13357
242 Ga0207706_10058121 3300025933 Bacteria 3407
243 Ga0207706_10067354 3300025933 Bacteria 3150
244 Ga0207706_10071172 3300025933 Bacteria 3059
245 Ga0207706_10076876 3300025933 Bacteria 2936
246 Ga0207669_10029113 3300025937 Bacteria 3049
247 Ga0207669_10082043 3300025937 Bacteria 2069
248 Ga0207704_10023865 3300025938 Bacteria 3305
249 Ga0207691_10006932 3300025940 Bacteria 10926
250 Ga0207691_10007996 3300025940 Bacteria 10168
251 Ga0207691_10036430 3300025940 Bacteria 4558
252 Ga0207691_10083229 3300025940 Bacteria 2873
253 Ga0207711_10069139 3300025941 Bacteria 3060
254 Ga0207711_10085801 3300025941 Bacteria 2759
255 Ga0207689_10007087 3300025942 Bacteria 9854
256 Ga0207689_10009559 3300025942 Bacteria 8364
257 Ga0207689_10013353 3300025942 Bacteria 7009
258 Ga0207689_10023269 3300025942 Bacteria 5202
259 Ga0207679_10000047 3300025945 Bacteria 119891
260 Ga0207679_10040394 3300025945 Bacteria 3339
261 Ga0207651_10085580 3300025960 Bacteria 2288
262 Ga0207712_10150548 3300025961 Bacteria 1797
263 Ga0207668_10018589 3300025972 Bacteria 4378
264 Ga0207668_10029872 3300025972 Bacteria 3577
265 Ga0207640_10014714 3300025981 Bacteria 4510
266 Ga0207640_10026671 3300025981 Bacteria 3511
267 Ga0207640_10141546 3300025981 Bacteria 1754
268 Ga0207640_10330777 3300025981 Bacteria 1217
269 Ga0207658_10003013 3300025986 Bacteria 12045
270 Ga0207658_10003655 3300025986 Bacteria 10853
271 Ga0207658_10027918 3300025986 Bacteria 3970
272 Ga0207658_10033970 3300025986 Bacteria 3641
273 Ga0207677_10085727 3300026023 Bacteria 2274
274 Ga0207677_10107364 3300026023 Bacteria 2070
275 Ga0207703_10004035 3300026035 Bacteria 12135
276 Ga0207639_10060740 3300026041 Bacteria 2917
277 Ga0207639_10118892 3300026041 Bacteria 2168
278 Ga0207678_10006013 3300026067 Bacteria 10798
279 Ga0207641_10004568 3300026088 Bacteria 11965
280 Ga0207641_10037683 3300026088 Bacteria 4039
281 Ga0207641_10191199 3300026088 Bacteria 1881
282 Ga0207648_10002295 3300026089 Bacteria 20666
283 Ga0207648_10012908 3300026089 Bacteria 7801
284 Ga0207648_10015894 3300026089 Bacteria 6899
285 Ga0207648_10055444 3300026089 Bacteria 3460
286 Ga0207648_10074405 3300026089 Bacteria 2960
287 Ga0207648_10300577 3300026089 Bacteria 1439
288 Ga0207676_10008687 3300026095 Bacteria 7223
289 Ga0207676_10015345 3300026095 Bacteria 5522
290 Ga0207676_10043099 3300026095 Bacteria 3472
291 Ga0207676_10084831 3300026095 Bacteria 2583
292 Ga0207674_10078380 3300026116 Bacteria 3309
293 Ga0207674_10093640 3300026116 Bacteria 2992
294 Ga0207675_100004056 3300026118 Bacteria 14185
295 Ga0207675_100061552 3300026118 Bacteria 3504
296 Ga0207675_100348346 3300026118 Bacteria 1451
297 Ga0207683_10049353 3300026121 Bacteria 3684
298 Ga0207683_10050406 3300026121 Bacteria 3646
299 Ga0207683_10051178 3300026121 Bacteria 3619
300 Ga0207683_10053057 3300026121 Bacteria 3554
301 Ga0207683_10065640 3300026121 Bacteria 3200
302 Ga0207698_10042779 3300026142 Bacteria 3388
303 Ga0207698_10064772 3300026142 Bacteria 2866
304 Ga0207698_10170179 3300026142 Bacteria 1917
