F443789

General Info

Members Datasets Scaffolds Average Seq Length
437 271 874 198

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_11011982|Ga0207658_110119821
Length 221
Sequence MATRRRLPPEQSRIAALEAARSLLIEAGPQAVTLKAVAARVHRTHANVLHHFGSAAGLQKELARHLAETVCTTIRDAVIASRSGIGSPRDVVDLTFDAFDKEGAGALASWMLLSGNEDALDPIVDAIHDLVVDLNDFGSEAQRSTTLSLTLMALGDALMGGPLSQSLELPRTAARDRAEQMLVEDMLRSGQLPEGSSTCIQPGTQPRQVEQEGRQQGAVVG

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
172 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
234 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
235 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
248 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
249 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
250 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
254 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
255 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
256 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
257 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
258 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
259 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
260 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
261 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
262 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
263 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
264 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
265 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
266 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
267 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
268 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
269 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
270 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
271 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 0
Isolates 4.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.56
Nodule 0.69
Rhizoplane 2.29
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_11011982 3300025986 Bacteria 758
2 SwRhRL2b_contig_3151502 2162886007 Bacteria 2265
3 JGI24752J21851_1000097 3300001976 Bacteria 11651
4 JGI24740J21852_10001256 3300001979 Bacteria 11472
5 JGI24739J22299_10006496 3300001989 Bacteria 4410
6 JGI24739J22299_10010510 3300001989 Bacteria 3436
7 JGI24737J22298_10007738 3300001990 Bacteria 3622
8 JGI24735J21928_10032687 3300002067 Bacteria 1539
9 JGI24750J21931_1000435 3300002070 Bacteria 6802
10 JGI24748J21848_1000042 3300002074 Bacteria 62376
11 JGI24748J21848_1000062 3300002074 Bacteria 40740
12 JGI24738J21930_10001264 3300002075 Bacteria 7088
13 JGI24738J21930_10005747 3300002075 Bacteria 2950
14 JGI24749J21850_1000167 3300002076 Bacteria 10507
15 JGI24034J26672_10000035 3300002239 Bacteria 85548
16 JGI24751J29686_10001238 3300002459 Bacteria 5401
17 JGI25153J46596_10000065 3300003215 Bacteria 124645
18 Ga0055536_1004558 3300003781 Bacteria 7037
19 Ga0055531_10006903 3300003794 Bacteria 6323
20 Ga0065704_10013311 3300005289 Bacteria 2741
21 Ga0070658_10000828 3300005327 Bacteria 26467
22 Ga0070658_10048493 3300005327 Bacteria 3439
23 Ga0070683_100070855 3300005329 Bacteria 3252
24 Ga0070683_100732175 3300005329 Bacteria 947
25 Ga0070683_100754771 3300005329 Bacteria 932
26 Ga0070690_100000009 3300005330 Bacteria 112447
27 Ga0070666_10000006 3300005335 Bacteria 319173
28 Ga0070680_100000284 3300005336 Bacteria 33748
29 Ga0070680_100631715 3300005336 Bacteria 920
30 Ga0068868_100069645 3300005338 Bacteria 2804
31 Ga0070660_100013836 3300005339 Bacteria 5803
32 Ga0070660_100082210 3300005339 Bacteria 2529
33 Ga0070660_100399450 3300005339 Bacteria 1136
34 Ga0070689_100026998 3300005340 Bacteria 4327
35 Ga0070661_100000345 3300005344 Bacteria 36834
36 Ga0070661_100488047 3300005344 Bacteria 985
37 Ga0070692_10098256 3300005345 Bacteria 1601
38 Ga0070668_100055459 3300005347 Bacteria 3059
39 Ga0070668_100174722 3300005347 Bacteria 1751
40 Ga0070668_100704563 3300005347 Bacteria 891
41 Ga0070669_100000095 3300005353 Bacteria 86930
42 Ga0070669_100020354 3300005353 Bacteria 4739
43 Ga0070671_100058573 3300005355 Bacteria 3206
44 Ga0070671_100544814 3300005355 Bacteria 1000
45 Ga0070674_100000262 3300005356 Bacteria 26193
46 Ga0070673_100019761 3300005364 Bacteria 4844
47 Ga0070688_100035475 3300005365 Bacteria 3030
48 Ga0070659_100007974 3300005366 Bacteria 7718
49 Ga0070659_100037984 3300005366 Bacteria 3754
50 Ga0070659_100243516 3300005366 Bacteria 1489
51 Ga0070667_100030502 3300005367 Bacteria 4497
52 Ga0070701_10179176 3300005438 Bacteria 1239
53 Ga0070708_100633053 3300005445 Bacteria 1008
54 Ga0070663_100134934 3300005455 Bacteria 1878
55 Ga0070678_100000992 3300005456 Bacteria 14678
56 Ga0070662_100000156 3300005457 Bacteria 39310
57 Ga0070662_100062080 3300005457 Bacteria 2729
58 Ga0070662_100218196 3300005457 Bacteria 1520
59 Ga0070662_100311059 3300005457 Bacteria 1282
60 Ga0070662_100326695 3300005457 Bacteria 1252
61 Ga0070662_100505452 3300005457 Bacteria 1008
62 Ga0070681_10069632 3300005458 Bacteria 3485
63 Ga0068867_100150212 3300005459 Bacteria 1829
64 Ga0070685_10000391 3300005466 Bacteria 26284
65 Ga0070679_100022055 3300005530 Bacteria 6220
66 Ga0070684_100671640 3300005535 Bacteria 965
67 Ga0068853_100000549 3300005539 Bacteria 25571
68 Ga0068853_100390219 3300005539 Bacteria 1301
69 Ga0068853_100555954 3300005539 Bacteria 1087
70 Ga0070672_100012043 3300005543 Bacteria 6053
71 Ga0070686_100000022 3300005544 Bacteria 131168
72 Ga0070665_100000019 3300005548 Bacteria 413972
73 Ga0070665_100026049 3300005548 Bacteria 5889
74 Ga0068855_100032350 3300005563 Bacteria 6246
75 Ga0068855_100254536 3300005563 Bacteria 1958
76 Ga0068855_100915703 3300005563 Unclassified 925
77 Ga0070664_100016466 3300005564 Bacteria 6061
78 Ga0070664_100086361 3300005564 Bacteria 2711
79 Ga0070664_100457410 3300005564 Bacteria 1172
80 Ga0068857_100029031 3300005577 Bacteria 4881
81 Ga0068857_100062183 3300005577 Bacteria 3319
82 Ga0068857_100863290 3300005577 Bacteria 866
83 Ga0068854_100033151 3300005578 Bacteria 3599
84 Ga0068854_100037124 3300005578 Bacteria 3418
85 Ga0068854_100062344 3300005578 Bacteria 2703
86 Ga0068854_100108096 3300005578 Bacteria 2094
87 Ga0068854_100145401 3300005578 Bacteria 1823
88 Ga0068856_100090107 3300005614 Bacteria 3051
89 Ga0068856_100097963 3300005614 Bacteria 2922
90 Ga0068852_100835472 3300005616 Bacteria 936
91 Ga0068852_101106631 3300005616 Bacteria 812
92 Ga0068859_100038075 3300005617 Bacteria 4826
93 Ga0068864_100021420 3300005618 Bacteria 5416
94 Ga0068861_100006310 3300005719 Bacteria 8070
95 Ga0068863_100000048 3300005841 Bacteria 135912
96 Ga0068858_100017934 3300005842 Bacteria 6629
97 Ga0068858_100049017 3300005842 Bacteria 3912
98 Ga0068860_100000014 3300005843 Bacteria 319437
99 Ga0068862_100000503 3300005844 Bacteria 41613
100 Ga0075368_10103196 3300006042 Bacteria 1172
101 Ga0075362_10000033 3300006177 Bacteria 50782
102 Ga0075362_10054303 3300006177 Bacteria 1800
103 Ga0075369_10004837 3300006186 Bacteria 5012
104 Ga0075369_10152115 3300006186 Bacteria 1058
105 Ga0075366_10000058 3300006195 Bacteria 40618
106 Ga0075366_10027754 3300006195 Bacteria 3322
107 Ga0075366_10354890 3300006195 Bacteria 900
108 Ga0075370_10000139 3300006353 Bacteria 24533
109 Ga0075370_10005075 3300006353 Bacteria 6489
110 Ga0075370_10029090 3300006353 Bacteria 3075
111 Ga0075370_10039996 3300006353 Bacteria 2644
112 Ga0075370_10104805 3300006353 Bacteria 1639
113 Ga0068871_100237543 3300006358 Bacteria 1583
114 Ga0097620_100038076 3300006931 Bacteria 4826
115 Ga0079104_1020976 3300006946 Bacteria 1788
116 Ga0079104_1037908 3300006946 Bacteria 1146
117 Ga0105250_10093738 3300009092 Bacteria 1223
118 Ga0105247_10031750 3300009101 Bacteria 3207
119 Ga0105243_10002024 3300009148 Bacteria 17214
120 Ga0105241_10087493 3300009174 Bacteria 2452
121 Ga0105241_11422911 3300009174 Bacteria 664
122 Ga0105242_10176950 3300009176 Bacteria 1879
123 Ga0105237_10009460 3300009545 Bacteria 10438
124 Ga0105249_10000104 3300009553 Bacteria 118213
125 Ga0105239_11233584 3300010375 Unclassified 862
126 Ga0157373_10021423 3300013100 Bacteria 4696
127 Ga0157371_10004757 3300013102 Bacteria 11711
128 Ga0157371_10103297 3300013102 Bacteria 2022
129 Ga0157371_10162486 3300013102 Bacteria 1595
130 Ga0157370_10005030 3300013104 Bacteria 14933
131 Ga0157370_10014795 3300013104 Bacteria 7963
132 Ga0157369_10003148 3300013105 Bacteria 19701
133 Ga0157369_10147549 3300013105 Bacteria 2487
134 Ga0157369_10597762 3300013105 Bacteria 1139
135 Ga0157374_10062917 3300013296 Bacteria 3479
136 Ga0157378_10032282 3300013297 Bacteria 4626
137 Ga0163162_10017371 3300013306 Bacteria 7037