305 Ga0207698_10444468 3300026142 Bacteria 1250
306 Ga0209281_1000151 3300027111 Bacteria 167268
307 Ga0209389_1000341 3300027296 Bacteria 28381
308 Ga0209371_1010309 3300027312 Bacteria 2888
309 Ga0209970_1000149 3300027614 Bacteria 10736
310 Ga0209813_10010278 3300027866 Bacteria 2416
311 Ga0268266_10092469 3300028379 Bacteria 2654
312 Ga0268265_10064219 3300028380 Bacteria 2827
313 Ga0268265_10081788 3300028380 Bacteria 2551
314 Ga0268264_10003212 3300028381 Bacteria 14160
315 Ga0268264_10088646 3300028381 Bacteria 2663
316 Ga0307515_10000180 3300028794 Bacteria 156173
317 Ga0307515_10045204 3300028794 Bacteria 6772
318 Ga0268256_1024280 3300030500 Bacteria 1558
319 Ga0265332_10001588 3300031238 Bacteria 12450
320 Ga0307513_10156808 3300031456 Bacteria 2175
321 Ga0307509_10022299 3300031507 Bacteria 7144
322 Ga0307509_10023360 3300031507 Bacteria 6947
323 Ga0307408_100061065 3300031548 Bacteria 2750
324 Ga0307408_100206698 3300031548 Bacteria 1593
325 Ga0307508_10000185 3300031616 Bacteria 75407
326 Ga0307508_10007788 3300031616 Bacteria 9948
327 Ga0307508_10030181 3300031616 Bacteria 4899
328 Ga0265314_10005581 3300031711 Bacteria 11314
329 Ga0307516_10085767 3300031730 Bacteria 2986
330 Ga0307405_10018710 3300031731 Bacteria 3829
331 Ga0307410_10072561 3300031852 Bacteria 2391
332 Ga0307406_10160096 3300031901 Bacteria 1617
333 Ga0307407_10232145 3300031903 Bacteria 1254
334 Ga0307409_100009019 3300031995 Bacteria 6101
335 Ga0307416_100001658 3300032002 Bacteria 12289
336 Ga0307414_10067474 3300032004 Bacteria 2563
337 Ga0307507_10182644 3300033179 Bacteria 1495
338 Ga0307510_10139326 3300033180 Bacteria 2074
339 Ga0307510_10183981 3300033180 Bacteria 1647
340 Ga0373941_0044489 3300035115 Bacteria 1386
341 Ga0373927_0119436 3300035695 Bacteria 1720
342 Ga0373937_0031134 3300036401 Bacteria 4831
343 Ga0373925_0017081 3300037068 Bacteria 5253
344 Ga0373925_0021911 3300037068 Bacteria 4658
345 Ga0395899_0019534 3300037312 Bacteria 5146
346 Ga0395900_0020449 3300037418 Bacteria 6757
347 Ga0395898_0023453 3300037466 Bacteria 6235
348 Ga0395898_0031352 3300037466 Bacteria 5312
349 Ga0395905_0219062 3300037471 Bacteria 1781
350 Ga0395901_0022643 3300038443 Bacteria 6440
351 Ga0395901_0043687 3300038443 Bacteria 4648
352 Ga0395901_0110796 3300038443 Bacteria 2882
353 Ga0395901_0128565 3300038443 Bacteria 2663
354 Ga0436365_1162343 3300039437 Bacteria 1505
355 Ga0451800_1494131 3300041459 Bacteria 1264
356 Ga0451853_1461120 3300041512 Bacteria 1418
357 Ga0450919_000922 3300042121 Bacteria 3809
358 Ga0450890_000923 3300042127 Bacteria 4246
359 Ga0450903_001471 3300042138 Bacteria 4394
360 Ga0439460_0043761 3300042461 Bacteria 1324
361 Ga0450918_000006 3300042531 Bacteria 48279
362 Ga0451577_0011268 3300042876 Bacteria 8469
363 Ga0451577_0064634 3300042876 Bacteria 3263
364 Ga0451577_0301569 3300042876 Bacteria 1452
365 Ga0453683_0001628 3300044673 Bacteria 18851
366 Ga0453683_0002265 3300044673 Bacteria 15199
367 Ga0453684_0104785 3300044712 Bacteria 3451
368 Ga0453684_0213742 3300044712 Bacteria 2239