138 Ga0163162_10306615 3300013306 Bacteria 1720
139 Ga0157372_10021983 3300013307 Bacteria 6896
140 Ga0157372_11360694 3300013307 Bacteria 819
141 Ga0157375_10176892 3300013308 Bacteria 2284
142 Ga0163163_10047485 3300014325 Bacteria 4221
143 Ga0157380_10029869 3300014326 Bacteria 4169
144 Ga0157380_10083655 3300014326 Bacteria 2615
145 Ga0157379_10340841 3300014968 Bacteria 1371
146 Ga0183363_1004 3300015690 Bacteria 416766
147 Ga0163161_10000020 3300017792 Bacteria 214642
148 Ga0163161_10130636 3300017792 Bacteria 1894
149 Ga0163161_10275387 3300017792 Bacteria 1318
150 Ga0207672_1000999 3300025223 Bacteria 2732
151 Ga0209676_1000085 3300025292 Bacteria 273425
152 Ga0209676_1002099 3300025292 Bacteria 15389
153 Ga0209676_1002536 3300025292 Bacteria 12713
154 Ga0209758_1000007 3300025297 Bacteria 1270410
155 Ga0209050_1039152 3300025298 Bacteria 1340
156 Ga0209050_1039982 3300025298 Bacteria 1314
157 Ga0209257_1000330 3300025304 Bacteria 99167
158 Ga0209257_1004946 3300025304 Bacteria 9775
159 Ga0207656_10222258 3300025321 Bacteria 918
160 Ga0207710_10146830 3300025900 Bacteria 1142
161 Ga0207680_10000011 3300025903 Bacteria 391225
162 Ga0207647_10001492 3300025904 Bacteria 17971
163 Ga0207705_10002481 3300025909 Bacteria 14213
164 Ga0207654_10000285 3300025911 Bacteria 30791
165 Ga0207654_10095779 3300025911 Bacteria 1819
166 Ga0207654_10358422 3300025911 Bacteria 1005
167 Ga0207707_10011840 3300025912 Bacteria 7586
168 Ga0207695_10002074 3300025913 Bacteria 30558
169 Ga0207660_10259353 3300025917 Bacteria 1374
170 Ga0207662_10190832 3300025918 Bacteria 1322
171 Ga0207657_10000139 3300025919 Bacteria 74245
172 Ga0207657_10041390 3300025919 Bacteria 4074
173 Ga0207649_10021646 3300025920 Bacteria 3705
174 Ga0207652_10002098 3300025921 Bacteria 17134
175 Ga0207681_10001112 3300025923 Bacteria 17445
176 Ga0207681_10413896 3300025923 Bacteria 1091
177 Ga0207694_10010872 3300025924 Bacteria 6871
178 Ga0207650_10243494 3300025925 Bacteria 1454
179 Ga0207650_10407549 3300025925 Bacteria 1126
180 Ga0207644_10024683 3300025931 Bacteria 4128
181 Ga0207690_10000043 3300025932 Bacteria 119547
182 Ga0207690_10384803 3300025932 Bacteria 1116
183 Ga0207706_10000403 3300025933 Bacteria 46590
184 Ga0207706_10023838 3300025933 Bacteria 5491
185 Ga0207706_10180349 3300025933 Bacteria 1855
186 Ga0207706_10355473 3300025933 Bacteria 1273
187 Ga0207709_10000109 3300025935 Bacteria 128086
188 Ga0207670_10008290 3300025936 Bacteria 5855
189 Ga0207669_10000048 3300025937 Bacteria 60914
190 Ga0207711_10031454 3300025941 Bacteria 4480
191 Ga0207661_10005251 3300025944 Bacteria 9112
192 Ga0207679_10001054 3300025945 Bacteria 17560
193 Ga0207679_10024460 3300025945 Bacteria 4141
194 Ga0207679_10068474 3300025945 Bacteria 2667
195 Ga0207679_10533781 3300025945 Bacteria 1051
196 Ga0207679_10819235 3300025945 Bacteria 849
197 Ga0207667_10001448 3300025949 Bacteria 29747
198 Ga0207667_10003746 3300025949 Bacteria 18739
199 Ga0207651_10059232 3300025960 Bacteria 2651
200 Ga0207712_10000013 3300025961 Bacteria 391208
201 Ga0207668_10045339 3300025972 Bacteria 2998
202 Ga0207668_10050542 3300025972 Bacteria 2866
203 Ga0207668_10168996 3300025972 Bacteria 1713
204 Ga0207640_10001279 3300025981 Bacteria 13673
205 Ga0207640_10044344 3300025981 Bacteria 2849
206 Ga0207640_10058695 3300025981 Bacteria 2536
207 Ga0207640_10095429 3300025981 Bacteria 2071
208 Ga0207640_10333555 3300025981 Bacteria 1212
209 Ga0207658_10001912 3300025986 Bacteria 15577
210 Ga0207677_10047664 3300026023 Bacteria 2879
211 Ga0207703_10007708 3300026035 Bacteria 8525
212 Ga0207703_10072667 3300026035 Bacteria 2844
213 Ga0207639_10029207 3300026041 Bacteria 4034
214 Ga0207678_10031526 3300026067 Bacteria 4624
215 Ga0207702_10002376 3300026078 Bacteria 17979
216 Ga0207702_10037709 3300026078 Bacteria 4047
217 Ga0207641_10000101 3300026088 Bacteria 122493
218 Ga0207648_10189900 3300026089 Bacteria 1820
219 Ga0207676_10004390 3300026095 Bacteria 9972
220 Ga0207674_10038821 3300026116 Bacteria 4940
221 Ga0207674_10070111 3300026116 Bacteria 3524
222 Ga0207674_10154107 3300026116 Bacteria 2253
223 Ga0207674_10241864 3300026116 Bacteria 1752
224 Ga0207675_100001593 3300026118 Bacteria 22726
225 Ga0207683_10000619 3300026121 Bacteria 32637
226 Ga0207698_10038551 3300026142 Bacteria 3532