369 Ga0466957_0046630 3300044842 Bacteria 2632
370 Ga0466960_0053943 3300044901 Bacteria 1950
371 Ga0451576_0003704 3300045051 Bacteria 20672
372 Ga0451576_0024717 3300045051 Bacteria 6485
373 Ga0451576_0167776 3300045051 Bacteria 2291
374 Ga0451576_0224313 3300045051 Bacteria 1962
375 Ga0495632_0003352 3300046519 Bacteria 11415
376 Ga0495597_0060628 3300046542 Bacteria 1650
377 Ga0495668_0160579 3300046616 Bacteria 1231
378 Ga0495625_0132535 3300046660 Bacteria 1687
379 Ga0495647_0053229 3300046681 Bacteria 1578
380 Ga0495647_0059564 3300046681 Bacteria 1504
381 Ga0495658_0029832 3300046683 Bacteria 2956
382 Ga0495649_0010955 3300046694 Bacteria 5340
383 Ga0495687_007410 3300047443 Bacteria 6462
384 Ga0495687_011089 3300047443 Bacteria 4875
385 Ga0495687_012143 3300047443 Bacteria 4572
386 Ga0495593_0019618 3300047673 Bacteria 3790
387 Ga0496100_0246529 3300048903 Bacteria 1320
388 Ga0496102_0128835 3300048905 Bacteria 2367
389 Ga0496104_0154329 3300048907 Bacteria 2204
390 Ga0496105_0207307 3300048908 Bacteria 1599
391 Ga0496106_0020542 3300048909 Bacteria 4903
392 Ga0496107_0193969 3300048910 Bacteria 1509
393 Ga0496108_0052127 3300048911 Bacteria 3428
394 Ga0496108_0082967 3300048911 Bacteria 2718
395 Ga0496111_0206702 3300048914 Bacteria 1459
396 Ga0496114_0020191 3300048917 Bacteria 5406
397 Ga0496124_0006265 3300048927 Bacteria 13019
398 Ga0496126_0330408 3300048929 Bacteria 1251
399 Ga0501031_0005333 3300049568 Bacteria 8373
400 Ga0501038_0257970 3300049574 Bacteria 1379
401 Ga0501076_0395274 3300049592 Bacteria 1137
402 nmdc:mga03683_609_c1 3300050489 Bacteria 10290
403 nmdc:mga03n38_6905_c1 3300050490 Bacteria 3984
404 nmdc:mga03n38_7237_c1 3300050490 Bacteria 3916
405 nmdc:mga00v17_88412_c1 3300050491 Bacteria 1943
406 nmdc:mga00v17_92917_c1 3300050491 Bacteria 1897
407 nmdc:mga0yw44_3930_c1 3300050492 Bacteria 6709
408 nmdc:mga0k408_12667_c1 3300050493 Bacteria 4202
409 nmdc:mga0k408_17400_c1 3300050493 Bacteria 4005
410 nmdc:mga0k408_33712_c1 3300050493 Bacteria 2929
411 nmdc:mga0k408_34112_c1 3300050493 Bacteria 2913
412 nmdc:mga0k408_4344_c1 3300050493 Bacteria 7530
413 nmdc:mga0k408_63717_c1 3300050493 Bacteria 2145
414 nmdc:mga0k408_77561_c1 3300050493 Bacteria 1943
415 nmdc:mga0k408_935_c1 3300050493 Bacteria 15996
416 nmdc:mga06z11_1427_c1 3300050494 Bacteria 8882
417 nmdc:mga06z11_29430_c1 3300050494 Bacteria 2646
418 nmdc:mga07m45_23824_c1 3300050496 Bacteria 3348
419 nmdc:mga07m45_24323_c1 3300050496 Bacteria 3316
420 nmdc:mga07m45_33638_c1 3300050496 Bacteria 2848
421 nmdc:mga07m45_355_c1 3300050496 Bacteria 18707
422 nmdc:mga07m45_43921_c1 3300050496 Bacteria 2507
423 nmdc:mga07m45_44702_c1 3300050496 Bacteria 2486
424 nmdc:mga07m45_52189_c1 3300050496 Bacteria 2308
425 nmdc:mga07m45_75397_c1 3300050496 Bacteria 1922
426 nmdc:mga0rr50_88694_c1 3300050513 Bacteria 2403
427 nmdc:mga0sz30_24895_c1 3300050516 Bacteria 2446
428 Ga0495601_0199515 3300053077 Bacteria 1308
429 Ga0500568_0006808 3300053139 Bacteria 5696
430 Ga0500619_000016 3300053154 Bacteria 54289