227 Ga0207698_10459847 3300026142 Bacteria 1230
228 Ga0209281_1013662 3300027111 Bacteria 1745
229 Ga0209813_10113453 3300027866 Bacteria 936
230 Ga0209974_10002931 3300027876 Bacteria 6188
231 Ga0209974_10029377 3300027876 Bacteria 1821
232 Ga0207428_10016665 3300027907 Bacteria 6320
233 Ga0268266_10000025 3300028379 Bacteria 477143
234 Ga0268266_10012074 3300028379 Bacteria 7475
235 Ga0268265_10000345 3300028380 Bacteria 50171
236 Ga0268264_10000037 3300028381 Bacteria 391116
237 Ga0307408_100080920 3300031548 Bacteria 2427
238 Ga0307408_100163158 3300031548 Bacteria 1772
239 Ga0307408_100380637 3300031548 Bacteria 1206
240 Ga0307508_10134225 3300031616 Bacteria 2078
241 Ga0316579_10056668 3300031691 Bacteria 1840
242 Ga0316576_10495255 3300031727 Bacteria 899
243 Ga0307405_10001052 3300031731 Bacteria 11182
244 Ga0307405_10015626 3300031731 Bacteria 4117
245 Ga0307405_10112856 3300031731 Bacteria 1844
246 Ga0307413_10016033 3300031824 Bacteria 3857
247 Ga0307413_10129406 3300031824 Bacteria 1725
248 Ga0307413_10385405 3300031824 Bacteria 1093
249 Ga0307413_10427733 3300031824 Bacteria 1045
250 Ga0307413_10604697 3300031824 Bacteria 898
251 Ga0307413_10881433 3300031824 Bacteria 759
252 Ga0307413_11008480 3300031824 Bacteria 714
253 Ga0307410_10040018 3300031852 Bacteria 3082
254 Ga0307410_10964777 3300031852 Bacteria 733
255 Ga0307410_11134242 3300031852 Bacteria 679
256 Ga0307406_10020086 3300031901 Bacteria 3928
257 Ga0307407_10005198 3300031903 Bacteria 5618
258 Ga0307407_10017058 3300031903 Bacteria 3633
259 Ga0307412_10001766 3300031911 Bacteria 11941
260 Ga0307412_10008664 3300031911 Bacteria 5816
261 Ga0307412_10012968 3300031911 Bacteria 4872
262 Ga0307412_10034007 3300031911 Bacteria 3245
263 Ga0307412_10041231 3300031911 Bacteria 2991
264 Ga0307412_10081749 3300031911 Bacteria 2235
265 Ga0307412_10109657 3300031911 Bacteria 1968
266 Ga0307412_10673253 3300031911 Bacteria 885
267 Ga0307412_10947179 3300031911 Bacteria 757
268 Ga0307409_100048424 3300031995 Bacteria 3234
269 Ga0307409_100100218 3300031995 Bacteria 2401
270 Ga0307409_100332469 3300031995 Bacteria 1426
271 Ga0307416_100108935 3300032002 Bacteria 2435
272 Ga0307416_100131989 3300032002 Bacteria 2250
273 Ga0307416_100207195 3300032002 Bacteria 1866
274 Ga0307414_10001003 3300032004 Bacteria 14423
275 Ga0307414_10018173 3300032004 Bacteria 4320
276 Ga0307414_10032998 3300032004 Bacteria 3416
277 Ga0307414_10074385 3300032004 Bacteria 2461
278 Ga0307414_10146339 3300032004 Bacteria 1857
279 Ga0307411_10013932 3300032005 Bacteria 4457
280 Ga0307411_10049552 3300032005 Bacteria 2730
281 Ga0307411_10710934 3300032005 Bacteria 876
282 Ga0307411_10733841 3300032005 Bacteria 864
283 Ga0307415_100026625 3300032126 Bacteria 3651
284 Ga0316583_10016311 3300032133 Bacteria 2674
285 Ga0373948_0016568 3300034817 Bacteria 1364
286 Ga0373962_0031544 3300035242 Bacteria 1454
287 Ga0316582_0005313 3300036647 Bacteria 6618
288 Ga0395899_0036585 3300037312 Bacteria 3682
289 Ga0395901_0176651 3300038443 Bacteria 2240
290 Ga0395901_0543250 3300038443 Bacteria 1178
291 Ga0451804_0915340 3300041463 Bacteria 848
292 Ga0451841_1269037 3300041498 Bacteria 1498
293 Ga0439462_0000259 3300042015 Bacteria 9521
294 Ga0450912_000136 3300042116 Bacteria 2777
295 Ga0450909_040048 3300042185 Bacteria 720
296 Ga0495617_022582 3300046452 Bacteria 2127
297 Ga0495627_000094 3300046453 Bacteria 108256
298 Ga0495627_000391 3300046453 Bacteria 39764
299 Ga0495638_0024309 3300046460 Bacteria 3952
300 Ga0495584_0012799 3300046491 Bacteria 4280
301 Ga0495606_0008940 3300046507 Bacteria 8575
302 Ga0495610_0000886 3300046512 Bacteria 27808
303 Ga0495632_0000383 3300046519 Bacteria 42267
304 Ga0495637_0002713 3300046520 Bacteria 9645
305 Ga0495637_0008273 3300046520 Bacteria 5115
306 Ga0495643_0000030 3300046522 Bacteria 260229
307 Ga0495643_0001568 3300046522 Bacteria 20340
308 Ga0495648_0031192 3300046524 Bacteria 3513
309 Ga0495648_0069111 3300046524 Bacteria 2057
310 Ga0495663_0000003 3300046525 Bacteria 362694
311 Ga0495663_0005359 3300046525 Bacteria 3564
312 Ga0495663_0018448 3300046525 Bacteria 1987
313 Ga0495663_0091203 3300046525 Bacteria 993
314 Ga0495654_0002832 3300046530 Bacteria 10895
315 Ga0495654_0030907 3300046530 Bacteria 2721
316 Ga0495654_0075445 3300046530 Bacteria 1591