431 Ga0500622_0003076 3300053156 Bacteria 11500
432 Ga0500645_022706 3300053730 Bacteria 1927
433 2644246514 2643221644 Bacteria 6865017
434 2644302871 2643221654 Bacteria 5273570
435 2831869307 2831864461 Bacteria 6502356
436 2886850583 2886848708 Bacteria 5632523
437 2928115650 2928115317 Bacteria 6477646
438 Ga0105242_10006564
439 rootL2_10013481
440 rootH1_10044193
441 rootH1_10044196
442 Ga0055526_1001752
443 Ga0055524_1000121
444 Ga0055524_1002354
445 Ga0055530_10000515
446 Ga0055540_1000001
447 Ga0055531_10000730
448 Ga0055531_10008874
449 Ga0055531_10012364
450 Ga0055531_10015992
451 Ga0055543_1004765
452 Ga0065165_1000016
453 Ga0065165_1002352
454 Ga0065707_10093354
455 Ga0070658_10137350
456 Ga0070658_10270173
457 Ga0070676_10031398
458 Ga0070683_100013208
459 Ga0070683_100186556
460 Ga0070690_100036884
461 Ga0070670_100008161
462 Ga0070670_100057570
463 Ga0070670_100101782
464 Ga0070670_100107001
465 Ga0070670_100111591
466 Ga0068869_100006018
467 Ga0068869_100068467
468 Ga0068869_100136426
469 Ga0070666_10005842
470 Ga0070680_100025391
471 Ga0068868_100025650
472 Ga0068868_100027684
473 Ga0068868_100044655
474 Ga0070660_100073646
475 Ga0070661_100015864
476 Ga0070668_100011100
477 Ga0070668_100039496
478 Ga0070669_100008914
479 Ga0070669_100055568
480 Ga0070675_100004779
481 Ga0070675_100010417
482 Ga0070675_100011548
483 Ga0070675_100017314
484 Ga0070675_100025466
485 Ga0070675_100169245
486 Ga0070675_100199901
487 Ga0070671_100008478
488 Ga0070671_100012328
489 Ga0070671_100035021
490 Ga0070671_100314021
491 Ga0070671_100342189
492 Ga0070674_100004964
493 Ga0070673_100007810
494 Ga0070673_100050422
495 Ga0070673_100065168
496 Ga0070673_100067571
497 Ga0070659_100005335
498 Ga0070667_100002053
499 Ga0070667_100015048
500 Ga0070667_100042339
501 Ga0070667_100117883
502 Ga0070667_100132163
503 Ga0070663_100049975
504 Ga0070678_100035116
505 Ga0070678_100132828
506 Ga0070662_100008631
507 Ga0070662_100012119
508 Ga0070662_100028919
509 Ga0068867_100006721
510 Ga0068867_100020479
511 Ga0068867_100043063
512 Ga0068867_100085295
513 Ga0068867_100255468
514 Ga0070679_100021665
515 Ga0070679_100042059
516 Ga0068853_100062068
517 Ga0068853_100113703
518 Ga0070672_100002031
519 Ga0070672_100007063
520 Ga0070672_100010437
521 Ga0070672_100080388
522 Ga0070672_100101071
523 Ga0070672_100247841
524 Ga0070664_100005762
525 Ga0070664_100016787
526 Ga0070664_100025177
527 Ga0070664_100128859
528 Ga0068857_100107336
529 Ga0068857_100190966
530 Ga0068854_100025152
531 Ga0068854_100043140
532 Ga0068856_100009753
533 Ga0068856_100215634
534 Ga0068852_100017004
535 Ga0068852_100037453
536 Ga0068852_100246599
537 Ga0068859_100226275
538 Ga0068864_100009971
539 Ga0068864_100020710
540 Ga0068864_100032590
541 Ga0068864_100173460
542 Ga0068866_10002843
543 Ga0068861_100001754
544 Ga0068851_10034263
545 Ga0068851_10147085
546 Ga0068863_100008147
547 Ga0068858_100029185
548 Ga0068858_100032464
549 Ga0068858_100035860
550 Ga0068860_100010210
551 Ga0068860_100012046
552 Ga0068862_100075506