317 Ga0495654_0105977 3300046530 Bacteria 1288
318 Ga0495598_0011007 3300046537 Bacteria 2182
319 Ga0495621_0012673 3300046539 Bacteria 2632
320 Ga0495597_0179916 3300046542 Bacteria 855
321 Ga0495633_0000184 3300046558 Bacteria 81757
322 Ga0495633_0000892 3300046558 Bacteria 25551
323 Ga0495668_0000001 3300046616 Bacteria 1013420
324 Ga0495668_0008071 3300046616 Bacteria 6630
325 Ga0495668_0020715 3300046616 Bacteria 3779
326 Ga0495625_0012965 3300046660 Bacteria 6726
327 Ga0495625_0066693 3300046660 Bacteria 2535
328 Ga0495661_0041922 3300046665 Bacteria 2827
329 Ga0495670_0080581 3300046691 Bacteria 1658
330 Ga0495671_0000072 3300046692 Bacteria 97315
331 Ga0495589_0083919 3300046794 Bacteria 1548
332 Ga0495677_0011253 3300047445 Bacteria 3275
333 Ga0495673_0062601 3300047469 Bacteria 1589
334 Ga0495681_0000342 3300047470 Bacteria 36568
335 Ga0495681_0013807 3300047470 Bacteria 4670
336 Ga0495686_0010474 3300047472 Bacteria 6591
337 Ga0495686_0080443 3300047472 Bacteria 1991
338 Ga0496102_0005685 3300048905 Bacteria 10585
339 Ga0496103_0005125 3300048906 Bacteria 7889
340 Ga0496104_0238834 3300048907 Bacteria 1729
341 Ga0496104_0460455 3300048907 Bacteria 1183
342 Ga0496105_0194310 3300048908 Bacteria 1658
343 Ga0496107_0250489 3300048910 Bacteria 1318
344 Ga0496108_0016951 3300048911 Bacteria 5954
345 Ga0496111_0464172 3300048914 Bacteria 934
346 Ga0496116_0034167 3300048919 Bacteria 3593
347 Ga0496116_0127757 3300048919 Bacteria 1456
348 Ga0496117_0010620 3300048920 Bacteria 8354
349 Ga0496118_0003608 3300048921 Bacteria 19234
350 Ga0496118_0345669 3300048921 Bacteria 795
351 Ga0496119_0098922 3300048922 Bacteria 1642
352 Ga0496119_0275287 3300048922 Bacteria 839
353 Ga0496121_0003164 3300048924 Bacteria 23728
354 Ga0496122_0429596 3300048925 Bacteria 661
355 Ga0496123_0022534 3300048926 Bacteria 4850
356 Ga0496123_0126981 3300048926 Bacteria 1421
357 Ga0496123_0142276 3300048926 Bacteria 1309
358 Ga0496124_0000684 3300048927 Bacteria 55763
359 Ga0496124_0003283 3300048927 Bacteria 19954
360 Ga0496124_0068448 3300048927 Bacteria 2950
361 Ga0496124_0104359 3300048927 Bacteria 2292
362 Ga0496124_0170170 3300048927 Bacteria 1688
363 Ga0496125_0123305 3300048928 Bacteria 1842
364 Ga0496125_0162431 3300048928 Bacteria 1515
365 Ga0496126_0039568 3300048929 Bacteria 4374
366 Ga0496126_0055365 3300048929 Bacteria 3589
367 Ga0495678_019950 3300049459 Bacteria 2979
368 Ga0501034_0546355 3300049571 Bacteria 1068
369 Ga0501043_0411817 3300049579 Bacteria 1020
370 Ga0501047_0219504 3300049581 Bacteria 1758
371 Ga0501071_0392681 3300049587 Bacteria 1059
372 Ga0501035_0645312 3300049822 Bacteria 859
373 nmdc:mga03683_10513_c1 3300050489 Bacteria 3320
374 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
375 nmdc:mga03n38_321_c1 3300050490 Bacteria 11592
376 nmdc:mga0k408_25019_c1 3300050493 Bacteria 3378
377 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
378 nmdc:mga04h51_77760_c1 3300050495 Bacteria 1171
379 nmdc:mga07m45_2225_c1 3300050496 Bacteria 9063
380 nmdc:mga07m45_239852_c1 3300050496 Bacteria 1055
381 nmdc:mga07m45_28076_c1 3300050496 Bacteria 3105
382 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
383 nmdc:mga08x19_341964_c1 3300050514 Bacteria 1044
384 nmdc:mga0sz30_3304_c1 3300050516 Bacteria 5801
385 Ga0500643_000001 3300053087 Bacteria 1440111
386 Ga0500643_000375 3300053087 Bacteria 34881
387 Ga0500643_001505 3300053087 Bacteria 13338
388 Ga0500643_004643 3300053087 Bacteria 6131
389 Ga0500646_0093409 3300053090 Bacteria 935
390 Ga0500647_0063783 3300053091 Bacteria 1772
391 Ga0500556_0224395 3300053104 Bacteria 741
392 Ga0500562_076122 3300053108 Bacteria 907
393 Ga0500592_000309 3300053116 Bacteria 8400
394 Ga0500607_000107 3300053121 Bacteria 64565
395 Ga0500607_194429 3300053121 Bacteria 881
396 Ga0500608_000363 3300053122 Bacteria 17531
397 Ga0500618_062178 3300053125 Bacteria 840
398 Ga0500559_0000616 3300053136 Bacteria 24116
399 Ga0500559_0003627 3300053136 Bacteria 7551
400 Ga0500564_003611 3300053138 Bacteria 6031
401 Ga0500568_0001033 3300053139 Bacteria 19043
402 Ga0500590_007500 3300053148 Bacteria 5391
403 Ga0500604_0024794 3300053151 Bacteria 1720
404 Ga0500604_0029520 3300053151 Bacteria 1599
405 Ga0500604_0116077 3300053151 Bacteria 892
406 Ga0500616_0003455 3300053153 Bacteria 12047
407 Ga0500622_0000283 3300053156 Bacteria 51667
408 Ga0500624_000015 3300053157 Bacteria 161928
409 Ga0500627_0000017 3300053158 Bacteria 119507
410 Ga0500627_0000577 3300053158 Bacteria 9879
411 Ga0500637_0000400 3300053178 Bacteria 16532
412 Ga0500567_001935 3300053723 Bacteria 8600
413 Ga0500611_001109 3300053727 Bacteria 2864
414 Ga0500625_000019 3300053729 Bacteria 93445
415 Ga0500645_008480 3300053730 Bacteria 3507
416 Ga0500645_087201 3300053730 Bacteria 887
417 Ga0501084_0426097 3300054114 Bacteria 1122
418 2600227758 2599185359 Bacteria 4772316
419 2739649217 2739367664 Bacteria 4114334
420 2740027690 2739367865 Bacteria 4114482
421 2809062412 2808606401 Bacteria 4586670
422 2809078248 2808606404 Bacteria 4652788
423 2809082801 2808606405 Bacteria 4586632
424 2819714189 2818991466 Bacteria 4748179
425 2852654976 2852653556 Bacteria 4050083
426 2852681685 2852680915 Bacteria 4100189
427 2879166513 2879163058 Bacteria 4223965
428 2880522328 2880518877 Bacteria 5012590
429 2882807639 2882806704 Bacteria 3007728
430 2882808816 2882806704 Bacteria 3007728
431 2895884333 2895880812 Bacteria 11255272
432 2896255738 2896253425 Bacteria 3418029
433 2919709699 2919709256 Bacteria 4318106
434 2928530405 2928526807 Bacteria 4760224
435 2928968199 2928968154 Bacteria 4633371
436 3000865336 3000865235 Bacteria 3106258
437 8057102440 8057101203 Bacteria 5034064
438 Ga0207658_11011982
439 SwRhRL2b_contig_3151502
440 JGI24752J21851_1000097
441 JGI24740J21852_10001256
442 JGI24739J22299_10006496
443 JGI24739J22299_10010510
444 JGI24737J22298_10007738
445 JGI24735J21928_10032687
446 JGI24750J21931_1000435
447 JGI24748J21848_1000042
448 JGI24748J21848_1000062
449 JGI24738J21930_10001264
450 JGI24738J21930_10005747
451 JGI24749J21850_1000167
452 JGI24034J26672_10000035
453 JGI24751J29686_10001238
454 JGI25153J46596_10000065
455 Ga0055536_1004558
456 Ga0055531_10006903
457 Ga0065704_10013311
458 Ga0070658_10000828
459 Ga0070658_10048493
460 Ga0070683_100070855
461 Ga0070683_100732175
462 Ga0070683_100754771
463 Ga0070690_100000009
464 Ga0070666_10000006
465 Ga0070680_100000284
466 Ga0070680_100631715
467 Ga0068868_100069645
468 Ga0070660_100013836
469 Ga0070660_100082210
470 Ga0070660_100399450
471 Ga0070689_100026998
472 Ga0070661_100000345
473 Ga0070661_100488047
474 Ga0070692_10098256
475 Ga0070668_100055459
476 Ga0070668_100174722
477 Ga0070668_100704563
478 Ga0070669_100000095
479 Ga0070669_100020354
480 Ga0070671_100058573
481 Ga0070671_100544814
482 Ga0070674_100000262
483 Ga0070673_100019761
484 Ga0070688_100035475
485 Ga0070659_100007974
486 Ga0070659_100037984
487 Ga0070659_100243516
488 Ga0070667_100030502
489 Ga0070701_10179176
490 Ga0070708_100633053
491 Ga0070663_100134934
492 Ga0070678_100000992
493 Ga0070662_100000156
494 Ga0070662_100062080
495 Ga0070662_100218196
496 Ga0070662_100311059
497 Ga0070662_100326695
498 Ga0070662_100505452
499 Ga0070681_10069632
500 Ga0068867_100150212
501 Ga0070685_10000391
502 Ga0070679_100022055
503 Ga0070684_100671640
504 Ga0068853_100000549
505 Ga0068853_100390219
506 Ga0068853_100555954
507 Ga0070672_100012043
508 Ga0070686_100000022
509 Ga0070665_100000019
510 Ga0070665_100026049
511 Ga0068855_100032350
512 Ga0068855_100254536
513 Ga0068855_100915703
514 Ga0070664_100016466
515 Ga0070664_100086361
516 Ga0070664_100457410
517 Ga0068857_100029031
518 Ga0068857_100062183
519 Ga0068857_100863290
520 Ga0068854_100033151
521 Ga0068854_100037124
522 Ga0068854_100062344
523 Ga0068854_100108096
524 Ga0068854_100145401
525 Ga0068856_100090107
526 Ga0068856_100097963
527 Ga0068852_100835472
528 Ga0068852_101106631
529 Ga0068859_100038075
530 Ga0068864_100021420
531 Ga0068861_100006310
532 Ga0068863_100000048
533 Ga0068858_100017934
534 Ga0068858_100049017
535 Ga0068860_100000014
536 Ga0068862_100000503
537 Ga0075368_10103196
538 Ga0075362_10000033
539 Ga0075362_10054303
540 Ga0075369_10004837
541 Ga0075369_10152115
542 Ga0075366_10000058
543 Ga0075366_10027754
544 Ga0075366_10354890
545 Ga0075370_10000139
546 Ga0075370_10005075
547 Ga0075370_10029090
548 Ga0075370_10039996
549 Ga0075370_10104805
550 Ga0068871_100237543
551 Ga0097620_100038076
552 Ga0079104_1020976
553 Ga0079104_1037908
554 Ga0105250_10093738
555 Ga0105247_10031750
556 Ga0105243_10002024
557 Ga0105241_10087493
558 Ga0105241_11422911
559 Ga0105242_10176950