553 Ga0068862_100281870
554 Ga0075368_10004315
555 Ga0075368_10024402
556 Ga0075368_10037262
557 Ga0075363_100025267
558 Ga0075364_10006775
559 Ga0075364_10063712
560 Ga0070715_10074880
561 Ga0075362_10010920
562 Ga0075362_10015345
563 Ga0075367_10013686
564 Ga0075367_10013850
565 Ga0075366_10004389
566 Ga0075366_10006193
567 Ga0075366_10020276
568 Ga0075366_10022784
569 Ga0075366_10027483
570 Ga0075366_10027485
571 Ga0075366_10041096
572 Ga0097621_100024414
573 Ga0097621_100041515
574 Ga0075370_10002177
575 Ga0075370_10013105
576 Ga0075370_10040870
577 Ga0075370_10045271
578 Ga0068871_100005973
579 Ga0068871_100006732
580 Ga0097620_100226278
581 Ga0099823_1000021
582 Ga0079104_1000001
583 Ga0105240_10002389
584 Ga0105240_10060597
585 Ga0105240_10148546
586 Ga0111539_10257504
587 Ga0105245_10123515
588 Ga0105243_10109870
589 Ga0105248_10010877
590 Ga0105248_10035875
591 Ga0105237_10001228
592 Ga0105237_10229268
593 Ga0105238_10038345
594 Ga0105238_10422771
595 Ga0105249_10068937
596 Ga0105239_10000942
597 Ga0157319_1000008
598 Ga0157371_10065465
599 Ga0157371_10194240
600 Ga0157370_10089028
601 Ga0157374_10012674
602 Ga0163162_10009814
603 Ga0163162_10015375
604 Ga0163162_10015380
605 Ga0163162_10162788
606 Ga0157372_10057881
607 Ga0157375_10039310
608 Ga0157375_10062939
609 Ga0157375_10093843
610 Ga0157375_10102612
611 Ga0157375_10158698
612 Ga0157375_10262258
613 Ga0163163_10180996
614 Ga0157380_10012326
615 Ga0157380_10047810
616 Ga0157377_10002823
617 Ga0157379_10022800
618 Ga0157379_10030462
619 Ga0157379_10043791
620 Ga0157379_10046178
621 Ga0157379_10096825
622 Ga0157379_10140733
623 Ga0157376_10010115
624 Ga0163161_10027884
625 Ga0209673_1011533
626 Ga0209673_1011821
627 Ga0209564_1000008
628 Ga0209050_1000934
629 Ga0209050_1010184
630 Ga0209256_1000015
631 Ga0209256_1001723
632 Ga0209256_1001935
633 Ga0209051_1000018
634 Ga0209051_1000244
635 Ga0209051_1002679
636 Ga0209257_1000084
637 Ga0209257_1000144
638 Ga0209257_1007729
639 Ga0209257_1012179
640 Ga0207642_10004772
641 Ga0207688_10205072
642 Ga0207680_10045362
643 Ga0207645_10003842
644 Ga0207645_10011283
645 Ga0207645_10023842
646 Ga0207645_10057865
647 Ga0207705_10122504
648 Ga0207707_10142327
649 Ga0207695_10011810
650 Ga0207671_10095082
651 Ga0207660_10071448
652 Ga0207660_10265729
653 Ga0207662_10002309
654 Ga0207662_10024514
655 Ga0207657_10017805
656 Ga0207649_10000359
657 Ga0207649_10145829
658 Ga0207652_10069211
659 Ga0207681_10004142
660 Ga0207681_10071729
661 Ga0207681_10072873
662 Ga0207650_10099348
663 Ga0207650_10121601
664 Ga0207659_10009237
665 Ga0207659_10038145
666 Ga0207659_10204037
667 Ga0207687_10240838
668 Ga0207644_10001574
669 Ga0207644_10015626
670 Ga0207644_10042686
671 Ga0207644_10057128
672 Ga0207644_10082148
673 Ga0207644_10087115
674 Ga0207644_10129042
675 Ga0207644_10135935
676 Ga0207644_10169155
677 Ga0207690_10018071
678 Ga0207706_10004316
679 Ga0207706_10058121
680 Ga0207706_10067354
681 Ga0207706_10071172
682 Ga0207706_10076876
683 Ga0207669_10029113
684 Ga0207669_10082043