560 Ga0105237_10009460
561 Ga0105249_10000104
562 Ga0105239_11233584
563 Ga0157373_10021423
564 Ga0157371_10004757
565 Ga0157371_10103297
566 Ga0157371_10162486
567 Ga0157370_10005030
568 Ga0157370_10014795
569 Ga0157369_10003148
570 Ga0157369_10147549
571 Ga0157369_10597762
572 Ga0157374_10062917
573 Ga0157378_10032282
574 Ga0163162_10017371
575 Ga0163162_10306615
576 Ga0157372_10021983
577 Ga0157372_11360694
578 Ga0157375_10176892
579 Ga0163163_10047485
580 Ga0157380_10029869
581 Ga0157380_10083655
582 Ga0157379_10340841
583 Ga0183363_1004
584 Ga0163161_10000020
585 Ga0163161_10130636
586 Ga0163161_10275387
587 Ga0207672_1000999
588 Ga0209676_1000085
589 Ga0209676_1002099
590 Ga0209676_1002536
591 Ga0209758_1000007
592 Ga0209050_1039152
593 Ga0209050_1039982
594 Ga0209257_1000330
595 Ga0209257_1004946
596 Ga0207656_10222258
597 Ga0207710_10146830
598 Ga0207680_10000011
599 Ga0207647_10001492
600 Ga0207705_10002481
601 Ga0207654_10000285
602 Ga0207654_10095779
603 Ga0207654_10358422
604 Ga0207707_10011840
605 Ga0207695_10002074
606 Ga0207660_10259353
607 Ga0207662_10190832
608 Ga0207657_10000139
609 Ga0207657_10041390
610 Ga0207649_10021646
611 Ga0207652_10002098
612 Ga0207681_10001112
613 Ga0207681_10413896
614 Ga0207694_10010872
615 Ga0207650_10243494
616 Ga0207650_10407549
617 Ga0207644_10024683
618 Ga0207690_10000043
619 Ga0207690_10384803
620 Ga0207706_10000403
621 Ga0207706_10023838
622 Ga0207706_10180349
623 Ga0207706_10355473
624 Ga0207709_10000109
625 Ga0207670_10008290
626 Ga0207669_10000048
627 Ga0207711_10031454
628 Ga0207661_10005251
629 Ga0207679_10001054
630 Ga0207679_10024460
631 Ga0207679_10068474
632 Ga0207679_10533781
633 Ga0207679_10819235
634 Ga0207667_10001448
635 Ga0207667_10003746
636 Ga0207651_10059232
637 Ga0207712_10000013
638 Ga0207668_10045339
639 Ga0207668_10050542
640 Ga0207668_10168996
641 Ga0207640_10001279
642 Ga0207640_10044344
643 Ga0207640_10058695
644 Ga0207640_10095429
645 Ga0207640_10333555
646 Ga0207658_10001912
647 Ga0207677_10047664
648 Ga0207703_10007708
649 Ga0207703_10072667
650 Ga0207639_10029207
651 Ga0207678_10031526
652 Ga0207702_10002376
653 Ga0207702_10037709
654 Ga0207641_10000101
655 Ga0207648_10189900
656 Ga0207676_10004390
657 Ga0207674_10038821
658 Ga0207674_10070111
659 Ga0207674_10154107
660 Ga0207674_10241864
661 Ga0207675_100001593
662 Ga0207683_10000619
663 Ga0207698_10038551
664 Ga0207698_10459847
665 Ga0209281_1013662
666 Ga0209813_10113453
667 Ga0209974_10002931
668 Ga0209974_10029377
669 Ga0207428_10016665
670 Ga0268266_10000025
671 Ga0268266_10012074
672 Ga0268265_10000345
673 Ga0268264_10000037
674 Ga0307408_100080920
675 Ga0307408_100163158
676 Ga0307408_100380637
677 Ga0307508_10134225
678 Ga0316579_10056668
679 Ga0316576_10495255
680 Ga0307405_10001052
681 Ga0307405_10015626
682 Ga0307405_10112856
683 Ga0307413_10016033
684 Ga0307413_10129406
685 Ga0307413_10385405
686 Ga0307413_10427733
687 Ga0307413_10604697
688 Ga0307413_10881433
689 Ga0307413_11008480
690 Ga0307410_10040018
691 Ga0307410_10964777
692 Ga0307410_11134242
693 Ga0307406_10020086
694 Ga0307407_10005198
695 Ga0307407_10017058
696 Ga0307412_10001766
697 Ga0307412_10008664
698 Ga0307412_10012968
699 Ga0307412_10034007
700 Ga0307412_10041231
701 Ga0307412_10081749
702 Ga0307412_10109657
703 Ga0307412_10673253
704 Ga0307412_10947179
705 Ga0307409_100048424
706 Ga0307409_100100218
707 Ga0307409_100332469
708 Ga0307416_100108935
709 Ga0307416_100131989
710 Ga0307416_100207195
711 Ga0307414_10001003
712 Ga0307414_10018173
713 Ga0307414_10032998
714 Ga0307414_10074385
715 Ga0307414_10146339
716 Ga0307411_10013932
717 Ga0307411_10049552
718 Ga0307411_10710934
719 Ga0307411_10733841
720 Ga0307415_100026625
721 Ga0316583_10016311
722 Ga0373948_0016568
723 Ga0373962_0031544
724 Ga0316582_0005313
725 Ga0395899_0036585
726 Ga0395901_0176651
727 Ga0395901_0543250
728 Ga0451804_0915340
729 Ga0451841_1269037
730 Ga0439462_0000259
731 Ga0450912_000136
732 Ga0450909_040048
733 Ga0495617_022582
734 Ga0495627_000094
735 Ga0495627_000391
736 Ga0495638_0024309
737 Ga0495584_0012799
738 Ga0495606_0008940
739 Ga0495610_0000886
740 Ga0495632_0000383
741 Ga0495637_0002713
742 Ga0495637_0008273
743 Ga0495643_0000030
744 Ga0495643_0001568
745 Ga0495648_0031192
746 Ga0495648_0069111
747 Ga0495663_0000003
748 Ga0495663_0005359
749 Ga0495663_0018448
750 Ga0495663_0091203
751 Ga0495654_0002832
752 Ga0495654_0030907
753 Ga0495654_0075445
754 Ga0495654_0105977
755 Ga0495598_0011007
756 Ga0495621_0012673
757 Ga0495597_0179916
758 Ga0495633_0000184
759 Ga0495633_0000892
760 Ga0495668_0000001
761 Ga0495668_0008071
762 Ga0495668_0020715
763 Ga0495625_0012965
764 Ga0495625_0066693
765 Ga0495661_0041922
766 Ga0495670_0080581
767 Ga0495671_0000072
768 Ga0495589_0083919
769 Ga0495677_0011253
770 Ga0495673_0062601
771 Ga0495681_0000342
772 Ga0495681_0013807
773 Ga0495686_0010474
774 Ga0495686_0080443
775 Ga0496102_0005685
776 Ga0496103_0005125
777 Ga0496104_0238834
778 Ga0496104_0460455
779 Ga0496105_0194310
780 Ga0496107_0250489
781 Ga0496108_0016951
782 Ga0496111_0464172
783 Ga0496116_0034167
784 Ga0496116_0127757
785 Ga0496117_0010620
786 Ga0496118_0003608
787 Ga0496118_0345669
788 Ga0496119_0098922
789 Ga0496119_0275287
790 Ga0496121_0003164
791 Ga0496122_0429596
792 Ga0496123_0022534
793 Ga0496123_0126981
794 Ga0496123_0142276
795 Ga0496124_0000684
796 Ga0496124_0003283
797 Ga0496124_0068448
798 Ga0496124_0104359
799 Ga0496124_0170170
800 Ga0496125_0123305
801 Ga0496125_0162431
802 Ga0496126_0039568
803 Ga0496126_0055365
804 Ga0495678_019950
805 Ga0501034_0546355
806 Ga0501043_0411817
807 Ga0501047_0219504
808 Ga0501071_0392681
809 Ga0501035_0645312
810 nmdc:mga03683_10513_c1
811 nmdc:mga03683_32_c1
812 nmdc:mga03n38_321_c1
813 nmdc:mga0k408_25019_c1
814 nmdc:mga0k408_7_c1
815 nmdc:mga04h51_77760_c1
816 nmdc:mga07m45_2225_c1
817 nmdc:mga07m45_239852_c1
818 nmdc:mga07m45_28076_c1
819 nmdc:mga07m45_3_c1
820 nmdc:mga08x19_341964_c1
821 nmdc:mga0sz30_3304_c1
822 Ga0500643_000001
823 Ga0500643_000375
824 Ga0500643_001505
825 Ga0500643_004643
826 Ga0500646_0093409
827 Ga0500647_0063783
828 Ga0500556_0224395
829 Ga0500562_076122
830 Ga0500592_000309
831 Ga0500607_000107
832 Ga0500607_194429
833 Ga0500608_000363
834 Ga0500618_062178
835 Ga0500559_0000616
836 Ga0500559_0003627
837 Ga0500564_003611
838 Ga0500568_0001033
839 Ga0500590_007500
840 Ga0500604_0024794
841 Ga0500604_0029520
842 Ga0500604_0116077
843 Ga0500616_0003455
844 Ga0500622_0000283
845 Ga0500624_000015
846 Ga0500627_0000017
847 Ga0500627_0000577
848 Ga0500637_0000400
849 Ga0500567_001935
850 Ga0500611_001109
851 Ga0500625_000019
852 Ga0500645_008480
853 Ga0500645_087201
854 Ga0501084_0426097
855 2600227758
856 2739649217
857 2740027690
858 2809062412
859 2809078248
860 2809082801
861 2819714189
862 2852654976
863 2852681685
864 2879166513
865 2880522328
866 2882807639
867 2882808816
868 2895884333
869 2896255738
870 2919709699
871 2928530405
872 2928968199
873 3000865336
874 8057102440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

16

62

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cdl-assembly1.cif.gz_B crystal structure of a tetr family transcriptional regulator from pseudomonas syringae pv. tomato str. dc3000 0.8759 8 59
3qkx-assembly1.cif.gz_B crystal structure of a tetr-family transcriptional regulator (hi0893) from haemophilus influenzae rd at 2.35 a resolution 0.778 14 91
3qkx-assembly1.cif.gz_A crystal structure of a tetr-family transcriptional regulator (hi0893) from haemophilus influenzae rd at 2.35 a resolution 0.7275 7 91
4pxi-assembly1.cif.gz_B elucidation of the structural and functional mechanism of action of the tetr family protein, cprb from s. coelicolor a3(2) 0.7025 8 87
1ui6-assembly1.cif.gz_B crystal structure of gamma-butyrolactone receptor (arpa-like protein) 0.6959 9 100
ID Description Score Start End Superfamily
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9315 14 62 1.10.10.60
3fiwA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9306 14 61 1.10.10.60
3dcfB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9255 12 53 1.10.10.60
3fiwC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9241 14 62 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9191 12 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2S4THS3-F1-model_v4 deleted 0.9404 1 66
AF-A0A3B0RAN5-F1-model_v4 Transcriptional regulator, AcrR family 0.9387 1 64 GO:0003677
AF-A0A3A8SI54-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9148 1 73 GO:0000976
GO:0003700
AF-A0A2S4THS3-F1-model_v4 deleted 0.913 1 66
AF-A0A3B0RAN5-F1-model_v4 Transcriptional regulator, AcrR family 0.9109 1 64 GO:0003677

Map