685 Ga0207704_10023865
686 Ga0207691_10006932
687 Ga0207691_10007996
688 Ga0207691_10036430
689 Ga0207691_10083229
690 Ga0207711_10069139
691 Ga0207711_10085801
692 Ga0207689_10007087
693 Ga0207689_10009559
694 Ga0207689_10013353
695 Ga0207689_10023269
696 Ga0207679_10000047
697 Ga0207679_10040394
698 Ga0207651_10085580
699 Ga0207712_10150548
700 Ga0207668_10018589
701 Ga0207668_10029872
702 Ga0207640_10014714
703 Ga0207640_10026671
704 Ga0207640_10141546
705 Ga0207640_10330777
706 Ga0207658_10003013
707 Ga0207658_10003655
708 Ga0207658_10027918
709 Ga0207658_10033970
710 Ga0207677_10085727
711 Ga0207677_10107364
712 Ga0207703_10004035
713 Ga0207639_10060740
714 Ga0207639_10118892
715 Ga0207678_10006013
716 Ga0207641_10004568
717 Ga0207641_10037683
718 Ga0207641_10191199
719 Ga0207648_10002295
720 Ga0207648_10012908
721 Ga0207648_10015894
722 Ga0207648_10055444
723 Ga0207648_10074405
724 Ga0207648_10300577
725 Ga0207676_10008687
726 Ga0207676_10015345
727 Ga0207676_10043099
728 Ga0207676_10084831
729 Ga0207674_10078380
730 Ga0207674_10093640
731 Ga0207675_100004056
732 Ga0207675_100061552
733 Ga0207675_100348346
734 Ga0207683_10049353
735 Ga0207683_10050406
736 Ga0207683_10051178
737 Ga0207683_10053057
738 Ga0207683_10065640
739 Ga0207698_10042779
740 Ga0207698_10064772
741 Ga0207698_10170179
742 Ga0207698_10444468
743 Ga0209281_1000151
744 Ga0209389_1000341
745 Ga0209371_1010309
746 Ga0209970_1000149
747 Ga0209813_10010278
748 Ga0268266_10092469
749 Ga0268265_10064219
750 Ga0268265_10081788
751 Ga0268264_10003212
752 Ga0268264_10088646
753 Ga0307515_10000180
754 Ga0307515_10045204
755 Ga0268256_1024280
756 Ga0265332_10001588
757 Ga0307513_10156808
758 Ga0307509_10022299
759 Ga0307509_10023360
760 Ga0307408_100061065
761 Ga0307408_100206698
762 Ga0307508_10000185
763 Ga0307508_10007788
764 Ga0307508_10030181
765 Ga0265314_10005581
766 Ga0307516_10085767
767 Ga0307405_10018710
768 Ga0307410_10072561
769 Ga0307406_10160096
770 Ga0307407_10232145
771 Ga0307409_100009019
772 Ga0307416_100001658
773 Ga0307414_10067474
774 Ga0307507_10182644
775 Ga0307510_10139326
776 Ga0307510_10183981
777 Ga0373941_0044489
778 Ga0373927_0119436
779 Ga0373937_0031134
780 Ga0373925_0017081
781 Ga0373925_0021911
782 Ga0395899_0019534
783 Ga0395900_0020449
784 Ga0395898_0023453
785 Ga0395898_0031352
786 Ga0395905_0219062
787 Ga0395901_0022643
788 Ga0395901_0043687
789 Ga0395901_0110796
790 Ga0395901_0128565
791 Ga0436365_1162343
792 Ga0451800_1494131
793 Ga0451853_1461120
794 Ga0450919_000922
795 Ga0450890_000923
796 Ga0450903_001471
797 Ga0439460_0043761
798 Ga0450918_000006
799 Ga0451577_0011268
800 Ga0451577_0064634
801 Ga0451577_0301569
802 Ga0453683_0001628
803 Ga0453683_0002265
804 Ga0453684_0104785
805 Ga0453684_0213742
806 Ga0466957_0046630
807 Ga0466960_0053943
808 Ga0451576_0003704
809 Ga0451576_0024717
810 Ga0451576_0167776
811 Ga0451576_0224313
812 Ga0495632_0003352
813 Ga0495597_0060628
814 Ga0495668_0160579
815 Ga0495625_0132535
816 Ga0495647_0053229
817 Ga0495647_0059564
818 Ga0495658_0029832
819 Ga0495649_0010955
820 Ga0495687_007410
821 Ga0495687_011089
822 Ga0495687_012143
823 Ga0495593_0019618
824 Ga0496100_0246529
825 Ga0496102_0128835
826 Ga0496104_0154329
827 Ga0496105_0207307
828 Ga0496106_0020542
829 Ga0496107_0193969
830 Ga0496108_0052127
831 Ga0496108_0082967
832 Ga0496111_0206702
833 Ga0496114_0020191
834 Ga0496124_0006265
835 Ga0496126_0330408
836 Ga0501031_0005333
837 Ga0501038_0257970
838 Ga0501076_0395274
839 nmdc:mga03683_609_c1
840 nmdc:mga03n38_6905_c1
841 nmdc:mga03n38_7237_c1
842 nmdc:mga00v17_88412_c1
843 nmdc:mga00v17_92917_c1
844 nmdc:mga0yw44_3930_c1
845 nmdc:mga0k408_12667_c1
846 nmdc:mga0k408_17400_c1
847 nmdc:mga0k408_33712_c1
848 nmdc:mga0k408_34112_c1
849 nmdc:mga0k408_4344_c1
850 nmdc:mga0k408_63717_c1
851 nmdc:mga0k408_77561_c1
852 nmdc:mga0k408_935_c1
853 nmdc:mga06z11_1427_c1
854 nmdc:mga06z11_29430_c1
855 nmdc:mga07m45_23824_c1
856 nmdc:mga07m45_24323_c1
857 nmdc:mga07m45_33638_c1
858 nmdc:mga07m45_355_c1
859 nmdc:mga07m45_43921_c1
860 nmdc:mga07m45_44702_c1
861 nmdc:mga07m45_52189_c1
862 nmdc:mga07m45_75397_c1
863 nmdc:mga0rr50_88694_c1
864 nmdc:mga0sz30_24895_c1
865 Ga0495601_0199515
866 Ga0500568_0006808
867 Ga0500619_000016
868 Ga0500622_0003076
869 Ga0500645_022706
870 2644246514
871 2644302871
872 2831869307
873 2886850583
874 2928115650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00933

Glyco_hydro_3

Glycosyl hydrolase family 3 N terminal domain

15

334

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5utp-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to n-ethylbutyryl-pugnac 0.936 5 360
5utr-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to (3s,4r,5r,6s)-3-butyryl-4,5,6-trihydroxyazepane 0.9351 5 359
5utq-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to pugnac 0.9347 5 360
4gnv-assembly1.cif.gz_B crystal structure of beta-hexosaminidase 1 from burkholderia cenocepacia j2315 with bound n-acetyl-d-glucosamine 0.9311 2 359
5utq-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to pugnac 0.9301 5 359
ID Description Score Start End Superfamily
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9289 5 359 3.20.20.300
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9079 5 359 3.20.20.300
5g3rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9066 5 358 3.20.20.300
5g3rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.8785 5 358 3.20.20.300
2oxnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.8785 7 358 3.20.20.300
ID Description Score Start End GO Terms
AF-A0A1I7JMZ4-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9476 4 361 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555
AF-A0A836NTK4-F1-model_v4 deleted 0.9427 172 269
AF-A0A1I7JMZ4-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9424 4 361 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555
AF-A0A4V1UI10-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.941 111 361 GO:0005975
GO:0009254
GO:0016231
AF-A0A353R1M9-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.94 181 311 GO:0004553
GO:0005975
GO:0009254

Map